(data stored in ACNUC30630 zone)

EMBL: FP565814.SPO0J

FP565814.SPO0J       Location/Qualifiers
FT   CDS_pept        729965..730945
FT                   /transl_table=11
FT                   /gene="spo0J"
FT                   /locus_tag="SRM_00595"
FT                   /product="spoOJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00595"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23516"
FT                   /db_xref="GOA:D5H661"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D5H661"
FT                   /protein_id="CBH23516.1"
FT                   /translation="MGKKSALGKGLNALLPEDQDEQASGDGEGPTDEAPEEQSQLYQFE
FT                   DGTRLLGRVAEVAVERIRPNPYQPRQEFEEGALDELAASIEQIGIIQPITVRALGDGEF
FT                   EIISGERRLRAARRAGMEHLPAFIREADSEEMLEMALVENVQREELNPIEIALGYQRLV
FT                   EECDLTQEEVAERVSKSRATVSNFLRLLRLPPRIQAALRDKQVSMGHARALIAMDDDEA
FT                   QVALLEETIAEDLSVREVERRARQWHEDEGAADSEAAEGADETAVPETAPDRDDLQFEE
FT                   LRNRLRSRFSTQVQIHHRKDGEGTIEISYYSEEDLNRLVELLASE"
     atgggtaaga aatcagcatt aggcaaaggc ctcaacgcgc tcctgcccga agaccaggac        60
     gagcaggcgt cgggggacgg cgagggcccg accgacgagg cgccggagga gcagagtcag       120
     ttgtaccagt tcgaagacgg gacccgcctg ctggggcgcg ttgcggaggt ggcggtggag       180
     cgcatccggc ccaaccccta ccagccgcgc caggagttcg aggagggggc cctcgacgag       240
     ctggcggcct ccatcgagca gatcggcatc atccagccca ttacggtgcg ggcgctgggg       300
     gatggcgagt tcgagatcat ctcgggcgag cgtcgcctgc gggcggcccg gcgggcgggc       360
     atggagcacc tgccggcatt catccgcgag gccgactcgg aggaaatgct cgagatggcc       420
     ctcgtcgaaa acgtccagcg cgaggagctg aaccccatcg agattgccct cggctaccag       480
     cgcctcgtcg aggagtgcga cctgacgcag gaagaggtgg ccgagcgcgt gagcaagagc       540
     cgggcgacgg tgtccaactt ccttcgtctg ctccgcctgc cgcctcgcat tcaggccgcg       600
     ctccgggaca agcaggtgag catgggccac gcccgggccc tcattgcgat ggacgacgac       660
     gaggcccagg tggcgctgct tgaagaaacc atcgcggagg acctatcggt gcgtgaggtg       720
     gagcgacggg cccgccagtg gcacgaagac gagggggcgg ccgactccga agcagcagag       780
     ggggccgacg aaaccgcggt tcccgagacg gcccccgacc gggacgatct tcagttcgaa       840
     gagctccgaa accggcttcg gtcccggttt agcacccagg tgcagattca tcaccggaag       900
     gacggcgagg gaacgatcga aatttcttac tactcggagg aggacctgaa tcgtctcgtg       960
     gagctcctgg cgagcgagta g                                                 981
//

If you have problems or comments...

PBIL Back to PBIL home page