(data stored in ACNUC8465 zone)

HOGENOMDNA: KANKD_1

ID   KANKD_1; SV 1; empty ; DNA; empty ; PRO; 2852073 BP.
XX
AC   NC_013166;
XX
PR   Project: 59209;
XX
DE   Kangiella koreensis DSM 16069, complete genome.
XX
OS   Kangiella koreensis DSM 16069
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Oceanospirillales;
OC   Alcanivoracaceae; Kangiella.
XX
RN   [1]
RP   1-2852073
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K.,
RA   Mikhailova,N., Sims,D., Meincke,L., Brettin,T., Detter,J.C., Han,C.,
RA   Larimer,F., Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P.,
RA   Woyke,T., Wu,D., Tindal,B., Klenk,H.-P. and Eisen,J.A.;
RT   "The complete genome of Kangiella koreensis DSM 16069";
RL   Unpublished
XX
RN   [2]
RP   1-2852073
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (28-AUG-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2852073
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K.,
RA   Mikhailova,N., Sims,D., Meincke,L., Brettin,T., Detter,J.C., Han,C.,
RA   Larimer,F., Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P.,
RA   Woyke,T., Wu,D., Tindal,B., Klenk,H.-P. and Eisen,J.A.;
RT   "Direct Submission";
RL   Submitted (12-AUG-2009) US DOE Joint Genome Institute, 2800 Mitchell
RL   Drive, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001707.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083296
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2852073
FT                   /strain="DSM 16069"
FT                   /mol_type="genomic DNA"
FT                   /organism="Kangiella koreensis DSM 16069"
FT                   /db_xref="taxon:523791"
FT   gene            363..1748
FT                   /db_xref="GeneID:8371467"
FT                   /locus_tag="Kkor_0001"
FT   CDS_pept        363..1748
FT                   /locus_tag="Kkor_0001"
FT                   /gene_family="HOG000235660" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="KEGG: pmr:PMI3132 chromosomal replication initiator
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="GI:256821229"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="GeneID:8371467"
FT                   /translation="MTGNVWRSCLQKLQSELSATEFNTWIKPLQVKETDSEMALYAPNP
FT                   FFVDWIRQQYLDRINEFLIQRDNNQQKHISLHVGNVAQIVNQNSNSQAVNNNHNAATPS
FT                   NSKPVAQNNHINQSSGFQQNNLNPKFLFSSFVEGKSNQLARAAAQQVVENPGEAYNPLF
FT                   IYGGVGLGKTHLMHSVGNSILDKNPNAHIVYLHSERFMANMVKALQTGTMDKFKNFYRS
FT                   VDALLIDDIQFFANKGRTQEEFFHTFNNLIEKNKQVIITCDRFPKEVEGLEERLKSRFG
FT                   WGLTVAVEPPELETRVAILMSKAQSSKIELPNEVAFFIAKRIRSNVRELEGALKRVIAN
FT                   AQFTGRAITLDFVKDALKDLIAAQDKLISIENIQKTVASYYKIKVSDLLSQRRSRSIAR
FT                   PRQMAMALAKNLTNHSLPEIGDAFGGKDHTTVLHACRKIEQLKGESIDIEEDFSNLLRT
FT                   LSS"
FT                   /protein_id="YP_003145192.1"
FT   misc_feature    363..1745
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    783..1214
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    858..881
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    order(861..884,1047..1049,1149..1151)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    <1017..1436
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    1035..1052
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    1185..1187
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    1470..1739
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Kkor_0001"
FT   misc_feature    order(1539..1541,1563..1568,1587..1589,1605..1613,
FT                   1638..1652,1659..1661,1668..1673)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Kkor_0001"
FT   gene            1764..2867
FT                   /db_xref="GeneID:8368771"
FT                   /locus_tag="Kkor_0002"
FT   CDS_pept        1764..2867
FT                   /locus_tag="Kkor_0002"
