(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_1

ID   LACTH_1; SV 1; linear; genomic DNA; STD; FUN; 687718 BP.
XX
AC   CU928165;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome A complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-687718
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-687718
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..687718
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="A"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0A"
FT                   /db_xref="taxon:381046"
FT   gene            complement(<2436..>2909)
FT                   /locus_tag="KLTH0A00110g"
FT                   /old_locus_tag="KLTH-ORF17112"
FT   CDS_pept        complement(2436..2909)
FT                   /locus_tag="KLTH0A00110g"
FT                   /gene_family="HOG000146797" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17112"
FT                   /product="KLTH0A00110p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB75"
FT                   /protein_id="CAR21032.1"
FT                   /translation="MKVCTRVEINAPASVVRETLLDFSGHAKWNPFFTSIVLFEHDGHD
FT                   LSSQIKPGDRLEVTMKDIRSGKVNKFTPTVLANTVNKFKWEGSLIGQWFFSGIHTFEFQ
FT                   EENGGQKCTLLQHETFSGVALPLLKPVLGGAQRNFEAMNNALKKACESQDEHK"
FT   LTR             3693..4109
FT                   /locus_tag="KLTH0A00132t"
FT                   /old_locus_tag="Klth0A.LTR.1"
FT   gene            <5329..>6715
FT                   /pseudo
FT                   /locus_tag="KLTH0A00154g"
FT                   /old_locus_tag="pseudo-Klth0A-5329-6715"
FT   gene            <7412..>9082
FT                   /pseudo
FT                   /locus_tag="KLTH0A00176g"
FT                   /old_locus_tag="pseudo-Klth0A-7412-9082"
FT   gene            <10527..>11932
FT                   /pseudo
FT                   /locus_tag="KLTH0A00198g"
FT                   /old_locus_tag="pseudo-Klth0A-10527-11932"
FT   gene            complement(<17344..>17547)
FT                   /locus_tag="KLTH0A00220g"
FT                   /old_locus_tag="KLTH-ORF17090"
FT   CDS_pept        complement(17344..17547)
FT                   /locus_tag="KLTH0A00220g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17090"
FT                   /product="KLTH0A00220p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB76"
FT                   /protein_id="CAR21033.1"
FT                   /translation="MPELGGSAPALIIFTGKVVIFELNSTAVHFKRFMEFHNSQLDGTV
FT                   ETLKNHSQYCQIALTPSEYIYS"
FT   gene            <18502..>19083
FT                   /locus_tag="KLTH0A00242g"
FT                   /old_locus_tag="KLTH-ORF17089"
FT   CDS_pept        18502..19083
FT                   /locus_tag="KLTH0A00242g"
FT                   /gene_family="HOG000063190" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17089"
FT                   /product="KLTH0A00242p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DB77"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB77"
FT                   /protein_id="CAR21034.1"
FT                   /translation="MAVKHILMIAGDFVEDYEIMVPFQILLMVGHKVDVVSPEKKAGEK
FT                   IATAIHDFEGHQTYTEKPGHNFMLNATYSNVQADDYDALVIPGGRAPEHLGTNESVLNL
FT                   VRAFANANKPIAAICHGPQLLAAANVISGRKVSAYPACRAEIIVAGAQYQAIAIDGAVT
FT                   DGKLVTAPAWPAHPAWMSQFLKVLGSKIEA"
FT   gene            complement(<21453..>21722)
FT                   /locus_tag="KLTH0A00264g"
FT                   /old_locus_tag="KLTH-ORF17085"
FT   CDS_pept        complement(21453..21722)
FT                   /locus_tag="KLTH0A00264g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17085"
FT                   /product="KLTH0A00264p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB78"
FT                   /protein_id="CAR21035.1"
FT                   /translation="MNELLYSSGKWPSPRCVFEGEQCHFIFQNIVEDPGQYDLHDKELI
FT                   ESAMRIYNTQFGAWWREFLETRISNITEGIKDILPRDNYRCTSL"
FT   LTR             complement(22324..22612)
FT                   /locus_tag="KLTH0A00286t"
FT                   /old_locus_tag="Klth0A.LTR.2"
FT   gene            <23428..>25053
FT                   /locus_tag="KLTH0A00308g"
FT                   /old_locus_tag="KLTH-ORF17082"
FT   CDS_pept        23428..25053
FT                   /locus_tag="KLTH0A00308g"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17082"
FT                   /product="KLTH0A00308p"
FT                   /note="weakly similar to uniprot|P53388 Saccharomyces
FT                   cerevisiae YPL265W Dicarboxylic amino acid permease,
FT                   mediates high-affinity and high-capacity transport of L-
FT                   glutamate and L-aspartate"
FT                   /db_xref="GOA:C5DB79"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB79"
FT                   /protein_id="CAR21036.1"
FT                   /translation="MTNEKEELPSGELKKTEAVQVCETYEADSVEPQNANEPEEGVLYN
FT                   DRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQI
FT                   AIAEVASFMPATGATIRHAEQFIDESVGFTFGWISTYSSLMPGELSATAVVMRYWTDIN
FT                   PAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGAKQERLG
FT                   FHYWREPGPFAEYIVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHG
FT                   ARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTGTAKSSPYVIAIQRANIKILPHIIN
FT                   AIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSY
FT                   MSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPF
FT                   AAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRP
FT                   AEVDLESIFEDIRQNPEITLATTT"
FT   gene            complement(<27377..>27449)
FT                   /locus_tag="KLTH0A00330r"
FT                   /old_locus_tag="Klth0A.tLys.CTT.14"
FT   tRNA            complement(27377..27449)
FT                   /locus_tag="KLTH0A00330r"
FT                   /old_locus_tag="Klth0A.tLys.CTT.14"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   LTR             complement(27559..27975)
FT                   /locus_tag="KLTH0A00352t"
FT                   /old_locus_tag="Klth0A.LTR.3"
FT   gene            <29810..>30532
FT                   /locus_tag="KLTH0A00374g"
FT                   /old_locus_tag="KLTH-ORF17077"
FT   CDS_pept        29810..30532
FT                   /locus_tag="KLTH0A00374g"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17077"
FT                   /product="KLTH0A00374p"
FT                   /note="similar to uniprot|P36087 Saccharomyces cerevisiae
FT                   YKL070W Hypothetical ORF"
FT                   /db_xref="GOA:C5DB80"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB80"
FT                   /protein_id="CAR21037.1"
FT                   /translation="MYIPKLTSVDDFDKQARTIKDHPLGILFSYSAPKIALTDFLLGDK
FT                   IDKPVDSEMCATHVPFFLQKSQDGSCRLVAHLAGKNQQIKLLKENPSCMVVFQGPNSYV
FT                   TPAWYPEKEETHKFVPTWDYSCVHVYGKAKIIEEKEWLLKMLDSLTDQEENKRPDRDEF
FT                   ESKWKVEQTNQKYLDSLIKGIVGLEIEVSHIQSKLKVHQNQNPKNVNGVLRGYEMEMGD
FT                   DTAKQMCKLVRENYPREL"
FT   gene            <31516..>33679
FT                   /pseudo
FT                   /locus_tag="KLTH0A00396g"
FT                   /old_locus_tag="pseudo-Klth0A-31516-33679"
FT   gene            complement(<34685..>35755)
FT                   /locus_tag="KLTH0A00418g"
FT                   /old_locus_tag="KLTH-ORF17070"
FT   CDS_pept        complement(34685..35755)
FT                   /locus_tag="KLTH0A00418g"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17070"
FT                   /product="KLTH0A00418p"
FT                   /note="similar to uniprot|P00331 Saccharomyces cerevisiae
FT                   YMR303C ADH2 Glucose-repressible alcohol dehydrogenase II
FT                   involved in the production of certain carboxylate esters"
FT                   /db_xref="GOA:C5DB81"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB81"
FT                   /protein_id="CAR21038.1"
FT                   /translation="MTEKLPSSIPLTQRAVIFKKHSGKLELKSIEVQSPKANELLINVK
FT                   FSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNSCC
FT                   MSCEQCELSNEPNCAYADISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGI
FT                   TVFKALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYSVVGIDSGAEKEHLFNDLGG
FT                   DVFLDFSKSENLVPEVVSATGGGGGAHGVLNLSASENAINTSVRFCRANGVIVLVGIPS
FT                   GATCVSEVFDHVVKSIKIVGSSVGNRADTREALDFYSRGLIRPAIKVAGLSQVPQIFKK
FT                   MDNGEIVGRCVVNTGE"
FT   gene            <37100..>38848
FT                   /locus_tag="KLTH0A00440g"
FT                   /old_locus_tag="KLTH-ORF17068"
FT   CDS_pept        37100..38848
FT                   /locus_tag="KLTH0A00440g"
FT                   /gene_family="HOG000157706" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17068"
FT                   /product="KLTH0A00440p"
FT                   /note="weakly similar to uniprot|P53389 Saccharomyces
FT                   cerevisiae YNR055C HOL1 Putative ion transporter similar to
FT                   the major facilitator superfamily of transporters;
FT                   mutations in membrane-spanning domains permit nonselective
FT                   cation uptake"
FT                   /db_xref="GOA:C5DB82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB82"
FT                   /protein_id="CAR21039.1"
FT                   /translation="MTTVIDYNVIPGDSHLVDFDETRKSGEREGKIVLNPTPSDDPDDP
FT                   LNWTPRRKWTAVACVLIYTLGACIPTAAIYSVLPNIEANTNITLSELNNGTGYMFLFLG
FT                   LGCLIFQPLALQFGKRPIYLFSMLATALICVWPPYTKSNGEWVASKILQGFVGSSMESL
FT                   PEISMSDLFFEHERSFALSLYGLTLLSASFLAPFVAGFISEGQGWEWVMWWCAIFGAVC
FT                   FVLLFFLMEETNYDRKLKVDAATGEVITLASRKQQLGAVFTNIDEVIASNSEGNNAGEK
FT                   NETKTNDIGASLQTEEYPENINIVNQVSNVEVVDSNSYAPNYEGTKTYLQKLSLFGGRR
FT                   KKFLLQHYIFAPFLMARFPVVLWAGFLYGSSLVWFNVLNATAALILGGSPYDFSSSTIG
FT                   VAYLSPTIFSVILFFISGLCSDWLKVRVALWRGTGLSKPEDRLWILVIYCVLGCAASIL
FT                   WGVGAYYEIHWFGLVFGMGLLGGCGIFGIASSATYVVDTYKELDTEAMVVVIIIRNCMS
FT                   FGVSYGITDWVTDLGYKKCFISVAFLCFAANFTFLAMVYFGPRLRNRQKHMYWSMVDKY
FT                   RKLGMH"
FT   gene            <40190..>41299
FT                   /locus_tag="KLTH0A00462g"
FT                   /old_locus_tag="KLTH-ORF17065"
FT   CDS_pept        40190..41299
FT                   /locus_tag="KLTH0A00462g"
FT                   /gene_family="HOG000246736" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17065"
