(data stored in ACNUC16935 zone)

EMBL: HQ318096.RPL40

HQ318096.RPL40       Location/Qualifiers
FT   CDS_pept        join(15..117,367..453,1902..2004,2095..2188)
FT                   /codon_start=1
FT                   /gene="Rpl40"
FT                   /product="ribosomal protein L40"
FT                   /db_xref="GOA:D2GV37"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/TrEMBL:D2GV37"
FT                   /protein_id="AEA39580.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLH
FT                   PRAVNCRKKKCGHTNNLRPKKKVK"
     atgcagatct ttgtgaagac cctgacgggc aagaccatca cccttgaggt cgagcccagt        60
     gacaccattg agaatgtcaa agccaaaatc caagacaagg agggcatccc gcctgaccaa       120
     cagcgtctga tttttgcggg caaacagctg gaagatggcc gcactctgtc agactacaat       180
     atccagaaag agtccaccct acacttggtg cttcgcctcc ggggtggcat catcgagcct       240
     tccctccgcc agctggccca gaagtacaac tgcgacaaga tgatctgccg caagtgttat       300
     gctcgcctgc acccccgcgc cgtcaactgc cgcaagaaga agtgcggtca caccaacaac       360
     ctgcgcccca aaaagaaggt caaataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page