FT                   /gene_family="HOG000071791" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: pfl:PFL_0002 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:256821230"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:8368771"
FT                   /translation="MRFTISRDQLLAPLQLVSGAVEKRQTLPVLSNVLMVVDDSKLSLT
FT                   ATDLEVELKAQVDLEGEFEPGEITVPARKLLDIVRSLGDGENVKIEQSETRLKVITPSS
FT                   RFSLSTMSANEFPNLDETVSLASLELTQDVLKSLIEKTQFAMAQQDVRYYLNGMLFEFD
FT                   NDKLTTVATDGHRLALSRAKASIDADDKISAIIPRKGVTELARLLEHSDDNITLNLGSN
FT                   HIKVIGPDYSFTSKLVDGRFPEYEKVLPRNGDKIVIADRELFKESLSRASILCNEKFRG
FT                   VRFMLTNEQVRLHANNPEQEEAEVEFGVDYQGSDLEIGFNVSYMIDVMNTIKTPQVKLT
FT                   FIDANSSTLIEEVDGGESVYVVMPMRL"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_003145193.1"
FT   misc_feature    1764..2864
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:168148"
FT                   /locus_tag="Kkor_0002"
FT   misc_feature    1764..2861
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Kkor_0002"
FT   misc_feature    order(1833..1835,1980..1982,2001..2003,2358..2360)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Kkor_0002"
FT   misc_feature    order(1983..1985,1992..1994,2070..2072,2076..2078,
FT                   2580..2582,2673..2678)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Kkor_0002"
FT   misc_feature    order(2277..2279,2283..2294,2724..2726,2850..2861)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Kkor_0002"
FT   misc_feature    order(2277..2279,2283..2288,2505..2507,2610..2612,
FT                   2649..2654,2733..2735,2850..2861)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Kkor_0002"
FT   gene            2898..4007
FT                   /db_xref="GeneID:8368772"
FT                   /locus_tag="Kkor_0003"
FT   CDS_pept        2898..4007
FT                   /locus_tag="Kkor_0003"
FT                   /gene_family="HOG000269560" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sdn:Sden_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="GI:256821231"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="GeneID:8368772"
FT                   /translation="MHIQSLSIQNFRNLQPSRLHFSPQLNIIYGNNAAGKTSILESLFI
FT                   LGHGRSFRTSRHSKLINYEQDSFTLFSELYSHNVQQRLGVQRFRNNDVNVRLNQEPLAK
FT                   LSDLVSLIPIQVLAPEHYELLTKGPSGRRKLLDWGVFHVEHSFLKRWQACQRIILQRNK
FT                   LLKGSLSYKDLEAWDSQLIPLSDQVNQYRQDYCDSLSPYFHEIASQFLPDVQLSLEFYK
FT                   GWQGKDLESLLVEQYLKDKKLGYTQSTIQKADLKILSGKRLAADYLSRGQQKLVTTALK
FT                   LAQLRLAQERGQQYPVFLLDDIGAELDENHQKLLLNFLAKQPEKQQIFITCVHLDPLKS
FT                   LINRYNNARLFHVEHGAVSIIEASEMNAQ"
FT                   /protein_id="YP_003145194.1"
FT   misc_feature    2904..>3398
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    2985..3008
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    order(2994..2999,3003..3011,3252..3254)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    3243..3254
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    <3657..3974
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    3699..3728
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    3786..3803
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    3810..3821
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Kkor_0003"
FT   misc_feature    3885..3905
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Kkor_0003"
FT   gene            4037..6463
FT                   /db_xref="GeneID:8368773"
FT                   /locus_tag="Kkor_0004"
FT   CDS_pept        4037..6463
FT                   /locus_tag="Kkor_0004"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="KEGG: son:SO_0011 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:256821232"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="GeneID:8368773"
FT                   /translation="MSENNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEV
FT                   VDNSIDEALAGHCTDIYVTIHSDNSVSVRDNGRGIPTEMHEEEGVSAAEVIMTVLHAGG