FT                   /product="KLTH0A00462p"
FT                   /note="some similarities with uniprot|Q04179 Saccharomyces
FT                   cerevisiae YDR400W URH1 uridine nucleosidase (uridine
FT                   ribohydrolase)"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB83"
FT                   /protein_id="CAR21040.1"
FT                   /translation="MKCLQTVLASAICLISKAAAEVFIVDNDTPTALQVLLPLAAGKQV
FT                   LGITTNLGDYDTDAATYEAAMALSTGNLTSCVPVYKGAEQPLLLDYNTYHLWQDLYGDI
FT                   VWQGAWDKDYESPVPVNASYEYNKTVGAPQWIMDTVKNSKDNVTIVAAGTMTNLALALA
FT                   QWPAMAEKVKLVIMGGYVDGQIAQTTGGDFVNDMYTDFNLMVDPEAAQTALSAPWKELV
FT                   IVGNISSEIFPTQDLYNELIAVSGGLAEIKSNKSLGYVSETVGNGTLPSFNLPYWDEVA
FT                   SAIAADPEIVTASYDAYVSVDTSFSSPFYGSLRIYPANLRAKKGVRTGKAKMITSIDEG
FT                   KLNAMIVDALVRDWTNYCKTGSAPSVAIM"
FT   gene            <42443..>44149
FT                   /locus_tag="KLTH0A00484g"
FT                   /old_locus_tag="KLTH-ORF17061"
FT   CDS_pept        42443..44149
FT                   /locus_tag="KLTH0A00484g"
FT                   /gene_family="HOG000142052" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17061"
FT                   /product="KLTH0A00484p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DB84"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB84"
FT                   /protein_id="CAR21041.1"
FT                   /translation="MPHRSKTACALCKAEKKCCDKKRPKCSHCTDENVACSYPLTLRWG
FT                   GRPYKDKTKQIKIPKNTVLVDGVLMVRDKSHLSPNRYERRSRLVLINEGPVFTKDITKG
FT                   KVRKAVEGASEESSVQISNPCYFTPQGSMPSLKLLNCSLEHSTFFEFYVYKTSYHFVAL
FT                   NKGCKSNPFHTIVPQMAMFNPSLMKLVMAFGGEHRERFRRLENPQLCYSLDEDFVGKKP
FT                   LTMTGQELLKQGVMELVDQLASPKTVIDDTVLASVLVLASFCIYFGTIENKWHAHLYGA
FT                   EGIILRELKEKSKIEKGLLRYTCEQGPYFFLRRWFAYMRIWGCISSASFRQKTVERPLL
FT                   EIDFEEAQDPRRHKNGDVDYALYTSGMESLVLSYLAQVANLILKSETRPPGSDREYIFR
FT                   DAVELEYKIMNYLGSRKQEGEASLKRFLPLTEGAPCDSTKQYSILIATNMLFGLTGVLQ
FT                   LRRRVLGLTHESLLVQNLVLKITDLIEKKLSTGTFVQPCLLFCFFSCGCELLDESLVPK
FT                   RTLFLNLLDSLIRDGVESARQARSAMQECWRTSKPWWEVLKERGLDICFAI"
FT   gene            complement(<44472..>45476)
FT                   /locus_tag="KLTH0A00506g"
FT                   /old_locus_tag="KLTH-ORF17058"
FT   CDS_pept        complement(44472..45476)
FT                   /locus_tag="KLTH0A00506g"
FT                   /gene_family="HOG000050225" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17058"
FT                   /product="KLTH0A00506p"
FT                   /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
FT                   YDL144C Hypothetical ORF"
FT                   /db_xref="GOA:C5DB85"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB85"
FT                   /protein_id="CAR21042.1"
FT                   /translation="MPNKPNVLLVGAGGVGAMASFALEYSGESSVTSVLRSDYAHVVEN
FT                   GFKINSCDYGRGIRYRPSNVVNSIEASKQYGPFDYVVLATKCIPGVSSMIDIIAPAVSK
FT                   DTAIVLIQNGIGIEDEALFKCPGNVILSGVSMIASSNVKGHIEHSDRDFLSVGYFENVN
FT                   LTNEHQEKVCKRFVSMYKNDKNQCVFDENVKYSRWRKLVYNACLNPVCALTEADVGRLE
FT                   IFGGTDSIIRKAMKEVIAIAKSDGVELSEALMDFMIRSKDPVYYRPSMLVDIDKGNPLE
FT                   VEVICGNPVRIAKKNGVEAPYLTLIYDLLKVVQGRIMEKRGMLIVPKERQVPK"
FT   gene            complement(<46253..>47173)
FT                   /locus_tag="KLTH0A00528g"
FT                   /old_locus_tag="KLTH-ORF17057"
FT   CDS_pept        complement(46253..47173)
FT                   /locus_tag="KLTH0A00528g"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17057"
FT                   /product="KLTH0A00528p"
FT                   /note="similar to uniprot|P14065 Saccharomyces cerevisiae
FT                   YOR120W GCY1 Putative NADP( ) coupled glycerol
FT                   dehydrogenase proposed to be involved in an alternative
FT                   pathway for glycerol catabolism"
FT                   /db_xref="GOA:C5DB86"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB86"
FT                   /protein_id="CAR21043.1"
FT                   /translation="MATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHID
FT                   TAAIYRNEAAVGRAIRDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYL
FT                   MHFPVALKTDLIKDGNVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVS
FT                   NFSIKNIEEILKPELGLSVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESS
FT                   MLTDPDLIKLAEKHQVEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQ
FT                   ISKILEKLGSKRYVSPSWAPFPMYE"
FT   gene            complement(<49572..>53438)
FT                   /locus_tag="KLTH0A00550g"
FT                   /old_locus_tag="KLTH-ORF17050"
FT   CDS_pept        complement(49572..53438)
FT                   /locus_tag="KLTH0A00550g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17050"
FT                   /product="KLTH0A00550p"
FT                   /note="some similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019C MUC1 GPI-anchored cell surface
FT                   glycoprotein required for diploid pseudohyphal formation
FT                   and haploid invasive growth transcriptionally regulated by
FT                   the MAPK pathway (via Ste12p and Tec1p) and the cAMP
FT                   pathway (via Flo8p)"
FT                   /db_xref="InterPro:IPR018789"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB87"
FT                   /protein_id="CAR21044.1"
FT                   /translation="MRCIWALSALTALTSTAVGSPLQKRCSNPRQNTGPKESQATCTEI
FT                   TNGCPNLDFTWKPKNTGQMLYDISMKKVQWVKDNIYEITVHVQGEKNIAISCIDGLKVI
FT                   GINGPDGGTFWLYDRNNNIAKVDSPTDYDATFRVYGQEDTSNCRVWMPNFQIQYDYNNQ
FT                   CDVYGNSKSFGLITGCNNYDNQGHSKTDAPGFYWSYQCSGKSSCGASSASSVFSTTQLT
FT                   SATSKTCTKNKPTTTSCTKNKPTTTSCTKSKTQTTSESSSTETTETYTKPSCTKSKTQT
FT                   TPETPSTETTETHTKPSCTKSKFSKTSCTKSKTQTTPETPSTETTETHTKPSCTKSKFS
FT                   KTSCTKSKTQTTPETPSTETTETHTKPSCTKSKFSKTSCTKKSKSTTPLTPSTAPGTTV
FT                   PSTTYYPSSSAPVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVSETTTPETPVGPSTAP
FT                   GTTIPGTRSCSTSPGTTVPGTTYYPSSSSSGFGNSSVPVTSAPSSSAPVSEFSSTPVSS
FT                   APSSSAPVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVSETSSTPETTAPSSSAPVSEF
FT                   SSTPVSSAPSSSAPVSEFSSTPVSSAPSSSAPVSEFSSTPVSSAPSSSAPVSESSSTCQ
FT                   TVVTSTVSGSTTVYTTTCSTPVSETSSTPVSSAPSSSAPVSSVPHSTPYYHNTTTAAGT
FT                   GSTSYPVSLSSTPVTSGSGTPATSGSVPATSGSVPATSGTPATSGSVPATSETTPATSG
FT                   TPATSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPATSGSVPATSGTPATS
FT                   GSVPATSETTPATSGSIPATSGTPATSGSVPATSETTPATSGTPATSGSVPATSETTPA
FT                   TSGSVPATSGTPATSGSVPATSETTPATSGTPATSGSVPATSETTPATSGSVPATSGTP
FT                   ATSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPATSGTPATSGSVPATSGS
FT                   IPTTSTCQTIVKSAVSGTTTIFTTTCPESTLPTTTGPAQTESVVTVTESGTVTSYTTTC
FT                   PITEVEPTTTGPDNAKTVLVSSVSGTVTSYTTTLPASESQPATTAPASSESVVVSSASG
FT                   TVTSYTTTLPASESQPATTAPASSESVVVSSASGTPVTESIVTDTVSGTTTIYTTTCPV
FT                   SSAVETTSPGPANSEIVTTSTISGTETVYTTTAPLSSAQKTEAASPSGSQTKSVESSPA
FT                   YSGSYTTPGASGSYVTQTPSSSLEVQSSSSVAAVSTTAGVSTFEGAANKLRAGLLLAIP
FT                   LALL"
FT   gene            complement(<56698..>58713)
FT                   /locus_tag="KLTH0A00572g"
FT                   /old_locus_tag="KLTH-ORF17023"
FT   CDS_pept        complement(56698..58713)
FT                   /locus_tag="KLTH0A00572g"
FT                   /gene_family="HOG000141797" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17023"
FT                   /product="KLTH0A00572p"
FT                   /note="weakly similar to uniprot|Q08905 Saccharomyces
FT                   cerevisiae YOR381W FRE3 Ferric reductase reduces
FT                   siderophore-bound iron prior to uptake by transporters
FT                   expression induced by low iron levels"
FT                   /db_xref="GOA:C5DB88"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB88"
FT                   /protein_id="CAR21045.1"
FT                   /translation="MSNALRAVALSFHSRPLPESLQLMITCVSEVNRYAWLWNGDEGGP
FT                   FYGKACGQYAPSMQTALQCFVTYGAEGSVEEKLAPFTKYCSLFAGSQLTLEDYAAALEN
FT                   GTRFLRDGASVGYGQPLATPIVLPERTMLANLKYFHYIYYNFSAAFSFSLLINLAVAAA
FT                   VVIAAVAKHSRANDKVTRFVRAKLLVPSIFGTAHHGETRTLPFYRVLLPTRGEAVLLAA
FT                   FLALNVALACYNYPLVSTGFDTKAMFLLKCVANRTGGLGFGLIPLTVLLAGRNNALQWL
FT                   TGMPFSSMMFFHKWASRTMALHSLAHALLWFVYGIYGQPEPVASMFYDFAYWRWGIYAT
FT                   LACAALLVHSAHSIKARWYEVFVVLHVTLALLFLVACLKHCAEFGWLGWIYLALGIWGS
FT                   DRALRLWRLFFRFGGYTHGYAHVISAEDHIYKIVVPHVDFSRFRFFPGCYAFLHVQGRR
FT                   WFWQSHPFTLMRAGEGLEILLKAKEGLTRDLLRALPRDGAKVPLRLALEGPYGHEAPLQ
FT                   TYRNVLVVSSGAGIPGPMSYLQKLTLAPGHVRRFAFVWAVPTEGLLESMHGSLLAAAEH
FT                   VRAAAATTCFELRIHVTRPRPGAQRPAWVPAEFVVSYGRPRVHEIVRRFCDAADGPIAV
FT                   TSCANPALDDLVRRYVSEQIARSAHRVDYYDELQVW"
FT   gene            complement(<59312..>60421)
FT                   /locus_tag="KLTH0A00594g"
FT                   /old_locus_tag="KLTH-ORF17018"
FT   CDS_pept        complement(59312..60421)
FT                   /locus_tag="KLTH0A00594g"
FT                   /gene_family="HOG000159494" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17018"
FT                   /product="KLTH0A00594p"
FT                   /note="similar to uniprot|P07257 Saccharomyces cerevisiae
FT                   YPR191W QCR2 40 kDa ubiquinol cytochrome-c reductase core
FT                   protein 2"
FT                   /db_xref="GOA:C5DB89"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB89"
FT                   /protein_id="CAR21046.1"
FT                   /translation="MIGSRTRMAGARQLARHYHISAKDSASKVSTLAVRVHAGARYAPK
FT                   EGLAHLLSRFNFHNTGNKSALRLVRESELLGGRFESTVDREYITLKATFLKEDLPYYVS
FT                   ALGDVVYKTSYRPHELPESVLPAAHHDLAVAQACPVKSAENLLYSTVFRSDLGNAVLYD
FT                   AVQKVSLDDIKAYADKVYTRDNIEIAGQGVNESDLKRFVNDSLFASLPQGTSLAKEATP
FT                   KTFVGETRLRSAEGDSVAAIAVPVAKADFATYQVLATYLTSALSDLSPLVTKAKLDQYS
FT                   NAGLFSLYVKGSDAAVVSENIKKVVATLKTGKDISAAKGAAALQLALHNETAAFPVQLS
FT                   LDNVKDFKLGKFSYAAVGDVAKLPFADEL"
