(data stored in ACNUC30630 zone)

EMBL: FP565814.RIBA

FP565814.RIBA        Location/Qualifiers
FT   CDS_pept        11375..12622
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="SRM_00013"
FT                   /product="Riboflavin biosynthesis protein ribA"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00013"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22934"
FT                   /db_xref="GOA:D5H4H9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H9"
FT                   /protein_id="CBH22934.1"
FT                   /translation="MSSSPSSSSPSSEKPFDTIEDALATIRDGGLAIVVDDEDRENEGD
FT                   FIGAAEAMTPDLVNFMTKEGRGLLCTAIPPERAEELDLDLMVDANSSLYSTPFTVSVDY
FT                   RQGTSTGISAADRAKTIRALADPDASPYDFARPGHVFPLRARTGGVLRRAGHTEAAVDL
FT                   ARLAGLEPAGALVEIMNEDGSMARVPQLRERAQALDMPLITIQDLIAYRMQNERLIERA
FT                   AEVDLDTAFGTFQVVAYEETLTGDVHLALLKGDWAEDEPVLVRVHSQNVLGDVLAARRE
FT                   SYSEELAEALLQVEHEGTGAILYMMQSNHGQGLLSKLKDLERHQNQDDGAPTDVSLEMD
FT                   HRDYGIGCQILRDLGIRKLRLLTNNPRKRIGLAGYGLELVEQTPIELPTEARDHLSTVA
FT                   ADRLTPLLMELIDAGT"
     atgagttctt cccccagcag ttcctccccg tcttcggaaa agcccttcga caccatcgaa        60
     gacgccctcg ctaccatccg ggacggcggg ctcgcgattg tcgtagacga cgaagatcga       120
     gaaaacgaag gcgacttcat cggagcggcc gaggccatga cgcccgacct cgtcaacttc       180
     atgacgaagg aaggacgcgg cctcctctgc acggccatcc cgcctgagcg ggccgaggag       240
     ctggacctcg acctaatggt cgacgccaac tcgtcgctct acagcacccc ctttaccgtc       300
     tcggtcgact accgccaggg cacgagcacc ggcatctcgg cggcggaccg tgcaaagacg       360
     atccgtgccc tggccgaccc ggacgcctct ccgtacgact ttgcccgccc cgggcacgtc       420
     tttccgcttc gggcccgcac gggaggggtt ctgcggcgtg caggacacac cgaggcggcc       480
     gtggaccttg cccgcctcgc cggcctggaa ccggccgggg ccctcgtcga gattatgaac       540
     gaggacggga gcatggcccg cgttcctcaa ctccgcgagc gggcccaggc cctggacatg       600
     ccgctcatca cgatccagga cctgattgcc taccgcatgc agaacgagcg gctcatcgag       660
     cgggcggcgg aagtggacct ggacaccgcg ttcggcacct tccaggtcgt cgcctacgag       720
     gagacactca ccggcgacgt acacctggcc ctgctcaagg gcgactgggc cgaggacgag       780
     cccgtcctcg ttcgcgtaca ctcccagaat gtgctggggg acgtgctcgc cgcacggcgc       840
     gaatcgtaca gcgaagaatt ggccgaggcc ctgctccagg tggagcacga aggcacgggc       900
     gccattctct acatgatgca gagcaatcac ggccagggcc tcctctcgaa actcaaggat       960
     ctggagcgcc atcagaacca ggacgacggg gcgcccacgg acgtgtcgct cgagatggac      1020
     caccgcgact acggcatcgg gtgccagatt ctccgggacc tcggcattcg caagctccga      1080
     ctcctcacca acaatccccg aaagcgaatc gggctggccg ggtacggcct cgagctcgtc      1140
     gaacagacgc cgatcgaatt gcccacggag gcccgagacc acctgtcaac cgtcgcggcg      1200
     gaccggctca cgccccttct catggagctc atcgacgccg gcacatag                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page