FT                   KFDDNSYKVSGGLHGVGVSVVNALSEELKLTIRRAGKRYEQIYVHGVPQAPLEVVGDAE
FT                   TTGTEIRFKPSDKTFTNTEYHYDILAKRLRELSFLNSGVGIRLADERSGKQDHFMYEGG
FT                   IKAFVEYLNSKKTPIHEKVFHFTHEREEDGVTVEVAMQWNDGFQESIFCFTNNIPQRDG
FT                   GTHLAGFRAALTRGLNNFMENEGYNKKGKVNTTGDDAREGLTAVVSVKVPDPKFSSQTK
FT                   DKLVSSEVKTAVEQAMGEHLKDFLLENPGEAKSVVNKMIDAARAREAARKAREMTRRKG
FT                   ALDIAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRDRKNQAILPLKGKILNVEK
FT                   ARFDKMLSSQEVGTLITALGCGIGREEFDADKTRYHRIIIMTDADVDGAHIRTLLLTFF
FT                   YRQVPQLIERGYIYIAQPPLYKVKKGKQEQYLKDDDALENYLTQTALNNTELYISKDAP
FT                   AISGEGLERLVNEYRDVQTTIRRLAQLYPSNILNSMIYHPTLKTDDLKSEPKVKEWMDT
FT                   LAVKLNKDQKSGAVRFNFNVRKDNELEHYLPHFVMFHHGVESEYLLSTEFFASGDYKKI
FT                   SLLGEKLETLIEEGAFVKRGEKIQEIESFKEALDWLMSEARRGQAIQRYKGLGEMNPGQ
FT                   LWETTMDPAGRRMLQVTIEDAVAADQLFTTLMGDQVEPRREFIENNALSVSNLDV"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003145195.1"
FT   misc_feature    4037..6460
FT                   /note="DNA gyrase subunit B; Validated; Region: gyrB;
FT                   PRK05644"
FT                   /db_xref="CDD:168149"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    4136..>4372
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    4697..5176
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    4856..4858
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    order(5030..5032,5039..5044,5048..5050)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    order(5048..5050,5054..5056)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    5297..5641
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    order(5315..5320,5327..5329,5537..5539,5543..5545,
FT                   5549..5551)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    order(5315..5317,5537..5539)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Kkor_0004"
FT   misc_feature    6254..6427
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Kkor_0004"
FT   gene            complement(6553..7488)
FT                   /db_xref="GeneID:8368774"
FT                   /locus_tag="Kkor_0005"
FT   CDS_pept        complement(6553..7488)
FT                   /locus_tag="Kkor_0005"
FT                   /gene_family="HOG000176511" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /codon_start="1"
FT                   /product="Polyphosphate:AMP phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   pat:Patl_0210 hypothetical protein"
FT                   /db_xref="GI:256821233"
FT                   /db_xref="InterPro:IPR005660"
FT                   /db_xref="GeneID:8368774"
FT                   /translation="MSNSDNPRPSSFCCIDSPYLMPFDGKLILTEQPTVPAEQLSKEEY
FT                   KAQLMVNSDALYHLQHKMYADNCFSVLLIFQALDAAGKDSTIRKVFSGINPAGFQVHNF
FT                   KQPSAQELDHDFLWRTSKALPERGRIGIFNRSYYEEVLVVRVHPKYLLNQNLPNIHLDN
FT                   LATINSNHQFWAGRYQSINDHEAHLARNGTIILKFFLNVSQQEQHQRFLSRIKDPEKNW
FT                   KFSSGDIEESQLWDTYQYAYQQALSHTSRPWAPWYIIPADYKPAMRAIVSKLVLQNIRQ
FT                   LPLSFPELSSQDQEALPIYESLLSQNTNKK"
FT                   /protein_id="YP_003145196.1"
FT   misc_feature    complement(6598..7368)
FT                   /note="Polyphosphate kinase 2 (PPK2); Region: PPK2;
FT                   cl11971"
FT                   /db_xref="CDD:164310"
FT                   /locus_tag="Kkor_0005"
FT   gene            7645..7848
FT                   /db_xref="GeneID:8368775"
FT                   /locus_tag="Kkor_0006"
FT   CDS_pept        7645..7848
FT                   /locus_tag="Kkor_0006"
FT                   /gene_family="HOG000229216" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07311"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF1458"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   jan:Jann_3624 hypothetical protein"