FT   gene            <61421..>63292
FT                   /locus_tag="KLTH0A00616g"
FT                   /old_locus_tag="KLTH-ORF17013"
FT   CDS_pept        61421..63292
FT                   /locus_tag="KLTH0A00616g"
FT                   /gene_family="HOG000066017" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17013"
FT                   /product="KLTH0A00616p"
FT                   /note="similar to uniprot|P32349 Saccharomyces cerevisiae
FT                   YPR190C RPC82 RNA polymerase III subunit C82"
FT                   /db_xref="GOA:C5DB90"
FT                   /db_xref="InterPro:IPR008806"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013197"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB90"
FT                   /protein_id="CAR21047.1"
FT                   /translation="MATNSASPESLDDKEVINGSVASLEARGLNPESFLYRELCKTHLG
FT                   ERAAAVMNMLVSKGRLSARELCDRLDMDLKSVKRILVSLVQLRCVQYCAETSVSGRTTV
FT                   YYSYCEDGLLLMLYAGEIVEAMQVHFQSDLAAQIVQNVLALGSLTLKAYLSSGLSEVSP
FT                   SEVSAYFLRLFEAGFLVPLTANDYCPVSELWTRLYKKEYDLIPKNSTLSDLKKRTEAKQ
FT                   KAKKQFYQLVGPPDASSFIVTDPRTSLRQVADSVPLTFSLGRYLKLKRSKQLVQFSAAK
FT                   VGKVPAALYKIALRMTERSSPEITDPLTKTGLLQDADELAATQDEAARAEEKNPGVTFN
FT                   AMDISKHLSDDIDLRGTIASQMKRQRPSSAEVQSHKRVKTEDGFVVPPPPANNGAEADE
FT                   MADDNIDLDLDDSDTDPHSVTLINGHLKLLASSTVSFLQEPQPGLYYVPYTRLMPLLKS
FT                   SVYEALLSYTLGGSACRILRCIRDNNLATEKLINSTALMREKDIRSVIATLIRYNAVEI
FT                   QEVPRTADRAASRSVFLFRNNPRHAYDFMTKNLTWNIANLYHKIEDLKSENSTLLQKAN
FT                   REDVKGKETELLLPSELNQLKMVNERELNALTRTQRLLLLWEVFRFF"
FT   gene            complement(<63363..>67598)
FT                   /locus_tag="KLTH0A00638g"
FT                   /old_locus_tag="KLTH-ORF17010"
FT   CDS_pept        complement(63363..67598)
FT                   /locus_tag="KLTH0A00638g"
FT                   /gene_family="HOG000247860" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17010"
FT                   /product="KLTH0A00638p"
FT                   /note="similar to uniprot|P17883 Saccharomyces cerevisiae
FT                   YPR189W SKI3 dsRNA virus protection family member contains
FT                   8 copies of the tetratricopeptide (TPR) domain"
FT                   /db_xref="GOA:C5DB91"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB91"
FT                   /protein_id="CAR21048.1"
FT                   /translation="MAELKQLLKDAKNALASEDYEQSIEKSKEVLNLDKNNYFAHVFLG
FT                   KAFSCTGDLAQSKKHYKAAIDMDPGNMLAWKGIFMLFRTANIAPTIVSFDEFFDLCGEY
FT                   AEHLVQQQLPMVDLVNDIRNFKNFYRDCQESYLRHMRPGTPMAERLSRHLITPQDALQG
FT                   LLNIVSAEEQQQVSKLVSRERLKISANQPDYNLKVNSIAWQVYQDSEIDELYQQLINIT
FT                   DDDEKRRGLESKWLEYRIRVLKSMPADIKHHFFTKVRNMVEDMVVVDHDFLLAWQLYFE
FT                   WQDYSDLDCMDVNVISKFLKKFPKEPLAAVLYAWVCSEQSSYNSKEFYEKTFQGEDTDN
FT                   SGTSSVDSINDVVEDGMDESEKRRLQQLVDPSMEEATFGLSEDEVLLSLTENIKKTQQS
FT                   IVAHRIVSHYYVSTREYESALHYTKAGIVLCAQSVKNMGAHLSNSKRELTLDLATTYTY
FT                   FEAPKNHPTALALFEKLLTENSDNVHAKMGKGLIAIERRNWQEAYELLKEVTERYPDNY
FT                   EVLSEFAWSELHLDAPDAAIERFKYILNNVEGSDLKVLEFRSLNHWRMAKGYVYKQHGE
FT                   INAGESSEKEYIKLAFKQLVQAVKTSENFAPGYSTLGDIYSEYYQDPTRAFKCYFKSFE
FT                   MDPSDLTAARYMCEKYCGSCDWQSASLIAERVVKAEKSKSILQNVNWPYRVLGIAHLEK
FT                   QAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEKALEVSPGNAYAHY
FT                   FKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVEHCNVLCSQGFLTRSVAA
FT                   AADAIRKIESIVLHIDYKIHGMWLSLSNALRVICLVQSQVHLLPLESLVNIFEVAELRN
FT                   TDEIDKIDHVTLSGLLSDLEQDNVAIAAQFLVLSGKHAIACSDYASLPRTVRASLWYNL
FT                   GIVELMAFVILKSNSHRDAAIESFKKSIEYQSNTAEAWIGFGIASIDLNVRVAQHCFIK
FT                   ATALNPRETSVWYDMAILALRYNDVAFARAVLMKSQSIAPQDSTPWFGLALASEKEGLT
FT                   QDSARLFAHSFVLSNGKSKGAQLLYAKSVLKTRIGSGDDERDIGPGQELSAVAYGLDDY
FT                   LKKNPDDKFALQCAILTLERLRNYAAARKLSDRLLDILEKRFEKAQDDSELFHFAIVKS
FT                   QLARVYLGLKDYETAIESADLSLGILAEHNNEVAEKCITSNHAVMGLASFFLDDFDQTL
FT                   EHFKVLLDRPGESKQLVILVAKILYNVESEETREVALKELVDYINSNGPDLTVTLTIAV
FT                   ISLLEGIPDDMRAILSELKSLPLSDMISDRHRDIPFLIQQLNTKLSQDCESQQQWQRTA
FT                   FFFPNDSGSWGSLDKKIRARIAAGGQNKVPARKMSEFYSSLGNLSKIQRSIFLCPWNKE
FT                   ALSSLKGCF"
FT   gene            complement(<68319..>68867)
FT                   /locus_tag="KLTH0A00660g"
FT                   /old_locus_tag="Klth0A.mRNA.3217.m"
FT   CDS_pept        complement(join(68319..68766,68848..68867))
FT                   /locus_tag="KLTH0A00660g"
FT                   /gene_family="HOG000225272" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0A.mRNA.3217.m"
FT                   /product="KLTH0A00660p"
FT                   /note="highly similar to uniprot|P20435 Saccharomyces
FT                   cerevisiae YPR187W RPO26 RNA polymerase subunit ABC23,
FT                   common to RNA polymerases I, II, and III; part of central
FT                   core; similar to bacterial omega subunit"
FT                   /db_xref="GOA:C5DB92"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB92"
FT                   /protein_id="CAR21049.1"
FT                   /translation="MSDYEEAFNDGPENFEDFDNEHFSDAEVYDAPEEFKDGETKDESG
FT                   KTIITGGTGAEDFQQHESNRKRTLKEKAIPKDERTTTPYMTKYERARILGTRALQISMN
FT                   APVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL"
FT   gene            <69084..>70385
FT                   /locus_tag="KLTH0A00682g"
FT                   /old_locus_tag="KLTH-ORF17000"
FT   CDS_pept        69084..70385
FT                   /locus_tag="KLTH0A00682g"
FT                   /gene_family="HOG000248089" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF17000"
FT                   /product="KLTH0A00682p"
FT                   /note="similar to uniprot|P39933 Saccharomyces cerevisiae
FT                   YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
FT                   putative Zn-fingers"
FT                   /db_xref="GOA:C5DB93"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB93"
FT                   /protein_id="CAR21050.1"
FT                   /translation="MEESEDHSNFWDVGKLGSEDGLPLVRSDSVGSIQSISSAGSTSSS
FT                   RAKTWVCEYEGCSKAFTRPSQLTEHQETVHQGLKPFTCTECGRQFTRKTHLERHMFTHT
FT                   AEKPFHCSHCGKGVTTRQQLRRHEITHTRSFVCPHEGCGESFYKHPQLRSHVLAVHLQK
FT                   LNCEFCGKKFQRPYRLKNHIAKHHNPDTVYKYQCSHGSCVEAFKTWTALQQHVKEAHPK
FT                   LQCPTCGKACVGEQGLQMHMRVHSSMTVIKNWKCESCPDLYFAKKADLVSHCLEHHKDL
FT                   VSTLLNDNEREPAEPSATASPNNIPLESGARPSRLRSSSTKHDSESELESIQTEVKLRK
FT                   YFDSGKSSVSLLLNSAGRKLKCPYLGCYRSFKTEEKYEMHIQKHKIHQLKLKILQEKNQ
FT                   ATSLASEENELESNMERKNGNSQDLESLSAAANR"
FT   gene            complement(<70544..>72592)
FT                   /locus_tag="KLTH0A00704g"
FT                   /old_locus_tag="KLTH-ORF16998"
FT   CDS_pept        complement(70544..72592)
FT                   /locus_tag="KLTH0A00704g"
FT                   /gene_family="HOG000034130" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16998"
FT                   /product="KLTH0A00704p"
FT                   /note="some similarities with uniprot|Q06628 Saccharomyces
FT                   cerevisiae YPR185W ATG13 Phosphorylated protein that
FT                   interacts with Vac8p required for the cytoplasm-to-vacuole
FT                   targeting (Cvt) pathway and autophagy"
FT                   /db_xref="InterPro:IPR018731"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB94"
FT                   /protein_id="CAR21051.1"
FT                   /translation="MTTSLDKQLWELIDNFFLKAALLICHSKGWKGAPAADEGPPTTNS
FT                   WFNIETFGDTKLERELKPWTTFDGSESLPPLVIETYLDLARLSPSQQVTLKDQDGNPWN
FT                   VCKGTKKSEIMLERWLIQLDNGEDSPSLQSSGSEDTDDNVSELYRQLVLLFRYLETLVG
FT                   LLPASELQARLIRPGVSPEAPPPVKLGTRILDGSKPIVSKGRIGLSKSLIATYSNVINE
FT                   TNLPAHLEQRKITPIRTKFGSLRISVSYRKDCDFHVNGSEEYNTQFNQETRSRSAAPVA
FT                   TPSLRRVSMNSNRSMSISPNTTISPSPLAEPSPQKRGTVLARQLQPFKAGSVGSGSLPQ
FT                   VQQGSLSRNPSATSVAAALRAQRPSNGSITAPTSQLHESHLEPSSIGSGSLSKYSSSFG
FT                   RLRRQSSVRRSDSVERSQKPSKLNESPSGDLLDFMKLLDDRKELKLKNKGTKVDISNSL
FT                   LKFQGMRTTNNNLSTDLSMSMSLERPSVSQPRNRSNSHSPNSSFSPSIQYSSIPMRLSQ
FT                   SRSDSYRPEILGELSSARGSTERPKSIISNLNESFYDGRRLGGRTSSNEGYAEDEEDEE
FT                   DEEDLLVGRSAMNPASTNFRNRSTSPGSVRSVSSSFSKSQLPFKSLSNFSGPTTMATPA
FT                   HAKLHKAIVGNSPETNVSDALPKKDDSLNQEEDDDLLFFMSDMNLSK"
FT   gene            complement(<72979..>77517)
FT                   /locus_tag="KLTH0A00726g"
FT                   /old_locus_tag="KLTH-ORF16996"
FT   CDS_pept        complement(72979..77517)
FT                   /locus_tag="KLTH0A00726g"
FT                   /gene_family="HOG000212981" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16996"
FT                   /product="KLTH0A00726p"
FT                   /note="highly similar to uniprot|O93808 Saccharomyces
FT                   cerevisiae YPR184W GDB1 Glycogen debranching enzyme
FT                   containing glucanotranferase and alpha-1 6-
FT                   amyloglucosidase activities required for glycogen
FT                   degradation"
FT                   /db_xref="GOA:C5DB95"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006421"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB95"
FT                   /protein_id="CAR21052.1"
FT                   /translation="MERQLLLRVSGKGEPVVSCSYGQGVLTLPSLPVYDGYDESSPLFT
FT                   VKLVIPGGSPVARDGLVWTNCPVDAKTPFVRDKFNKKEIKATFHQDHHVELPVFRPGPF
FT                   CFYFSFRNDRDELETTRRFYFVVPPSLYIDDRYIPLNSLTMQSVVSKWMGSDWDKIFGK
FT                   IASKGYNLIHFTPLQKRGDSNSPYSIYDQLEFDPAFFPNNIDDVSKMVLKLHKEHGILA
FT                   MTDVVLNHTANNSPWLREHPDSGYNHKTAPHLISAMELDKQLLEFSGKLRQLGYPTELN
FT                   STHDLFKIMDGIKIHVLGSLKLWEYYVIDANQALDMVKNDWRQASHDQVEIPDSAKNDL
FT                   VELANFIRDSASCENFGHLGERFSNRLEGSKFVAILKTLYGFELNDAVLEEAQKIVDEI
FT                   NLPLYREYDEDIGDILEQLFNRIKYLRVDDHGPKLGPVTDKSPLTEPYFTRFNGSDGEE
FT                   YALANNGWIWNGNPLVDFASSQSKAYLRREVIVWGDCVKLRYGAKPEDSPFLWKKMSEY
FT                   IETCAKLFDGFRIDNCHSTPLHVGEYYLDLARRHKPNLYVAAELFSGSEAMDCLFVERL
FT                   GTSSLIREAMQAWSEEELSRLVHRHGGRPIGSYKFMPLDDFAYPTNRQVEEFHIHNAKR
