(data stored in ACNUC30630 zone)

EMBL: FP565814.ZWF

FP565814.ZWF         Location/Qualifiers
FT   CDS_pept        complement(90032..91546)
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="SRM_00083"
FT                   /product="Glucose-6-phosphate dehydrogenase"
FT                   /function="The enzyme catalyses the first step in the
FT                   pentose pathway, i.e. the conversion of glucose-6-
FT                   phosphate to gluconolactone 6-phosphate in the presence of
FT                   NADP, producing NADPH."
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00083"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23004"
FT                   /db_xref="GOA:D5H4P9"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P9"
FT                   /protein_id="CBH23004.1"
FT                   /translation="MSQIDPHLFVIFGATGDLTKRKLIPALYHLMQDEDVARRCVVLGA
FT                   ARSDWTDERFREAARTALREQGYAEETVDAWCTRNLHYQCLGPEGNDYEGLRERIEQLE
FT                   RHRNLTGNRVFYFSLPPSIYTQAIEGLGAVGLNTSSGWSRVVVEKPFGHDLDSAQRLNE
FT                   RVHQHFDEDQVYRIDHYLGKETVQNLMAFRFGNALFESMWNREHIDRVEITVAEPLGVG
FT                   GRAGYYDQSGHVRDMVQNHLTQLLSLVAMEPPASMDADAIRDEKVKVLNAVQQPDPRAD
FT                   VALGQYRAGTMGGEPVPGYRDEPDVPADSDTETFAAMRLNVANWRWQGVPFFLRTGKRL
FT                   PRKLTQIAVRFQSAPVSLFQADGGPCVPRDADCEAAPNELLITLQPDEGFDLRFEVKAP
FT                   GNSDDGSMPLETQQLSFSYQDAFGPVPDAYETLLRDIIVGDPTLFVRADEVEASWQLYT
FT                   PLLETDLPVHSYEAGTWGPDAVDRLLPTWTSTGRTRSHRAEATSSS"
     atgtctcaga ttgaccccca cctcttcgtc atcttcgggg ccaccggcga cctcacgaag        60
     cggaagctga tcccggccct ctaccacttg atgcaggacg aggacgtggc ccggcggtgc       120
     gtcgtgctgg gcgcggcccg gtcggactgg accgacgagc ggtttcggga ggccgcccgg       180
     acggccctcc gcgagcaggg ctacgcggag gagacggtgg acgcctggtg cacccgaaac       240
     ttgcactacc agtgcctcgg gcccgaggga aacgactacg aggggctgcg tgagcgtata       300
     gaacagctgg agcggcaccg caacctgacc ggcaaccggg tcttctactt ctccctcccg       360
     cccagcatct acacccaggc cattgagggg ctcggggcgg tcggcctgaa cacgagttcg       420
     ggctggagcc gcgtcgtcgt ggagaagccg ttcggccacg acctcgactc ggcacagcgc       480
     ctcaacgagc gggtccacca gcacttcgac gaggaccagg tgtaccgcat cgaccactac       540
     ctgggcaagg agaccgtcca gaacctcatg gccttccggt tcggaaatgc cctcttcgag       600
     tcgatgtgga accgggagca catcgatcgg gtggagatca cggtcgccga gccgctcggg       660
     gtgggcgggc gggccggcta ctacgaccag tccggccacg tgcgcgacat ggtccagaac       720
     cacctcacgc agctcctgtc gttggtggcg atggagccgc ccgccagcat ggacgccgac       780
     gccatccgcg acgagaaggt gaaggttctg aacgcggtgc aacagcccga ccccagggcc       840
     gacgtcgccc tcgggcagta ccgggcgggc acgatggggg gcgagccggt gcccggctac       900
     cgggacgagc cggacgtgcc ggcggattct gacaccgaga cgttcgccgc gatgcgcctg       960
     aatgtggcca actggcggtg gcagggcgtg ccctttttcc tgcggacggg caagcggctg      1020
     ccccgcaagc tcacccagat cgccgtgcgc ttccagagcg cgccggtgtc gctcttccag      1080
     gcggacgggg ggccgtgtgt gccacgggac gccgactgtg aagccgcccc gaacgagctg      1140
     ctgatcacgc tgcagccgga tgaggggttc gacctgcgct tcgaggtgaa ggcccccggc      1200
     aacagcgacg acggctcgat gcccctggag acgcagcagc tcagcttttc ctatcaggac      1260
     gcgttcggtc ccgtccccga cgcctacgag acgctcctgc gcgacatcat cgttggggac      1320
     cctacgctct tcgtccgggc cgacgaggtg gaggcctcgt ggcaactcta tacgcccctt      1380
     ctggagacgg acctcccggt gcattcctac gaggcgggca cgtggggccc cgacgcggta      1440
     gaccgcctcc tccccacctg gacctcgacc ggccgcaccc gatctcatcg ggccgaagcg      1500
     acctcctcct cgtag                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page