FT                   /db_xref="GI:256821234"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="GeneID:8368775"
FT                   /translation="MTVAKVTEIIADSSESFEDAVKRGIRRANKTLDQVKSAWVKEQQV
FT                   VIQDGEVEKFRVVMKVTFLLKD"
FT                   /protein_id="YP_003145197.1"
FT   misc_feature    7648..7845
FT                   /note="Protein of unknown function (DUF1458); Region:
FT                   DUF1458; cl01328"
FT                   /db_xref="CDD:154336"
FT                   /locus_tag="Kkor_0006"
FT   gene            complement(7944..9407)
FT                   /db_xref="GeneID:8368776"
FT                   /locus_tag="Kkor_0007"
FT   CDS_pept        complement(7944..9407)
FT                   /locus_tag="Kkor_0007"
FT                   /gene_family="HOG000252419" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05872"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF853 NPT hydrolase
FT                   putative"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF853 NPT
FT                   hydrolase putative; KEGG: cja:CJA_1322 hypothetical
FT                   protein"
FT                   /db_xref="GI:256821235"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="GeneID:8368776"
FT                   /translation="MILIGGNQEQQHILLNPKMANRHGLIAGATGTGKTVTLQVMAEAF
FT                   SNIGVPVFAADIKGDLSGIAKAAGTHPKITERINSIQIPDYQPRANPVLYWDVYGKHGH
FT                   PVRTTISEMGPLLLSNLLELNDTQSGVLHIAFDIADEEGLLLLDLKDLRSMLNWLSDNR
FT                   QQVSRDYGNVTPQTVAAIIRKLLVLENSGGDHFFGEPALNINDLMRVDQSGKGFINLLY
FT                   SRELMLNPKIYSTFLLWMLSELFEELDEVGDPDKPRLVFFFDEAHLLFDHAPRILLQRI
FT                   EQVVRLIRSKGVGVYFVTQNPTDIPDSVLGQLGNRVQHALRAFTPKDQKAVKSAADTFR
FT                   PNPKLDTQSVITQLSVGEALVSVLDEKGRPTPVEQTLICPPCSQIGPLSDSDWQSSFNQ
FT                   SILKGVYDDAVDRQSAYEILLKREQDLVQRQAKEMKEAEAIRKKSKPARRSNRQSVGEA
FT                   FTKTLVRTISSGIGRKIVRGLLGSILGSK"
FT                   /protein_id="YP_003145198.1"
FT   misc_feature    complement(7947..9407)
FT                   /note="Bacterial protein of unknown function (DUF853);
FT                   Region: DUF853; pfam05872"
FT                   /db_xref="CDD:114590"
FT                   /locus_tag="Kkor_0007"
FT   gene            9558..11537
FT                   /db_xref="GeneID:8368777"
FT                   /locus_tag="Kkor_0008"
FT   CDS_pept        9558..11537
FT                   /locus_tag="Kkor_0008"
FT                   /gene_family="HOG000008427" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: aeh:Mlg_1571 type II secretion system protein
FT                   E"
FT                   /db_xref="GI:256821236"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="GeneID:8368777"
FT                   /translation="MNFNQLVAEAISSDQEQANNSVLCDKKNKLEDTRLTTVDFKEQIF
FT                   ITEDKSIPFADVQYIVIQKPIYETLEDYQKQTGNLNYSNYRIEMSDKFTITGQCVYCEN
FT                   EDGLWKVLRLHKNHIFIILISEKNVTNMDIIQSNGRSTFGREEDRYTGEIKNIDLSTVK
FT                   IDEKWVRKFPPELLFKYQALPLFKKNNFLEVAFTNPQQIDAMQVLSFIAGCNIEPLKAE
FT                   KRELLEYLSGIVQFQNEKEALVELERVGIDAGKNLATNEIESLGKKKGIINLMASIITD
FT                   AIEKGASDIHLHPRAKYLQLLYRMDGSLTPIRKLNLSLHQALVSRIKIIGGMDISERRL
FT                   PQDGRIEYAGNGKSIDMRISVMPTVYGESVVIRILDSSQGLRDINELGLTEKDTERFVN
FT                   LLHSSYGMFLVTGPTGSGKSTTLYAAINEKVKEGPHIITVEEPVEYKMEGVTQIPVNHK
FT                   TGYSFARALRNILRHDPDVIMVGEIRDGETAKIAVESSLTGHLVLSTLHTNSAVSTITR
FT                   LVEMGVEPYLLKDALVGILAQRLVKKNCKHCLVEEKIPGSILKEIQAAKNDKFYKGAGC
FT                   AECFNTGIAGRRSVYELLSITPEVAREINETLDINKLNQIAQNQGMVSLAQMALELARK
FT                   KEISALEVYKIRANASQIKTLEEE"
FT                   /protein_id="YP_003145199.1"
FT   misc_feature    10023..11486
FT                   /note="Type II secretory pathway, ATPase PulE/Tfp pilus
FT                   assembly pathway, ATPase PilB [Cell motility and secretion