FT                   VSEVNIPKNLTATPPHALFMDCTHDNETPFQKRTLEDTLPNAALVSFCSSAIGSVYGYD
FT                   ECFPYLLDVVGEARTYDVTANDGISVARAQLHKIRDEIAQGSADIEDSEMHVHHEGQYI
FT                   TFQRNNAKNGSGWFLVARTKFGEKGEQKLPKIKFTGSRCEFSFAYSLLKAGGVPEDKNI
FT                   IKGIPSKLEELSGFKVDYNEDLGESTIEITDSFPQGSIAVFKTQQNGIDETLLKFLTTG
FT                   ALKASEQLNLYSLNGLLYRCDAEERDISAGSSGVYDVPDFGRLTYCGLQGWVSVLRKII
FT                   FSNDLAHPMSNHLRSGHWALDYVVQRLENYKEQPGISEMQAWLASRFDRVKKLPSFLVP
FT                   TYFALVIGIAYQCCRFRAIQNMPENVGSSTRFVQSLALTSVQMLSEMRSTSLIPEKNVP
FT                   CMAAGLPHFSTDYMRCWGRDVFISLRGLLLTTARFDDAKQHILAFARTLKHGLIPNLLD
FT                   AGRNPRYNARDATWLFIQSIQDYVKMAPDGESILREKIPRRFPLDDTYITVDDPRAFSY
FT                   ETSIEDIIFEILSRHAKGISYREANAGPQLDRVMSDRGFDVKIHVDWSTGLIHGGSQYN
FT                   CGTWMDKMGESEKAGSFGVPGTPRDGAAVEISGLLKSALRFVLELHEKKLFKYTKVEKE
FT                   DGSQVTFKEWNNLVQENFEAKYFVPSDPSKDSEYDIDETLVNRRGIYKDLYKAGKPYED
FT                   YQLRPNFAIAMTVAPELFTPELALQALDNADRIIRGPVGMRTLDPSDYNYRPNYNNGED
FT                   SADFATSKGRNYHQGPEWVWCYGYFMRAFYRFHLAADARCQSKGSSKPSSYLYQQLYNR
FT                   FEGQRNFIYGSPWAGLTELTNKDGALCSDSSPTQAWSSATTLDFFYDLWEH"
FT   gene            complement(<78506..>79303)
FT                   /locus_tag="KLTH0A00748g"
FT                   /old_locus_tag="KLTH-ORF16990"
FT   CDS_pept        complement(78506..79303)
FT                   /locus_tag="KLTH0A00748g"
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16990"
FT                   /product="KLTH0A00748p"
FT                   /note="highly similar to uniprot|P14020 Saccharomyces
FT                   cerevisiae YPR183W DPM1 Dolichol phosphate mannose (Dol-P-
FT                   Man) synthase of the ER membrane catalyzes the formation of
FT                   Dol-P-Man from Dol-P and GDP-Man required for glycosyl
FT                   phosphatidylinositol membrane anchoring O mannosylation and
FT                   protein glycosylation"
FT                   /db_xref="GOA:C5DB96"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB96"
FT                   /protein_id="CAR21053.1"
FT                   /translation="MAIENSVIVPAYHERLNIKPLTTRLFAALGNDGSKTTELIFVDDN
FT                   SKDGSVEEVDALQKQGYNVRIIVRTDERGLSSAVLKGFHGAQGQYLICMDADLQHPPES
FT                   VPQLFDVLRNHAFVLGTRYAPGVGIDKDWPLYRRVISSGARMMARPLTTASDPMSGFFG
FT                   LQKKYLLNSDAKEINAQGFKIALDLLVKLPLPRQNAIGEVPFSFGVRTEGESKLSGKVI
FT                   VQYLQQLQELYVYKFGANNLVLFLFFWTILALYAFYKLMSLVF"
FT   gene            complement(<80170..>80515)
FT                   /locus_tag="KLTH0A00770g"
FT                   /old_locus_tag="Klth0A.mRNA.3193.m"
FT   CDS_pept        complement(join(80170..80442,80507..80515))
FT                   /locus_tag="KLTH0A00770g"
FT                   /gene_family="HOG000223542" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0A.mRNA.3193.m"
FT                   /product="KLTH0A00770p"
FT                   /note="similar to uniprot|P54999 Saccharomyces cerevisiae
FT                   YPR182W SMX3 Sm or Sm-like snRNP protein"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR016487"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB97"
FT                   /protein_id="CAR21054.1"
FT                   /translation="MSELAPTNPKPFLRELINKPIVVTLKFNKTQYKGLLVSTDNYFNL
FT                   QLTEAEEFIEGQSKGKIGDIFIRCNNVLWIGEDLQKKEEEPQTLDQQS"
FT   gene            complement(<80668..>81840)
FT                   /locus_tag="KLTH0A00792g"
FT                   /old_locus_tag="KLTH-ORF16987"
FT   CDS_pept        complement(80668..81840)
FT                   /locus_tag="KLTH0A00792g"
FT                   /gene_family="HOG000189223" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16987"
FT                   /product="KLTH0A00792p"
FT                   /note="similar to uniprot|P41733 Saccharomyces cerevisiae
FT                   YLR459W GAB1 GPI transamidase subunit involved in
FT                   attachment of glycosylphosphatidylinositol (GPI) anchors to
FT                   proteins may have a role in recognition of the attachment
FT                   signal or of the lipid portion of GPI"
FT                   /db_xref="GOA:C5DB98"
FT                   /db_xref="InterPro:IPR009600"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB98"
FT                   /protein_id="CAR21055.1"
FT                   /translation="MNLRELQVVFACLASRFGAAAVFPLLQQQLDRSVEFSTPVTSFRS
FT                   LQEGVFLLQNDFPLYSGGVMHHAPLLVALMSTFNSNTLISLLFTCADSAIAYQLIAMAK
FT                   CFQNLHLPAWVPGALYVINPLVLLSSVSRSTVVFSNLAISTALLSALQGKAVLSAASIA
FT                   VAAYLSLYPLLLLVPILTLLPKDRFKTVAITFTTLAGLLLSSYKINDENWNYLFSTYGV
FT                   IITFSKIIPNLGLWWYFFVELFEMFIPFFKAVFNLFIVSCIIPFSLRFHKQPFYAFILC
FT                   LCWITLTKSYPTLGEGGFLLSFVPFFRPLFGYFRYSVISTLLFIHVSVLSPVFYHLWVD
FT                   LGSGNSNFFYAISLVYALGLATVLVDLVWAMLRIEYDKGKPNLNLKLTPI"
FT   gene            <84356..>86656
FT                   /locus_tag="KLTH0A00814g"
FT                   /old_locus_tag="KLTH-ORF16980"
FT   CDS_pept        84356..86656
FT                   /locus_tag="KLTH0A00814g"
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16980"
FT                   /product="KLTH0A00814p"
FT                   /note="highly similar to uniprot|P15303 Saccharomyces
FT                   cerevisiae YPR181C SEC23 cytoplasmic GTPase-activating
FT                   protein"
FT                   /db_xref="GOA:C5DB99"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB99"
FT                   /protein_id="CAR21056.1"
FT                   /translation="MDFETNEDINGIRFSWNVFPSSRTDANKNVVPVGCLYTPLKSKED
FT                   LMVMSYNPVVCGGPQCKAVLNPYCEIDLRSNAWACPICNSRNHLPAHYANMSQENMPAE
FT                   LSNTTIEYITNRPVQVPPVFLFVVDITAEEENLQALKESIIASLSLLPPNALVGLITYG
FT                   NVVHLHDLSCDTIDKCNVFRGDREYQLLQLIEMLTGEKSGVAGAAGGAVGANAALNKIT
FT                   PFSLNRFFLPLEQVEFKLTQLLENLSPDQWSIPAGHRPLRATGSALNIATLVLQGCYKN
FT                   VASRIILFASGPGTLAPGLIVSSELKDPLRSHHDIDSDNAKHYKKASKFYSMLADRIAQ
FT                   NGHTVDIFAGCYDQVGMSEMKYLTDTTGGVLLLTDAFSTSIFKQSFLRLFSSDDEGYLT
FT                   MAFNGNMSVKTSRDLKVQGLIGHASPVKKTDATNISDSEIGVGGTSTWKMSSITPNHSY
FT                   AVFFEIANNAAASAGVVGGDRPKLAYTQFVTSYQHASGTNRVRVTTVANQLLPFGSPAI
FT                   AASFDQEAAAVLMARIAVHKAESDDGADVIRWIDRTLIKLCQKYADYNKDDPRSFRLAP
FT                   NFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTAFFMEEE
FT                   PQPVLLDSVSVKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQYADFKSLLEEPKL
FT                   EAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQDQSAGGSTIVLTDDVSLQNF
FT                   MLHLQEVTVSGQT"
FT   gene            complement(<86917..>87879)
FT                   /locus_tag="KLTH0A00836g"
FT                   /old_locus_tag="KLTH-ORF16977"
FT   CDS_pept        complement(86917..87879)
FT                   /locus_tag="KLTH0A00836g"
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16977"
FT                   /product="KLTH0A00836p"
FT                   /note="similar to uniprot|Q06624 Saccharomyces cerevisiae
FT                   YPR180W AOS1 Nuclear protein that acts as a heterodimer
FT                   with Uba2p to activate Smt3p (SUMO) before its conjugation
FT                   to proteins (sumoylation) which may play a role in protein
FT                   targeting essential for viability"
FT                   /db_xref="GOA:C5DBA0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA0"
FT                   /protein_id="CAR21057.1"
FT                   /translation="MAAQARMRSAKVLLINLGGLGTEIAKNLVLSGVGFLSLVDNHDVS
FT                   EGDLSTQFFLSKDEIGTKRLDSAISRIQDMNPRVTLTVDTEDFRQKPDSFYGQFDLIIA
FT                   TDVSTEEAIRVNQLTRKFNVPFFLCGLNGLSGFIFVDLIRFDATDEKLKSSVKTPLGAL
FT                   SQNREVVEVTEYLNEEQSEVYERIVTRNAYKPFEQVLKEGTLKGKLTKRQVKRLTNAVP
FT                   LTFALFSYRDGYAAVTRHDLEQRATDACVQLGLPSENLKQEYVEQFSQQAGLEFAPVSA
FT                   VIGGTVAQDVINILGKKQSPLNNFIVLDGISLDMHIFEL"
FT   gene            <88180..>90123
FT                   /locus_tag="KLTH0A00858g"
FT                   /old_locus_tag="KLTH-ORF16976"
FT   CDS_pept        88180..90123
FT                   /locus_tag="KLTH0A00858g"
FT                   /gene_family="HOG000094536" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16976"
FT                   /product="KLTH0A00858p"
FT                   /note="similar to uniprot|Q06623 Saccharomyces cerevisiae
FT                   YPR179C"
FT                   /db_xref="InterPro:IPR021006"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA1"
FT                   /protein_id="CAR21058.1"
FT                   /translation="MDLAKILDTAPEPAIVDAQTMGVSGDVSGDYWLPAPMCLYQKELS
FT                   EQIVSLHYSDILKYYETEDYNTDVVLHSMQTMCLNSEYVATHPYLLIDHCVPKSLITKD
FT                   IPNHLAETSGKFAVLKDLITLIQDYETETAIVCRSGRTMDLLEALLLGNRVNIKRYRSP
FT                   SIKTKQKARKHSCTCHLFPSDGFDETSGLPVDPKIYFDLLLCLDPTVDTSMPHIQQILT
FT                   QARPSSGPGKQAPIVRLTTINAIDHCELYHSKLLDPKSREYLVRVSAAVVVLRDVVGTL
FT                   PPDLRPIYSQGLKYLVEWLEDPSIPWPLPDIYPIKTFTPMDVEKSLLTEVRFNQANENL
FT                   AHVFNNGKKRGRKPNSAYSKEGEPISYYQSKRLKNDYSTNPLKQNMAQLTGIATINDGG
FT                   SVNYHLSGGLLTHKLIQSIGEAYYNLDRQSAELQNFETKEQNQVHRLELVMKEHEDIKN
FT                   QLEPAIKAQDYNREESTRLLAVVEEEHKKVASSMEELDTYTETLREKSPDFSKLIDCLL
FT                   EIAKVQEEIEKQQKLKVSRNNEHTYMTEELRRANEALAGFQAEKAPIAEETQQLEQKIE
FT                   EKLAEDRIQSQKSQERIQKLMAQINDEKAILETLDKQVASMTEQLKKTPPSKVRSSNNA
FT                   QRGKHRKHSGNS"
FT   gene            complement(<90125..>91540)
FT                   /locus_tag="KLTH0A00880g"
FT                   /old_locus_tag="KLTH-ORF16974"
FT   CDS_pept        complement(90125..91540)
FT                   /locus_tag="KLTH0A00880g"
FT                   /gene_family="HOG000157615" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16974"
FT                   /product="KLTH0A00880p"
FT                   /note="similar to uniprot|P20053 Saccharomyces cerevisiae
FT                   YPR178W PRP4 Splicing factor component of the U4/U6-U5
FT                   snRNP complex"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA2"
FT                   /protein_id="CAR21059.1"
FT                   /translation="MNGQGTISFDEIRVDTSYIVEDGGKKADDTLKSLEFDREQKLTIV
FT                   PTDDTEVRESLVHLGQPEALENESNRDRRDRLSDLLYQNPDIRAQFLERQAKSPSLETG
FT                   PSEASESEDEEFYTPASGSLVECRQFLIQDSLGRARERLRNERGHADSQDVSTTIVQRR
