(data stored in ACNUC30630 zone)

EMBL: FP565814.RECF

FP565814.RECF        Location/Qualifiers
FT   CDS_pept        71724..72962
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SRM_00068"
FT                   /product="DNA replication and repair protein recF"
FT                   /function="The recF protein is involved in DNA metabolism;
FT                   it is required for DNA replication and normal SOS
FT                   inducibility. RecF binds preferentially to single-
FT                   stranded, linear DNA. It also seems to bind ATP."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00068"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22989"
FT                   /db_xref="GOA:D5H4N4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N4"
FT                   /protein_id="CBH22989.1"
FT                   /translation="MILHTLRLRSFRAHAESEFDLAPSINLLYGANGAGKTNVLEAVHY
FT                   LCLTKSFTASRDRYAVRKDAPYFEIEGRIGQVREEPMTVRLAYVPGEGKSIFVNGAELD
FT                   RLADIVGTLPVVVFSPEDYDLTAGGPSERRRFVNNILSQARSVYMETLMKYRRARRQRN
FT                   EVLRSYKKRSAPPPDELLAPWTEKLVGLGSRIVHRRQQFLQAFADDLEEAYRRIDAVAE
FT                   RPTIEYDTIADLAPDATPDAIEDAFRAALARKQGQERDRGTTLVGPQRDELVFRLDDLE
FT                   VRRYGSQGQHRTFAMALKLAQYFYLQQRNDTEPLLLLDDAFGKLDAERTGVFLDLLRSD
FT                   AVGQSLVTATRRGPFEPALNAEPASHRALQVRPGGGTAAVAPDPEYARGEATAANGAAS
FT                   APTGADAASTSRD"
     atgattctgc acacccttcg cctccggtcg ttccgggccc acgcggagag cgagttcgac        60
     ctcgccccgt cgatcaacct cctctacggg gccaacgggg cgggcaagac gaacgtcctg       120
     gaggcggttc actacctgtg cctcaccaag agctttacgg cctcgcgaga ccggtatgcc       180
     gtccgcaaag acgcgcccta cttcgagatt gaaggccgca tcgggcaggt ccgcgaggag       240
     ccgatgaccg tgcggctggc gtacgtgccg ggcgagggca agagcatctt cgtaaacggc       300
     gcggagctcg accggctggc ggacatcgtc ggcacgctgc cggtggttgt cttctcgccg       360
     gaggactacg acctgacggc cggcgggccc agcgagcggc gccgcttcgt caacaacatc       420
     ctcagccagg cgcggtccgt ctacatggag acgctgatga agtaccgtcg cgcgcggcgc       480
     cagcgcaacg aggtgctccg cagctacaag aagcggtccg ccccgccgcc cgacgagctc       540
     ctggccccct ggacggaaaa gctcgtcggg ctcggcagcc gcatcgtgca ccggcgccag       600
     cagttcctgc aggcgttcgc ggacgacctc gaagaggcgt accgccgcat cgacgcggtg       660
     gccgagcggc ccacgatcga gtacgacacg attgcggacc tggcccccga cgcgacgccc       720
     gacgccatcg aagacgcatt ccgggcggcc ctcgcccgca agcaggggca ggaacgagac       780
     cgcggcacca ccctcgtggg gccgcagcgg gacgagctcg tcttccgcct cgacgacctg       840
     gaggtgcgcc ggtacggctc gcagggccag caccgcacct ttgccatggc cctcaagctg       900
     gcgcagtact tctacctgca acagcggaac gacaccgagc cgctgctgct gctcgacgac       960
     gccttcggca agctcgacgc ggagcgcacc ggggtcttcc tcgacctcct ccggtcggac      1020
     gccgtggggc agagcctcgt caccgccact cgccgggggc ccttcgagcc ggccctcaac      1080
     gcagagcccg cgtcgcaccg tgccctgcag gtccgcccgg gcggcgggac ggcggcggtg      1140
     gcgccggatc cggagtacgc ccggggagag gcgacggccg ccaacggcgc ggcgtcggcg      1200
     cccacagggg ctgacgcggc gtccacgtcc cgcgactag                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page