FT                   / Intracellular trafficking and secretion]; Region: PulE;
FT                   COG2804"
FT                   /db_xref="CDD:32635"
FT                   /locus_tag="Kkor_0008"
FT   misc_feature    <10026..10250
FT                   /note="GSPII_E N-terminal domain; Region: GSPII_E_N;
FT                   pfam05157"
FT                   /db_xref="CDD:147371"
FT                   /locus_tag="Kkor_0008"
FT   misc_feature    10533..11318
FT                   /note="PulE/GspE The type II secretory pathway is the main
FT                   terminal branch of the general secretory pathway (GSP). It
FT                   is responsible for the export the majority of Gram-negative
FT                   bacterial exoenzymes and toxins. PulE is a cytoplasmic
FT                   protein of the GSP, which...; Region: PulE-GspE; cd01129"
FT                   /db_xref="CDD:29995"
FT                   /locus_tag="Kkor_0008"
FT   misc_feature    10791..10814
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29995"
FT                   /locus_tag="Kkor_0008"
FT   misc_feature    order(10794..10796,10806..10814,10869..10871,10875..10880,
FT                   10998..11003)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29995"
FT                   /locus_tag="Kkor_0008"
FT   misc_feature    10986..11003
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29995"
FT                   /locus_tag="Kkor_0008"
FT   gene            complement(11586..11828)
FT                   /db_xref="GeneID:8368778"
FT                   /locus_tag="Kkor_0009"
FT   CDS_pept        complement(11586..11828)
FT                   /locus_tag="Kkor_0009"
FT                   /gene_family="HOG000265044" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF526"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   amc:MADE_00075 hypothetical protein"
FT                   /db_xref="GI:256821237"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="GeneID:8368778"
FT                   /translation="MIDPKVLDDIASKLSDAIPQSVKNTGDEFAKQAKQILQTQLAKLD
FT                   LVTREEFDAQTKVLQRTRLMLQELEKKLADIDAKL"
FT                   /protein_id="YP_003145200.1"
FT   misc_feature    complement(11595..11807)
FT                   /note="Protein of unknown function (DUF526); Region:
FT                   DUF526; cl01115"
FT                   /db_xref="CDD:154206"
FT                   /locus_tag="Kkor_0009"
FT   gene            complement(11843..12208)
FT                   /db_xref="GeneID:8368779"
FT                   /locus_tag="Kkor_0010"
FT   CDS_pept        complement(11843..12208)
FT                   /locus_tag="Kkor_0010"
FT                   /gene_family="HOG000270268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04247"
FT                   /codon_start="1"
FT                   /product="invasion gene expression up-regulator SirB"
FT                   /transl_table="11"
FT                   /note="PFAM: Invasion gene expression up-regulator SirB;
FT                   KEGG: cja:CJA_2198 hypothetical protein"
FT                   /db_xref="GI:256821238"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="GeneID:8368779"
FT                   /translation="MLALKHFHMSLAALTVLGFLIRSVWLFRGSQLLQKKVVKILPHVI
FT                   DTFLLASGIVLMVQTKMYPHHQPWLTVKILLIVTYILFGIKMFHATESKKRLTFFALAL
FT                   ASVLAVLYLARVKPPLW"
FT                   /protein_id="YP_003145201.1"
FT   misc_feature    complement(11909..12205)
FT                   /note="Invasion gene expression up-regulator, SirB; Region:
FT                   SirB; cl01184"
FT                   /db_xref="CDD:154253"
FT                   /locus_tag="Kkor_0010"
FT   gene            complement(12202..12855)
FT                   /db_xref="GeneID:8368780"
FT                   /locus_tag="Kkor_0011"
FT   CDS_pept        complement(12202..12855)
FT                   /locus_tag="Kkor_0011"