FT                   KLNAELSKYELWGSQVASSRPVSGVLLSPNQKSVACGSWHGDVKIIDSETLEILASFDA
FT                   IHDDKIGGLDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKFHPSDR
FT                   YVASASFDMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIGRIWDMR
FT                   SGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILAHNNIVSD
FT                   VKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFSHLYSSGWD
FT                   RSVKLWKLGVCNS"
FT   gene            <91636..>92610
FT                   /locus_tag="KLTH0A00902g"
FT                   /old_locus_tag="KLTH-ORF16973"
FT   CDS_pept        91636..92610
FT                   /locus_tag="KLTH0A00902g"
FT                   /gene_family="HOG000180334" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16973"
FT                   /product="KLTH0A00902p"
FT                   /note="highly similar to uniprot|P20133 Saccharomyces
FT                   cerevisiae YPR176C BET2 Beta subunit of Type II
FT                   geranylgeranyltransferase required for vesicular transport
FT                   between the endoplasmic reticulum and the Golgi provides a
FT                   membrane attachment moiety to Rab-like proteins Ypt1p and
FT                   Sec4p"
FT                   /db_xref="GOA:C5DBA3"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA3"
FT                   /protein_id="CAR21060.1"
FT                   /translation="MADLKLNKESHVSYIKSLDSKRQDYEYWLSEHLRLNGVYWGLTAL
FT                   CLLDAKNTFNKQEIIEFVRSCWDAKTGGFSAFPGHDAHIHTTLSGIQILATYNALDEVL
FT                   EGEALKQCISFIKDNQLPDGSFQGDRFGEVDARFVYSALNALSILGELTPEVVDPAVAF
FT                   IKRCYNFDGGFGLCPGAESHAAMAFTCIGALAIVGKLGELSADQFENIGWWLCERQVPE
FT                   GGLNGRPSKQPDVCYSWWVLSSLAIIGKLEWISFEKLREFILKSQDPKSGGISDRPDNE
FT                   VDVFHTIFGLAGLSLMGYDGLIEIDPVYCMPTSVTKTFKKYPY"
FT   gene            complement(<92634..>94724)
FT                   /locus_tag="KLTH0A00924g"
FT                   /old_locus_tag="KLTH-ORF16972"
FT   CDS_pept        complement(92634..94724)
FT                   /locus_tag="KLTH0A00924g"
FT                   /gene_family="HOG000246706" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16972"
FT                   /product="KLTH0A00924p"
FT                   /note="similar to uniprot|P24482 Saccharomyces cerevisiae
FT                   YPR175W DPB2 Second largest subunit of DNA polymerase II
FT                   (DNA polymerase epsilon) required for normal yeast
FT                   chromosomal replication expression peaks at the G1/S phase
FT                   boundary potential Cdc28p substrate"
FT                   /db_xref="GOA:C5DBA4"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA4"
FT                   /protein_id="CAR21061.1"
FT                   /translation="MDPVVALPVKIQPGLLRPLAYRVLSKKYGLNIKSDGLAALADYIG
FT                   NRFGMNWRKDSGTFKFLEQFAAIWDQQERGLFIDRVGVEEVIKEVKERSKASQIPKKVA
FT                   GEESQSSVRPKTLDNFLANRQPSAAEQNILPSSLVAPDVDQDVTDVTEEAQRMEVDEPA
FT                   LPTDSGDLDWQDHFKIIDAFAQQNFIYDHTTRQYRLKGQRARKVIPQAESNVAMFANRY
FT                   HVVKDRVMRNDLFQGHGDTFNPLSSIAGPMSSGPGSFSSQNMTITQIKNLLGRDGRSFL
FT                   LLGLLRPNYKGGWSLEDPSGSVEVDLSQAIPTVGTFYVSGCILLAEGIYFSAGHKFHVA
FT                   SLAHPPGERREATMDAIGNLDLLGVHQQSSPNYISRIDKDLKIRMHLLERELTDHRFAF
FT                   LGGDLFLDQPQILEALRKVFAKLEGDPPTMMVLQGSFSSAPLFPVMSSKNISATSAYKN
FT                   NFDALALLLLNFERLINETTFVFIPGNNDPWSSTVSLGTAGVWPQKPIPGIFAQRINRV
FT                   CKKIHWGSNPTRVAYLSQELILVRDDINGRFKRHNIAFPAIMDDEEYGGEVADSALAQD
FT                   ALMPELNDNYEGIDQLVKSQDQLAASVQESRRLVKTILDQGHISPFVSSTRPVIWNLDH
FT                   TLHLTPIPSLMVICDTTASQFEVTYNGCKSVNVGSFLYKRRARYVEYRPSSRKVVREEV
FT                   YF"
FT   gene            <94999..>95904
FT                   /locus_tag="KLTH0A00946g"
FT                   /old_locus_tag="KLTH-ORF16970"
FT   CDS_pept        94999..95904
FT                   /locus_tag="KLTH0A00946g"
FT                   /gene_family="HOG000113740" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16970"
FT                   /product="KLTH0A00946p"
FT                   /note="weakly similar to uniprot|P52919 Saccharomyces
FT                   cerevisiae YLR457C NBP1 Component of the mitotic apparatus
FT                   containing a coiled-coil domain essential for the G2/M
FT                   transition"
FT                   /db_xref="InterPro:IPR013743"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA5"
FT                   /protein_id="CAR21062.1"
FT                   /translation="MEAAKNYFKSWFNADEPRKVERGSLDKWRKRSQMLDGLGGRGARR
FT                   GRTSVTLRNKTTGKSLRPKRTAPGIWNLVKGVFSREDQDLREMKNAYTALKLRSNNRGM
FT                   QTRSQVQRRIASSAALKRKLLEKQYDEKRLDELRRGRKPGPRAVALEPRNISQPNFDTD
FT                   RVILLQHKVDALKEQLNEVERELHLTRKRLKFTQEKNALLEGLLNDANVDDDYLKSRRR
FT                   ITNLQREDLKPEYDALPPSPHRAISPLVTSSPRKVELPQDDFYERYRSIPTAELLRRDP
FT                   ESSLSPIRVDLSKYSSSRAP"
FT   gene            <96149..>97432
FT                   /locus_tag="KLTH0A00968g"
FT                   /old_locus_tag="KLTH-ORF16967"
FT   CDS_pept        96149..97432
FT                   /locus_tag="KLTH0A00968g"
FT                   /gene_family="HOG000225146" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16967"
FT                   /product="KLTH0A00968p"
FT                   /note="highly similar to uniprot|P52917 Saccharomyces
FT                   cerevisiae YPR173C VPS4 Defective in vacuolar protein
FT                   sorting homologous to mouse SKD1 and to human hVPS4 AAA-
FT                   type ATPase"
FT                   /db_xref="GOA:C5DBA6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR007330"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA6"
FT                   /protein_id="CAR21063.1"
FT                   /translation="MSTGDFLTKGIGLIQKAIDLDTATQYEEAYTAYYNGLDYLMLALK
FT                   YEKNPKSKDLIRTKFTEYLNRAEQLKEHLEAKEDTQKSKKDSPAKKTSANSNDDDADDK
FT                   KLRGALSGAILTEKPNVRWEDIAGLEGAKAALKEAVILPVKFPHLFTGNRKPTSGILLF
FT                   GPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFAMARENKPSIIFI
FT                   DEVDALTGQRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSAIRRRF
FT                   EKRIYISLPDLAARTRMFELNIGETPCSLTKEDYRTLAQLTEGYSGSDIAVVVKDALMQ
FT                   PIRKIQNATHFKNVSEDPEHRKLTPCSPGDKDAIEMSWVDIEADELQEPELNIKDFLKA
FT                   IKTTRPTVNEEDLRKQIEFTRDFGQEGD"
FT   gene            complement(<97551..>98183)
FT                   /locus_tag="KLTH0A00990g"
FT                   /old_locus_tag="KLTH-ORF16963"
FT   CDS_pept        complement(97551..98183)
FT                   /locus_tag="KLTH0A00990g"
FT                   /gene_family="HOG000248348" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16963"
FT                   /product="KLTH0A00990p"
FT                   /note="similar to uniprot|Q06608 Saccharomyces cerevisiae
FT                   YPR172W Protein of unknown function transcriptionally
FT                   activated by Yrm1p along with genes involved in multidrug
FT                   resistance"
FT                   /db_xref="GOA:C5DBA7"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA7"
FT                   /protein_id="CAR21064.1"
FT                   /translation="MSCPDSLPEHVLSLLKTSKYLHLATCSKPECIPSVSLMNYTYISP
FT                   EKVFVADKEKGATGERRHYIIMATQRDTEKYENIAQNPEVSVLIHDWVTAKKLSLRKSS
FT                   MSNTPTPEPQSAAAAAAAQNPDHPSRLLNLLQELNQSELSQMSATLRGRAEAVDPSSEE
FT                   FRYYEEALLKANPDAGVYTKGQNVAVVKVRLESAKVSDRENNTSFYD"
FT   gene            complement(<98450..>99379)
FT                   /locus_tag="KLTH0A01012g"
FT                   /old_locus_tag="KLTH-ORF16961"
FT   CDS_pept        complement(98450..99379)
FT                   /locus_tag="KLTH0A01012g"
FT                   /gene_family="HOG000142010" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16961"
FT                   /product="KLTH0A01012p"
FT                   /note="similar to uniprot|Q06188 Saccharomyces cerevisiae
FT                   YLR455W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA8"
FT                   /protein_id="CAR21065.1"
FT                   /translation="MEQKLTTGDLVLCKVGSFAPWPAVVFPQRLLRKDVYRRRRAECVA
FT                   VCFFNDETYYWDKPARLKRLTKSTIERFLEDAPATEDPGLVGAYEEARDYTSLHEFVMQ
FT                   RLEEENRIEEWEKSAEADTKVEAGQDPFEGRPAGLKAGGAKLRKSSASASPPRGYPKAR
FT                   RAASGSADGSIGTKSSSASLKSRSMPESPSAVKKLSRLDHAKRVEISLLFRCKLQRNLV
FT                   QRELPPGPDEIKESHKLLGKITENTLANPQFFDFEALKHSKLHKLLKVITNDDNLAEFH
FT                   RECNDILASWSPVIAELKKDKLNQRRDT"
FT   gene            <100382..>101902
FT                   /locus_tag="KLTH0A01034g"
FT                   /old_locus_tag="KLTH-ORF16957"
FT   CDS_pept        100382..101902
FT                   /locus_tag="KLTH0A01034g"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16957"
FT                   /product="KLTH0A01034p"
FT                   /note="similar to uniprot|P53322 Saccharomyces cerevisiae
FT                   YGR260W TNA1 High affinity nicotinic acid plasma membrane
FT                   permease"
FT                   /db_xref="GOA:C5DBA9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBA9"
FT                   /protein_id="CAR21066.1"
FT                   /translation="MSEAKLEALATVGTSEKASTVSVTSRRSYNGDELSEIQQDLAQKH
FT                   GVKQRKLEWKIDICVVPALVLLYFAAFLDRINISNARLYGMEEDLGLHGNQFNVALTVF
FT                   FVPYIVFELVANYLAKLFKPHWCFSVSMFMFGCSTIGCGFVKSFGGLITVRVFLGVAES
FT                   ATFGLIFYILSSYYTPRQAQRRFSCFFSSVTLAGAAGGSIARQIYTGIGNKHLANWRWI
FT                   FIIEGAATVFIAFLLFFITPDFPETAKFLKPNEKAFLKEKLQLYSRVESGFEVKFNWRD
FT                   YLPLFKEPIFYANALAYLGLLVPSYGYAYFATSIIKLLGYTAVSAQQHSVYPWLAAFGY
FT                   INIVAYLSDRLQNRWCFSVSSSIIGIAGLAMVLGSSAPHVRYGGCFVASLGLYGATPVV
FT                   VCWTSINLGGHLRKSFGTAFQVGLGNIGGIIATFLFLQKDEPKYTSGLSVSIGFVGLSI
FT                   ISQLFIVFYCSFMNKKKMTLTYIERFEELPIEDRVLKGDLNPNFKYLL"
FT   gene            complement(<101960..>104230)
FT                   /locus_tag="KLTH0A01056g"
FT                   /old_locus_tag="KLTH-ORF16956"
FT   CDS_pept        complement(101960..104230)
FT                   /locus_tag="KLTH0A01056g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16956"
FT                   /product="KLTH0A01056p"
FT                   /note="similar to uniprot|Q06604 Saccharomyces cerevisiae
