(data stored in ACNUC30630 zone)

EMBL: FP565814.PE75

FP565814.PE75        Location/Qualifiers
FT   CDS_pept        80398..80790
FT                   /transl_table=11
FT                   /locus_tag="SRM_00075"
FT                   /product="PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00075"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22996"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P1"
FT                   /protein_id="CBH22996.1"
FT                   /translation="MKVVIDTSAIIAVVLGEEHRDRIIRQTEGADLIAPETLHWEVGNA
FT                   FSAMFKRDRLGLDAAVEALRRYDEIPIQWVEVALDDALRVSDRHDLYAYDAYMLVAARR
FT                   HQAPLLTLDEGLKEAARESDIDLLEV"
     atgaaagttg tcatcgatac ttccgccatc atcgccgttg tgttgggtga agagcaccgg        60
     gaccggatca tccgacagac ggagggagcc gacctgattg cgccggagac gcttcattgg       120
     gaggtgggaa atgctttctc ggcgatgttt aagcgggatc gtctcggtct ggatgcggcc       180
     gtagaggccc tccggcgata cgacgagatt ccgatccagt gggtggaggt ggcgttggac       240
     gatgcccttc gtgtttccga tcggcacgat ctctatgcat atgacgccta catgctcgtc       300
     gccgcgaggc gccatcaggc gccgctcttg acgctggatg aagggctgaa ggaggcagct       360
     cgcgaatccg acatcgatct tttggaggtg tag                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page