(data stored in ACNUC30630 zone)

EMBL: FP565814.RPMF

FP565814.RPMF        Location/Qualifiers
FT   CDS_pept        36647..36844
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="SRM_00038"
FT                   /product="Ribosomal L32p protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00038"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22959"
FT                   /db_xref="GOA:D5H4K4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K4"
FT                   /protein_id="CBH22959.1"
FT                   /translation="MAVPKRRHSKSRTRKRRSTYYNELEPPQLMECNNCGNPKVMHRAC
FT                   KHCGHYRGRQVIEPSDELIA"
     atggctgtcc cgaaacgacg acattcgaag tcgcgcaccc gaaagcgccg ctcgacctat        60
     tacaatgagt tggagccccc ccagctcatg gagtgcaaca actgtggcaa cccgaaggtg       120
     atgcaccggg cgtgcaagca ctgcgggcac taccgcggcc gtcaggttat cgagccgtcc       180
     gacgagctga tcgcgtag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page