FT                   YPR171W BSP1 Adapter that links synaptojanins Inp2p and
FT                   Inp53p to the cortical actin cytoskeleton"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB0"
FT                   /protein_id="CAR21067.1"
FT                   /translation="MEREASSLRDPELEDYLARVERLDSARNGSRRSPDAHDQRPKYRP
FT                   EDLERAQRLLDGDYTGYDSGTSPTKYSGSVPQIAYRSAYNYERTFSPKRGAGSPRRSDA
FT                   GSAPALGLDSSPDGTRRYTVSEQDYLLLQKLKREAVGDPLVSALPSRGRPRENRVVRTV
FT                   TLADDGDDNDEIPPPLPTRRAASPVLPPPDREEDSTPTKPARPLGLSVPSKSVAPAKPA
FT                   RVPDLSMRLKSAAPASPVVETGTKPSTPLQKNTAVSIDNRDSLVPKKPPPRKPASLTEA
FT                   SKADGFIKILSDRAKKPVPPKPETLKKSASYLESLENNKLTTASLDKPSKPSIQSKPSI
FT                   QSKPTSYLDSLQKNKVTVSTPVREPKSPSPIAKPQHTPQMFMNSVLKTESSRPLQDSSA
FT                   QSPKPFVIPPKRKSPQKEPVPESDEKAEVSFLSLRSSLKPAQSFKKSDAREPGFRSDEQ
FT                   KLVIPKLRRPKVQDDSAQFDGQESLKSVPRSIEGNGSASETASQRQRLNVAPPKPERKV
FT                   STPEALSKRESLAKAPPKPARKISTPEALSKRESLNKAPPKPPRKVSALEALSKRESLS
FT                   KAPPKPARKVSTPEAVNKRESLSKPPPKPSRKVSMPEAMKRLEAIKAKKLSQFEGTEVS
FT                   EKPPQKLEPTVESKGSPLKAKTEANNQKAPESELAALIAAKQLANKGKSRTAPELSNRA
FT                   HLPQAIPFMAQLDNDKIAKMLRPASETDISRPRASDGDNQLNHPTKSRARGPKRKLPKG
FT                   VKT"
FT   gene            complement(<104423..>104870)
FT                   /locus_tag="KLTH0A01078g"
FT                   /old_locus_tag="Klth0A.mRNA.gf.449.m"
FT   CDS_pept        complement(join(104423..104531,104620..104750,
FT                   104853..104870))
FT                   /locus_tag="KLTH0A01078g"
FT                   /gene_family="HOG000172240" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0A.mRNA.gf.449.m"
FT                   /product="KLTH0A01078p"
FT                   /note="highly similar to uniprot|P0C5R9 Saccharomyces
FT                   cerevisiae YPR170W-B"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB1"
FT                   /protein_id="CAR21068.1"
FT                   /translation="MKPVVSSGKAWFCTVISAFGVVILSVIAHLFNTNHESFVGSINDP
FT                   EDGPAVARTVFMAVLVYAVFFVFCGSQIWLGKKKPAIELR"
FT   gene            <105023..>105096
FT                   /locus_tag="KLTH0A01100r"
FT                   /old_locus_tag="Klth0A.tIle.AAT.1"
FT   tRNA            105023..105096
FT                   /locus_tag="KLTH0A01100r"
FT                   /old_locus_tag="Klth0A.tIle.AAT.1"
FT                   /note="tRNA-Ile (AAT) cove score=71.40"
FT   gene            complement(<105295..>106073)
FT                   /locus_tag="KLTH0A01122g"
FT                   /old_locus_tag="Klth0A.mRNA.3161.m"
FT   CDS_pept        complement(join(105295..105709,106054..106073))
FT                   /locus_tag="KLTH0A01122g"
FT                   /gene_family="HOG000230649" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0A.mRNA.3161.m"
FT                   /product="KLTH0A01122p"
FT                   /note="highly similar to uniprot|P07280 Saccharomyces
FT                   cerevisiae YOL121C RPS19A Protein component of the small
FT                   (40S) ribosomal subunit; nearly identical to Rps19Bp and
FT                   has similarity to rat S19 ribosomal protein"
FT                   /db_xref="GOA:C5DBB2"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB2"
FT                   /protein_id="CAR21069.1"
FT                   /translation="MPGVSVRDVPAQDFITAYASFLQRQGKLEVPGYVDIVKTSAGNEM
FT                   PPQDSEGWFYMRAASVARHIYMRKQVGVGKLNKLYGNAKNRGSRPSKHVDASGSVNRKV
FT                   LQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEDDE"
FT   gene            complement(<106916..>107791)
FT                   /locus_tag="KLTH0A01144g"
FT                   /old_locus_tag="Klth0A.mRNA.3142.m"
FT   CDS_pept        complement(join(106916..107364,107680..107791))
FT                   /locus_tag="KLTH0A01144g"
FT                   /gene_family="HOG000213425" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0A.mRNA.3142.m"
FT                   /product="KLTH0A01144p"
FT                   /note="highly similar to uniprot|P07279 Saccharomyces
FT                   cerevisiae YOL120C RPL18A and highly similar to
FT                   uniprot|P07279 Saccharomyces cerevisiae YNL301C RPL18B
FT                   Protein component of the large (60S) ribosomal subunit"
FT                   /db_xref="GOA:C5DBB3"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB3"
FT                   /protein_id="CAR21070.1"
FT                   /translation="MGIDHTTKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFN
FT                   KVVLRSLFLSKINRPPVSVSRIGKALNQQGAANKTVVVVGTVTDDNRIFEFPKATVAAL
FT                   RFTAGARATILKAGGECITLDQLAVRAPKGQNTLIVRGPRNSREAVRHFGAGPHKHKAP
FT                   RIMSKGRKFEKARGRRRSRGFKV"
FT   gene            complement(<108732..>110162)
FT                   /locus_tag="KLTH0A01166g"
FT                   /old_locus_tag="KLTH-ORF16936"
FT   CDS_pept        complement(108732..110162)
FT                   /locus_tag="KLTH0A01166g"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16936"
FT                   /product="KLTH0A01166p"
FT                   /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
FT                   YOL119C MCH4 Protein with similarity to mammalian
FT                   monocarboxylate permeases which are involved in transport
FT                   of monocarboxylic acids across the plasma membrane mutant
FT                   is not deficient in monocarboxylate transport"
FT                   /db_xref="GOA:C5DBB4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB4"
FT                   /protein_id="CAR21071.1"
FT                   /translation="MVSILPKRPQQLILSPHTRFEAHASGFKPQSGGTGRDSDDHVRES
FT                   TLDQLSHTGSTDDEDESEFPDGGVAAYLALLGSFMGLLPAWGVINSLGALEGYISKHQL
FT                   ASDSSSSVSWIFALYLAIVSASCVLTGAYFDRNGGFGAIVVGTVLFVTSLVATANCHTI
FT                   WQFILAFSVLGGLANGILTTPLVSCVATWFSRKRAMATSCATIGGSLGGIIFPLMLKKL
FT                   YVEVGFPWALRILAFVCLACLSFACLFARERVKQKPQAFSSKHEMAKFYVLGSFNWKYF
FT                   CDAKYVFTTLGFSLAENSILATSTYIASYAMARGNSEGSSFTLITAGNAMQILGRYVPG
FT                   YISDRYAGRFNVVIVMTLMAVVVNFAIWLPFGGNPKALWAYYLLYGFFSGSIFSLTAVC
FT                   IGQISKTRDFGKRYSTAYLLNAMMTLPTIPIAGTIIGRGSVSDYNKFIIFSTCLMLAGG
FT                   LSYAVARFLCAGVRICKV"
FT   gene            complement(<110365..>110928)
FT                   /locus_tag="KLTH0A01188g"
FT                   /old_locus_tag="KLTH-ORF16930"
FT   CDS_pept        complement(110365..110928)
FT                   /locus_tag="KLTH0A01188g"
FT                   /gene_family="HOG000255884" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16930"
FT                   /product="KLTH0A01188p"
FT                   /note="weakly similar to uniprot|P38013 Saccharomyces
FT                   cerevisiae YLR109W AHP1 Thiol-specific peroxiredoxin,
FT                   reduces hydroperoxides to protect against oxidative damage;
FT                   function in vivo requires covalent conjugation to Urm1p"
FT                   /db_xref="GOA:C5DBB5"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB5"
FT                   /protein_id="CAR21072.1"
FT                   /translation="MLHGIRSAIRPASASGLRFFHNTTRTQMFQVGDVIKTGLAGVQEN
FT                   APSNSIDLGKLVSKGKHIIVGVPAAFSPACSASHVPGYIAHLSDLQAKGVQDVFVTCVN
FT                   DAFVTKAWAESLKTPEQVHIVADTKGEFAKSGDTLFDSEEVFGNKRNYRYAVVVEDGKV
FT                   VSTFEEPDKTGVNVSSAENVLKSL"
FT   gene            <111361..>113199
FT                   /locus_tag="KLTH0A01210g"
FT                   /old_locus_tag="KLTH-ORF16928"
FT   CDS_pept        111361..113199
FT                   /locus_tag="KLTH0A01210g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16928"
FT                   /product="KLTH0A01210p"
FT                   /note="some similarities with uniprot|Q12348 Saccharomyces
FT                   cerevisiae YOL117W RRI2 subunit of COP9 Signalosome (CSN)
FT                   like protein complex that cleaves the ubiquitin-like
FT                   protein Rub1 from Cdc53 COP9 signalosome (CSN) subunit"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB6"
FT                   /protein_id="CAR21073.1"
FT                   /translation="MTGDDAGYGDFAASEDENYDDFMASDEDVSIEMEDETEDEAENEG
FT                   AAENETGSKTRQGSASRRDDSGAENGAGKPQVESGAAVMASAALQEARRMVQEQRWYEA
FT                   RSALDGVLQSSTLDPDRAFGARLELVRCCYLSWVSRQENAAGPAELTEHSELQEACGHL
FT                   QQLQAYVDWLEPEVLDSAVSRLLDLFAPPLKSKLLFEGPAASGLGPRAAVTLLECCAPL
FT                   ARHESAQDLRSRVLQHRLGFNDPPGGSQRRQMLDELATISGGRLDSLEFLITTHVQQFL
FT                   ADPQGLDVPQLQSLVSHASALLQRSLTQPLRLLSLLSFCEAIIALNNYCSPHDHAKRLS
FT                   ECQTAFWNCYKHLEELGDHSRFRDLTLCAFVLSSMLLTGQAANAHQAITPFELEQIKVI
FT                   ESTPLVQDLKHIYSDFVGYNLSGFADSLRKIKQFHLQLAGLVDALIHLLQTRMLWNRVA
FT                   RLYSCISLSDIRAQLQIGDSPQLSRNDLLTILMKSIMNDTAQVYFKLDLTHDLVYFGKE
FT                   NRRPLCPLSKHLYLSAKSDAVTKSPNTPSCNSLKEWVDNIGVFETKPRRLKDMSAVQFV
FT                   HELQQSRECTAVADSSDQAKPLKYSQLLQCVRDALS"
FT   gene            <113770..>114303
FT                   /locus_tag="KLTH0A01232g"
FT                   /old_locus_tag="KLTH-ORF16920"
FT   CDS_pept        113770..114303
FT                   /locus_tag="KLTH0A01232g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16920"
FT                   /product="KLTH0A01232p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB7"
FT                   /protein_id="CAR21074.1"
FT                   /translation="MKFSIAASVFAAAGVASATIAAVSQIGDGQIQATVPGASTSAATT
FT                   TTTSVATPASTPATVVSASTSATTESASATTFTTTFGGSSISSPVASSQRSSDDITYVD
FT                   ITTTPEVTTSQVKTEKSTSTPYSYTTLATQNSTATGSGSSSSVSLSVFEAGAQNIAAGA
FT                   GIGALAAGALIALL"
FT   gene            <114559..>115443
FT                   /locus_tag="KLTH0A01254g"
FT                   /old_locus_tag="KLTH-ORF16918"
FT   CDS_pept        114559..115443
FT                   /locus_tag="KLTH0A01254g"
FT                   /gene_family="HOG000113670" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16918"
FT                   /product="KLTH0A01254p"
FT                   /note="some similarities with uniprot|P22148 Saccharomyces
FT                   cerevisiae YOL116W MSN1 Transcriptional activator involved
FT                   in regulation of invertase and glucoamylase expression
FT                   invasive growth and pseudohyphal differentiation iron
