(data stored in ACNUC30630 zone)

EMBL: FP565814.UDK

FP565814.UDK         Location/Qualifiers
FT   CDS_pept        742522..743193
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="SRM_00610"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23531"
FT                   /db_xref="GOA:D5H676"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H676"
FT                   /protein_id="CBH23531.1"
FT                   /translation="MPAPRAPMPMNPPVVIGIAGGSGSGKTTVLNHILEEFGSDPIAIL
FT                   DHDAYYHDLSHLSREKRAQFNFDHPDALETSLMREHLDRLIEGEAIEKPVYDFTTHTRR
FT                   EETETVEPRPVIIIEGILVLAESALEERMDIKIYVDAADDIRLMRRIRRDMQERDRSIE
FT                   GILRQYERTVRPMHLEFVEPSKREADIIIPRGGHNEVAIQMVMSRIQELLRLVEQGTLQ
FT                   A"
     atgcctgccc ctcgcgcccc gatgcccatg aaccccccgg tcgttatcgg cattgccggt        60
     gggtctgggt cgggcaagac gacggtcctg aaccacatcc tcgaggagtt tgggtccgac       120
     ccgattgcga tcctcgacca cgacgcgtac taccacgacc tctcgcacct ttcccgagag       180
     aagcgggcgc agtttaattt cgaccacccc gacgcgctgg agacgtcgct catgcgcgag       240
     cacctcgacc gcctcattga gggggaggcg atcgagaagc cggtgtacga cttcaccacg       300
     cacacccgcc gcgaggagac cgagacggta gagccccgcc ccgtcatcat catcgagggc       360
     atcctcgtgc tggccgagtc ggcccttgag gagcggatgg acatcaagat atacgtcgac       420
     gcggccgacg acatccggct catgcgccgc atccggcgag acatgcagga gcgggatcgg       480
     tccatcgagg gcattctgcg ccagtacgag cgaaccgtcc gcccgatgca cctcgagttc       540
     gtcgagccct cgaagcggga ggccgacatc atcattcccc ggggcgggca caacgaggtg       600
     gccatccaga tggtgatgtc gcggattcag gagctgctcc gcctggtgga acagggaacg       660
     ctgcaggcat ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page