FT                   /gene_family="HOG000075267" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0029"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   eca:ECA0210 hypothetical protein"
FT                   /db_xref="GI:256821239"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="GeneID:8368780"
FT                   /translation="MSDAVKEPLAGYRVPQHSVEHPFSFEEVIKGSRFIARVAFTPTVE
FT                   DAKAFINHFNQTEPEATHHCWAYIVGNPASTTLIACSDDGEPSGTAGMPMLNVLQHSDV
FT                   GDITAVVTRYYGGTKLGTGGLARAYGGSVKQAMDQIKLGSRIYTEKLDLTCAYELQKQV
FT                   EYLLKEAQAEIVHTDFAAQVTICAQVPVNTLPELEAALEAYINRNQIEVTKVTC"
FT                   /protein_id="YP_003145202.1"
FT   misc_feature    complement(12214..12801)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG1739"
FT                   /db_xref="CDD:31925"
FT                   /locus_tag="Kkor_0011"
FT   misc_feature    complement(12442..12771)
FT                   /note="Uncharacterized protein family UPF0029; Region:
FT                   UPF0029; pfam01205"
FT                   /db_xref="CDD:144705"
FT                   /locus_tag="Kkor_0011"
FT   misc_feature    complement(12253..12399)
FT                   /note="Domain of unknown function (DUF1949); Region:
FT                   DUF1949; pfam09186"
FT                   /db_xref="CDD:150017"
FT                   /locus_tag="Kkor_0011"
FT   gene            complement(12865..14184)
FT                   /db_xref="GeneID:8368781"
FT                   /locus_tag="Kkor_0012"
FT   CDS_pept        complement(12865..14184)
FT                   /locus_tag="Kkor_0012"
FT                   /gene_family="HOG000290531" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /codon_start="1"
FT                   /product="proline dipeptidase"
FT                   /transl_table="11"
FT                   /note="catalyzes the hydrolysis of dipeptides with a
FT                   proline at the C-terminal; also catalyzes the low
FT                   efficiency hydrolysis of organophosphate di- and
FT                   tri-esters"
FT                   /db_xref="GI:256821240"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="GeneID:8368781"
FT                   /translation="MHDSSLAPLFKHHIDVVTQRYQKAMENHDFDHLVIPAGSQHGIFL
FT                   DDMSYPFKSNFHFNSFVPLDDLHDSVLIISADGTRKLCYYQPVDFWHYVAGDPEGFWVE
FT                   HFDIVMTRTKDEVLSHVPTTGNVAYIGEMGRPFDEDGFAAVNPGYFMNEINWHRAIKSD
FT                   YEVECVSRANKRAALGHMAARDMFFKNGSELEIHLAYLLATGHAEHQLPYGSIVALNEH
FT                   AAILHYTLYNNQAPDNHRTFLIDAGARYNNYAADITRTYAYEQNEFAELIGDMDALEQR
FT                   ICSKVASGQSYVDLHIETHHEIAKLLNKYKFCDMSPESMVEAGVTSTFFPHGLGHHIGL
FT                   QVHDVGGHQANVEGDPAPPPKSHPFLRNTRDIEVGNILTVEPGLYFIDSLLGDLKQTDH
FT                   AKSINWDKIEQFKPFGGIRIEDEVLVTATGPRNLTREHLD"
FT                   /protein_id="YP_003145203.1"
FT   misc_feature    complement(12877..14175)
FT                   /note="proline dipeptidase; Provisional; Region: PRK13607"
FT                   /db_xref="CDD:172170"
FT                   /locus_tag="Kkor_0012"
FT   misc_feature    complement(12880..13689)
FT                   /note="Prolidase. E.C. 3.4.13.9. Also known as Xaa-Pro
FT                   dipeptidase, X-Pro dipeptidase, proline dipeptidase.,
FT                   imidodipeptidase, peptidase D, gamma-peptidase. Catalyses
FT                   hydrolysis of Xaa-Pro dipeptides; also acts on
FT                   aminoacyl-hydroxyproline analogs. No action...; Region:
FT                   Prolidase; cd01087"
FT                   /db_xref="CDD:29972"
FT                   /locus_tag="Kkor_0012"
FT   misc_feature    complement(order(12925..12927,13042..13044,13177..13179,
FT                   13417..13419,13450..13452,13504..13506))
FT                   /note="active site"
FT                   /db_xref="CDD:29972"
FT                   /locus_tag="Kkor_0012"
FT   gene            14485..16641
FT                   /db_xref="GeneID:8368782"
FT                   /locus_tag="Kkor_0013"