(data stored in ACNUC30630 zone)

EMBL: FP565814.PE81

FP565814.PE81        Location/Qualifiers
FT   CDS_pept        complement(87566..88510)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00081"
FT                   /product="conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23002"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P7"
FT                   /protein_id="CBH23002.1"
FT                   /translation="MPLRSLPLAPPHRLVIGGALLLVVALGVTGCGTGDSSSSPAANVV
FT                   LEDEVERRVADARNRLSQNEGGQRLLRAIEAHGGLPAWHRAPTSSYTWTYANKGADLRF
FT                   KSFLVVDNRTRRAYHDLLAVGAYDDARPVDARFAWTGERAWIAPASLKRPNPRFWALTG
FT                   FYFQQIPFVLADPGARYEALPDDSIDGTPHDMVRVTFGKNVGDSPDDTYILYLDKETGR
FT                   VDAIRYTVSYGREVGADADLPQTFFDYQDYVTVDGLTVPTRFEGYAYDEDDGPGDALRN
FT                   EAVADSISYRRSFDASKLEPPKNARVVSLPDET"
     atgccacttc gttcccttcc cctcgccccg ccccaccgcc tcgtcatcgg gggcgcgctc        60
     ctgctcgtcg tcgcgctcgg ggtgacgggc tgcggcaccg gagactcgtc gtcgtccccg       120
     gcggcaaacg tcgtgctcga ggacgaggtg gagcggcggg ttgcggacgc ccggaaccgg       180
     ctttcccaga acgagggcgg gcagcgcctc ctccgggcca tcgaggccca cggcgggctc       240
     ccggcgtggc accgggcccc gaccagctcc tacacctgga cctacgccaa caaaggggcc       300
     gacctccgct tcaaatcctt tctcgtcgtc gacaaccgca cgcgccgcgc ctaccacgac       360
     ctcttggcgg tgggggcgta cgacgacgcc cggccggtgg acgcccgctt tgcgtggacc       420
     ggggagcggg cgtggatcgc gccggcctcc ctcaagcgcc ccaacccccg cttctgggca       480
     ctgaccggct tctacttcca gcagatcccg ttcgtcctgg ccgaccccgg cgcccggtac       540
     gaggccctcc cggacgactc gatcgacggc acgccccacg acatggtgcg ggtcacgttt       600
     ggaaagaacg tgggcgactc gcccgacgat acgtacatcc tctacctcga caaggagacc       660
     ggacgggtcg acgccatccg gtacacggta agctacgggc gcgaggtggg ggccgacgcg       720
     gacctccccc agacgttttt cgactatcag gactacgtga ccgtcgacgg cctgacggtg       780
     cccactcggt tcgagggcta cgcgtacgac gaggacgacg ggcccggcga tgcgctccgc       840
     aatgaggccg tcgccgacag catttcgtac cgccgctcgt tcgacgcgtc aaagctggag       900
     ccgccgaaaa acgcgcgggt tgtatcgctt ccggacgaga cgtaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page