FT                   uptake chromium accumulation and response to osmotic stress
FT                   localizes to the nucleus"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB8"
FT                   /protein_id="CAR21075.1"
FT                   /translation="MDDVSPLIARISGLESQIAMYEKLFQTLSAKLDHHFKKYDTVVNA
FT                   QQQQINSLTDVLFTLLNDRCRYADIQREKLGNTLAGVASTGASLSGVVATAGLGRQPKQ
FT                   ATGPQTSSRHVSGLQSDHQSASLYAEDTPSRREDERRSSDSYYSDNSVTSAESDESEDR
FT                   ENSELRPELHESADAAHKKRKLFDRKFRFLASPQSVAEVWKEYTEGLAGQPSLKEMEST
FT                   YRSSWRRDAAVSRKFYRRKVLCRAIETGLARGYALEEIIDMLESHRQQREGRQDKLPIG
FT                   WLCRRSNLPSIFK"
FT   gene            <115664..>117493
FT                   /locus_tag="KLTH0A01276g"
FT                   /old_locus_tag="KLTH-ORF16917"
FT   CDS_pept        115664..117493
FT                   /locus_tag="KLTH0A01276g"
FT                   /gene_family="HOG000246586" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16917"
FT                   /product="KLTH0A01276p"
FT                   /note="similar to uniprot|P53632 Saccharomyces cerevisiae
FT                   YOL115W TRF4 DNA polymerase sigma involved in mitotic
FT                   chromsome condensation"
FT                   /db_xref="GOA:C5DBB9"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBB9"
FT                   /protein_id="CAR21076.1"
FT                   /translation="MGAKEASKNERAGPKSSSKSKPLKNNQRRTKRLRKSSLSKAQRNF
FT                   AVFNKDGAHINKYENLELDNIESEGDDGSERTQESSEAPTTEATPESEEPQKEQAQDNA
FT                   LDDNQDYISLSMSSEEEQESEEEAPDEAGGEHPGGDAAQPRTLNTDYPWILNHDHSKQR
FT                   EIADWLTLEIKDFVAYISPSQEEIRVRNSTISKIRNAVKDLWPDADLHVFGSFATDLYL
FT                   PGSDIDCVINSSSGDKENRNCLYSLASFLKRRKLATQVEVISKARVPIIKFVEPISQIH
FT                   IDISFERVNGLEAARVIRGWLKETPGLRELVLIVKQFLAARRLNMVHTGGLGGFSIICL
FT                   VYAFLQLHPRVISSDIDSMENLGILLIDFFELYGKNFGYDHVAISVTDSGARYLSKELY
FT                   GSLQNPRTSFALAIQDPGDKDNNISRGSFNIRDIKKAFAGAFDLLTNRCFELDAATFKD
FT                   RVGKSILGNVIKYRGKQRDFKDERNLVVNKAIAENETYHRKRGRIVHEEVFTDVSDGEK
FT                   EDDIYTVEEPAKKKPKKAKKAKKAKKETKASSSSVDTLMGLDTQDDADEDGYDPSNEAP
FT                   STLALEDARSDIRKKSVDAQTKRDYWLSKGQAL"
FT   gene            complement(<117599..>118156)
FT                   /locus_tag="KLTH0A01298g"
FT                   /old_locus_tag="KLTH-ORF16914"
FT   CDS_pept        complement(117599..118156)
FT                   /locus_tag="KLTH0A01298g"
FT                   /gene_family="HOG000246587" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16914"
FT                   /product="KLTH0A01298p"
FT                   /note="some similarities with uniprot|Q12322 Saccharomyces
FT                   cerevisiae YOL114C Hypothetical ORF"
FT                   /db_xref="GOA:C5DBC0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC0"
FT                   /protein_id="CAR21077.1"
FT                   /translation="MRFGCRSRLPSLFFMRSVAGLLPIVRQYSAKTSLPAQQWVDSLTV
FT                   RALPEKAFSYNFDRSSGPGGQNVNKVNSKCTLTIHAFSKCDWIPQEVRDQLVQRRFRYL
FT                   SSSRDCVVIQSDQSRSRETNRQICLEKLVSELKTTCWFPKEAQPEDLQRWSAIRRKTSQ
FT                   QRLEGKKIKSDKKKLRRKVTDY"
FT   gene            <118671..>121115
FT                   /locus_tag="KLTH0A01320g"
FT                   /old_locus_tag="KLTH-ORF16912"
FT   CDS_pept        118671..121115
FT                   /locus_tag="KLTH0A01320g"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16912"
FT                   /product="KLTH0A01320p"
FT                   /note="similar to uniprot|P48562 Saccharomyces cerevisiae
FT                   YNL298W CLA4 Involved in localizing cell growth with
FT                   respect to the septin ring protein kinase homologous to
FT                   Ste20p interacts with CDC42"
FT                   /db_xref="GOA:C5DBC1"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC1"
FT                   /protein_id="CAR21078.1"
FT                   /translation="MSLSAAANKISENDFQNIGPAPRPPGAAFNKTQPITSYLNQLDLQ
FT                   DKRNEQRGAGNGNRKSGWVSYKDDGILSFLWQKRYMVLSDSYLTLYKNEPRAGSDDAVL
FT                   QIPLTTIVSVSRTQLKQNCFEVVRSSDRNSSASGSSVGSSGNGSGGSDGSRKTMYIATK
FT                   TEIDLHSWLDAIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPSNWEKLLKHSRI
FT                   TGEDWNNNSAAVIQVLQFYQEYNGAGTATASNNSSTTSLPKASINQGQYGGQQSRQNSH
FT                   DMLPQRKPPTPPSVQHRPKLQVSTSHQNYQTSQQSPYQSFNNKYASPLQNKPLNSHLPS
FT                   PPAHKLPYPQQVQGQNSSQLKQHRQNGYAQDASRFKHNMQNPYLTSTPPSSSPSSSKEQ
FT                   VSQRHAPQQRPPVNNSPYSNSSTPPPQRLHPQRAAPAVLKPPAQPAPSTAAAAAAMNQS
FT                   RPEAGPKFLQPNREAPKKPDAHPKKDVGVTKQRKPTKPTMSNAEIMAKLKSVTFNTDPT
FT                   PFFQMVEKAGQGASGSVYLAQRTQLPDYGEGDLNEQIGEQHIGDKVAIKQMILSKQPRK
FT                   ELIVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLIENSPTNGSNHA
FT                   PLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDHRARVKITDFGFCAKLTDKR
FT                   SKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIA
FT                   TNGTPKLKQPEVLSLKIKRFLSVCLCVDVKYRASTEELLHHSFFDMSCDPRDLTSLLEW
FT                   KK"
FT   gene            complement(<121198..>126042)
FT                   /locus_tag="KLTH0A01342g"
FT                   /old_locus_tag="KLTH-ORF16909"
FT   CDS_pept        complement(121198..126042)
FT                   /locus_tag="KLTH0A01342g"
FT                   /gene_family="HOG000074721" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16909"
FT                   /product="KLTH0A01342p"
FT                   /note="similar to uniprot|P48563 Saccharomyces cerevisiae
FT                   YNL297C MON2 Peripheral membrane protein with a role in
FT                   endocytosis and vacuole integrity interacts with Arl1p and
FT                   localizes to the endosome member of the Sec7p family of
FT                   proteins"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC2"
FT                   /protein_id="CAR21079.1"
FT                   /translation="MSTKLSFRKFSDELFTELHALSAESKRRSSEVRHASDKSIEILKT
FT                   VHEFEDLPRHPDFVTPFVLSCASKNAKLTSVSVQCLQKMSSVNCIPEDRIEDVLDAFID
FT                   STHLAAEIQLKVLQIIPLFFKTYSQVVVGKLCSKLLLCCSSLIQIPNKAPVVFGTASAT
FT                   LQQLINDILERATIDQESRTCKVAVNNIEFIEVGSFRHDANRLFNDLCNLKNASYSPKD
FT                   CILNVESIPEDYGLEVLESVLRNHRKLFAACPDLQFVLRTRAVPLLLRSISSSKSFPIV
FT                   VRSARCLTLLIQEEFLAILELELEIILFLLINILSNEIESPIWKKIISLELFQLVCKNF
FT                   ALVWGIFKSYDVHPDRRQILKSLLSTLKGILSQKEYHEYLKVLHVLTRGDTPIVSQEYS
FT                   VAKIPFIDLLDKASAPLVDQTYVVYLVLAVTNSISDGMGSQAVSLYQKQAKEEEVKSLK
FT                   LMYSELFDDLFFIHKMFLYASTLDTPLFHSVVRAFQKLSHSAGVLECENKLNKCLRLFG
FT                   IATVESCHIMGEAPEDNESDRSLTTASTVINTISESLIGNSSNAKGSFEANLQHSRAIH
FT                   QRTISVFRALMSLSLSLGSVFSSDSWKEVLKTWQWMSYYLEGPSRDSDHSTHGFKTAQN
FT                   PRASSSDISAAKFSIIKLYESTQHYSSSSFNVMVSSVIQQSKECAELITSNYAPEGHSP
FT                   VDGSKMLNTCIFNRDFFIAQLRELSQINIWRLVNESKWRPSWDLVISYLVEVAASREIA
FT                   NEKLRLSAVDVFNNIISRAAIVSSDPEIPQKTDTEAAQSRLLTALMQMINSIMSLKRTR
FT                   DDVRNGAVETEYDILFQVLRTLKGLLDIFGDSLQGAWDVVFKIINCPFVIMSESSITEL
FT                   SDHEEDSSILETISSKHNGVIKLSFEVFKLIFDDFLQTLPLDVVKNVIDTLLNFVRQDR
FT                   DLNISFSSISQFWLIGDYLRTCVSKVPSEFTDSQKLAFAKKIEDGQLISMISDQNTEPC
FT                   GLYYGLWLYLLKKLVECTNDERVEVKNGAIQTFFRIIDSHSSSFPPWELIVHEVIKPLL
FT                   QQRSNFEEYLESGEYVNLTLKGLIHMFALYLAKFSHTSDFTEAWSLLVCYMADLVILPS
FT                   FEISFIVLSNLRELLQAVLKIQDFPARITSEIYQRWCGYNVIYADPAKSSELKRKTNYD
FT                   CVEELLLCYPFLHQLMGSQGLLDAEKVENILLILNSAARYPLLPEFSTDNQKPSTLQNA
FT                   VLKSIKTFELGQQLDVELLMLDQISTIMALPFDTRTRIQMKLGPKLSSSSRKRIPSFEA
FT                   MSYEACSCFSQRLSGINDLNQSFVSSKRLLKILKSLSIPIINKSLIKGDMNNSAVLWTL
FT                   SSRCFFSLAEKILDVFHYEEVDHIPEEVRDAFFDMFVEVAVVPLKRLDSETDLLTEIDD
FT                   IEEFQHFREKLLQQLNLESLKAKHLKKFVSSVWSASFFHEVDDIEDEIIKSSESLEEVA
FT                   QKLAVFPFDEVLESTRGQKLLSKYKTATLCLQDLTNYMMFEGPGFDKLRAVCLPFLVAR
FT                   YAFSLRRYVSDAILLNRAPIAKDRSMEVALVLSGLRKVLDYISKAKGKVACDKAIRDLQ
FT                   VLYPLILRAIPVSQKVSGLETIVQEVSLDFTKLLH"
FT   gene            <126448..>127878
FT                   /locus_tag="KLTH0A01364g"
FT                   /old_locus_tag="KLTH-ORF16906"
FT   CDS_pept        126448..127878
FT                   /locus_tag="KLTH0A01364g"
FT                   /gene_family="HOG000142063" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16906"
FT                   /product="KLTH0A01364p"
FT                   /note="weakly similar to uniprot|P48564 Saccharomyces
FT                   cerevisiae YNL295W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC3"
FT                   /protein_id="CAR21080.1"
FT                   /translation="MFRNLAHLYNGKFQTLNRTNALWERCSCMRLCSTDANAAEKSKEE
FT                   EEEVEVATKENGKKDGGDWNGSNAYSCGRPSRKSGKGVYLVPKVHSTDHIKQDEIHTEG
FT                   LFAGNKPLFLGELSLSFKRPSGALDGIFGTLTKIKRATDDGGDQEIDVQGIINDLQTGD
FT                   KDISSGEKSAAKRPVIPWDASISGMVYNDQPFKQVPRGVVNKLKPFKLLKIERKNKSGN
FT                   SQDHELVKMRVHNSKVNDELQLVDLNREATRRPPTLELNDSAGKAKRFYTDESKSLTQF
FT                   KFIRSDQHVFKTDVDKLNNLLVKEFLKRTKLKIDSEFRDNQLPLYIYINKTLSSNALLQ
FT                   RFIRKRVTDHISPLFTTILSSYEREDEAKKFEKRIQLRVNSLVEDLAEYFPSVFFAGDI
FT                   VDCVHHPSPVPGYGRLYWLKPGKRHKAIWGRNSESDFVFNLSNTYRITRSGVRYMKYPI
FT                   NIHYRTFHQAFTEWEYRK"
FT   gene            complement(<127952..>129517)
FT                   /locus_tag="KLTH0A01386g"
FT                   /old_locus_tag="KLTH-ORF16904"
FT   CDS_pept        complement(127952..129517)
FT                   /locus_tag="KLTH0A01386g"
FT                   /gene_family="HOG000066077" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16904"
FT                   /product="KLTH0A01386p"
FT                   /note="similar to uniprot|P48565 Saccharomyces cerevisiae
FT                   YNL294C RIM21 Protein proposed to be involved in the
FT                   response to alkaline pH; has similarity to A. nidulans
FT                   PalH"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC4"
FT                   /protein_id="CAR21081.1"
FT                   /translation="MVKKTSWRYSQVPKEYQSCGGIDLGNGVLIWKNKWQPVAYFDSVR
FT                   FTSYCDEGNPVYSSLKRNRLSFPYSKALQRDWHTFITSGNDRGPFKYSIYAIIMSFTTN
FT                   FVITLFLTVIVFITIRQKPHRGASNLLKLGSTLASVNLAIFISKALKVLHQDHIYKGVV
FT                   STERVLDLLWMDLTFTCLDLLVVLICQLCQVQIIMRLFSRVKEKRTVFLVGVTLSIISQ
FT                   VLWAIPTLAQSINDNFSGLSYDADGLTLLSPFVYLFRIALAASYACIICFNMFNKRHLC
FT                   FLYQRMMILTLLALIIVLLQPGFFVADVANIWVDDLSEIFNTTCYVGSAVIVWEWVDHI
FT                   LILERKVQAQSVLGRPVYEDDQEDYHFAKYALKVQDAISRDSETGEIGSRNDTANSGTE
FT                   EQRVRWQYGDDTPPRDTNKVEFNEPQPLKNVILEKCSRIWDGMIYYTDHFIVKGLVIKT
FT                   LSIHSKSSSDDHRKRKAKVRRRIGLDRPNEVYVYATRDVVFDSDEDEAESNQGSSVDEE
FT                   RDFP"
FT   gene            <129878..>131578
FT                   /locus_tag="KLTH0A01408g"
FT                   /old_locus_tag="KLTH-ORF16902"
FT   CDS_pept        129878..131578
FT                   /locus_tag="KLTH0A01408g"
FT                   /gene_family="HOG000248756" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16902"
FT                   /product="KLTH0A01408p"
FT                   /note="similar to uniprot|P48566 Saccharomyces cerevisiae
FT                   YNL293W"
FT                   /db_xref="GOA:C5DBC5"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC5"
FT                   /protein_id="CAR21082.1"
FT                   /translation="MTKLSDVHDYGSSKTKSRNGGLSGYLASKSPSVPNLTQTFTTRSM
FT                   KETSPERAGYQQFGSPLVEEPTNLSVIDLYGDEDDEDADDDEDADDDEAEGSQSTSGVI
FT                   ADLPVSSTESPSLEAPNAFGAAKDLSQYDRYGFKKQTAHVSQEEYHMWWDQYSRYCIRR
FT                   KRKWQDLLEKSGLAPSNDVPDRFPPRSEKLKRYVRKGIPAEWRGQAWWYFARGQEKLNK
FT                   NAGVYDKLLEGLNNKKDKNNCKDLEVIERDLHRTFPENIHFQKDPKEGQEPLMIQSLRR
FT                   VLLAFSVYNPKIGYCQSMNFLAGLLLLFLDEEKSFWMLVIITSRYLPGVHNVNLEGVNV
FT                   DQGVLMLCVKEYLPDFWQRIIPKEQSRSNEFLYKLPPITLCTASWFMSCFVGVVPIETT
FT                   LRIWDCLFYEESHVLFKISLSIIKICEQELAGSRLAHRGLRARTHGRDDDDIEVFQVIQ
FT                   TVPKKLLDPQDIFDRIIFKRRVPLNNLNQEEIDRCRKYVTSQRLKFKNCAEIMGDRTSA
FT                   KASAKRDLEIGPDFVNNALSSEVYGFRRSLTGAHWNNSIKEKVRQIRRK"
FT   gene            complement(<131610..>132350)
FT                   /locus_tag="KLTH0A01430g"
FT                   /old_locus_tag="KLTH-ORF16897"
FT   CDS_pept        complement(131610..132350)
FT                   /locus_tag="KLTH0A01430g"
FT                   /gene_family="HOG000113515" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16897"
FT                   /product="KLTH0A01430p"
FT                   /note="similar to uniprot|Q12285 Saccharomyces cerevisiae
FT                   YOL111C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC6"
FT                   /protein_id="CAR21083.1"
FT                   /translation="MSLIKFNFQKANCATKKYPIDHKELPLPIGIKKQKRASMSLPEKE
FT                   FISKFLSLVAQQPIVLKSDFKTPMENITNLGVALPPLKYKYDHKRLKRNGGNGSGSARI
FT                   QLNLKSIRAPKFVYSQEFDQSETIYQVKEFLIQKEDSIHETSQLKVLLKGKVLHDNILL
FT                   SDLKSDKVDLVVMVSKLENAASQGTSAGDSANASIDAEEIAPRSVQVPWVKIEQLLKNE
FT                   MADPQEATAVLQRLQRGWDLADLD"
FT   gene            <132363..>133031
FT                   /locus_tag="KLTH0A01452g"
FT                   /old_locus_tag="KLTH-ORF16896"
FT   CDS_pept        132363..133031
FT                   /locus_tag="KLTH0A01452g"
FT                   /gene_family="HOG000248765" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16896"
FT                   /product="KLTH0A01452p"
FT                   /note="similar to uniprot|P41912 Saccharomyces cerevisiae
FT                   YOL110W SHR5 Subunit of a palmitoyltransferase composed of
FT                   Shr5p and Erf2p that adds a palmitoyl lipid moiety to Ras2p
FT                   through a thioester linkage palmitoylation is required for
FT                   Ras2p localization to the plasma membrane"
FT                   /db_xref="InterPro:IPR019383"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC7"
FT                   /protein_id="CAR21084.1"
FT                   /translation="MNSALTSSNSKHVVPDDSDQPKALFFNYHEFSVTDYAEIGKECSE
FT                   HEEELALCITHFPNTYAPLDSIRFKQTRIVRIPRRYEDNLDWPVFCTLLPGHEPAALVN
FT                   QDGSLQFVPYGFYENQIYGLSSVSPLSSYLSPEEFKDIVETVNMYLRQGYDPNTWRNII
FT                   SATFDVLTFNLWNCLMIRLVSSPLLKLENYVETLNKSKLFKNKNIRLISPRRSGFLSVC
FT                   "
FT   gene            <133212..>134447
FT                   /locus_tag="KLTH0A01474g"
FT                   /old_locus_tag="KLTH-ORF16895"
FT   CDS_pept        133212..134447
FT                   /locus_tag="KLTH0A01474g"
FT                   /gene_family="HOG000176412" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16895"
FT                   /product="KLTH0A01474p"
FT                   /note="similar to uniprot|P48567 Saccharomyces cerevisiae
FT                   YNL292W PUS4 catalyzes formation of Psi55 (modified
FT                   uridine) in mitochondrial and cytoplasmic tRNAs
FT                   Pseudouridine synthase"
FT                   /db_xref="GOA:C5DBC8"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC8"
FT                   /protein_id="CAR21085.1"
FT                   /translation="MNGIFAIEKPSGISSSQFLLKLQNVLMNSSVFSREIQRATAERMQ
FT                   QYQRETGKKPSKRKLRKVSKVKMGHGGTLDPLASGVLVVGVGTGTKKLSQYLSGTVKVY
FT                   ESEALFGVSTTSGDVEGEILSMHSVSHLKMDDLKSVEKKMVGSLKQTPPIFAALKMNGK
FT                   PLHEYAREGIPLPRAIEPRQVEIYDLEVFPESLTRDHTYKLLRPATDADKEVVSELSHQ
FT                   GNLLTDKLFFSKQFCESQGWESEEAKVDPPIALSEEEMQQLLAEGDNYRAPLLHFKAKV
FT                   SSGTYIRSLISDIGKAMRSSCYMVKLVRCQQQEWALDKRNVFRMEDFTENDEAVWTKVL
FT                   EQVLEQGSSVDIMQELADAQDAFKKQKEDLEQQLKSELQSCSSAEVAEVDGSANPAKRP
FT                   LDEDDSNSEAKS"
FT   gene            complement(<134444..>136030)
FT                   /locus_tag="KLTH0A01496g"
FT                   /old_locus_tag="KLTH-ORF16892"
FT   CDS_pept        complement(134444..136030)
FT                   /locus_tag="KLTH0A01496g"
FT                   /gene_family="HOG000248364" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16892"
FT                   /product="KLTH0A01496p"
FT                   /note="similar to uniprot|P41821 Saccharomyces cerevisiae
FT                   YNL291C MID1 N-glycosylated integral plasma membrane
FT                   protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBC9"
FT                   /protein_id="CAR21086.1"
FT                   /translation="MTNEMYWGLWAITWIAAFLGTVQGYRDFSVSDEEVQRASLLNSNL
FT                   IQEWTPIESVITAGKRDYFTFQINSTYAHTMSKLDMLVFISGNLHSESARLSNSTELQL
FT                   AVWYSFDQEVTSDTSKGSRALFSAGYMEALAATPLEDQDGNLTEYSNLYLVIEAYNVTS
FT                   NSPLQLTSTTQDLSWNYTIGVSQYDLVFQWDVRSWVELVDSDADSALLVTGNVTSLTTT
FT                   SANSSLYDVGLYELYLYSYDELIAFDKALPHSLRAVQDGPYLASSVNNSAVKIELSNSS
FT                   TPEIVKSLTVRGGSVKEQFYITGLNHSTTYGVYLTKKISDNTEVLSDSGGILFSKATFT
FT                   TMADDSCSLIFGLDFCDGVAYSVPTAKSAGTNKTVTSLIYDGIASSLYSNFSKALQMIP
FT                   CDTEKDARFSPLRTCNDCANSYRNWLCAVTIPRCTTENSSYYIHRDKTQNRNDFLNQQI
FT                   QPIHDYYEILPCIDMCYNLAADCPPDFQFSCPSKTSHSELLYLSYSVWEENDFHTCNYV
FT                   GNSRNLHILNS"
FT   gene            complement(<136291..>136394)
FT                   /locus_tag="KLTH0A01518r"
FT                   /old_locus_tag="Klth0A.tSer.GCT.13"
FT   tRNA            complement(join(136291..136335,136358..136394))
FT                   /locus_tag="KLTH0A01518r"
FT                   /old_locus_tag="Klth0A.tSer.GCT.13"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            <137284..>138270
FT                   /locus_tag="KLTH0A01540g"
FT                   /old_locus_tag="KLTH-ORF16886"
FT   CDS_pept        137284..138270
FT                   /locus_tag="KLTH0A01540g"
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16886"
FT                   /product="KLTH0A01540p"
FT                   /note="highly similar to uniprot|P38629 Saccharomyces
FT                   cerevisiae YNL290W RFC3 Subunit of heteropentameric
FT                   Replication factor C (RF-C) which is a DNA binding protein
FT                   and ATPase that acts as a clamp loader of the proliferating
FT                   cell nuclear antigen (PCNA) processivity factor for DNA
FT                   polymerases delta and epsilon"
FT                   /db_xref="GOA:C5DBD0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD0"
FT                   /protein_id="CAR21087.1"
FT                   /translation="MNRSAENLPWIEKYRPQTLDDVYGQREIVGTVRKFVKEGRLPHLL
FT                   FYGPPGTGKTSMIVALSREIYGTNYRNMVLELNASDDRGIDVVRNQIKEFASTRQIFSK
FT                   GFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYAHKLTPALLSRCTRFRFQP
FT                   LPTDAIEKRVNKVLILENLKLSREAFTALLRLSKGDMRRALNVLQASKATLDDPDAEVT
FT                   EDTIYECIGAPHPQDIETALESMLKDDWSTAFFTVNKIRTLKGLALIDLVEGIVETLEG
FT                   YELKPETRVELLCKLSDIEYAMSKGGNDKVQSSAVIGVVKSSFELEA"
FT   gene            complement(<138389..>140236)
FT                   /locus_tag="KLTH0A01562g"
FT                   /old_locus_tag="KLTH-ORF16883"
FT   CDS_pept        complement(138389..140236)
FT                   /locus_tag="KLTH0A01562g"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF16883"
FT                   /product="KLTH0A01562p"
FT                   /note="similar to uniprot|P39980 Saccharomyces cerevisiae
FT                   YEL065W SIT1 Ferrioxamine B transporter member of the ARN
FT                   family of transporters that specifically recognize
FT                   siderophore-iron chelates transcription is induced during
FT                   iron deprivation and diauxic shift potentially
FT                   phosphorylated by Cdc28p"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD1"
FT                   /protein_id="CAR21088.1"
FT                   /translation="MVSFSILLHSGKNSRNKLKKMSLEGHPAKDAKDHAEQILARRKDA
FT                   GVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLATI
FT                   NCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQ
FT                   LGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMW
FT                   AFIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGL
FT                   LLVCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPW
FT                   SLVKDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITG
FT                   FLLGGVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFT
FT                   YTTQTSIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRITDVA
FT                   TYTLAYGSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLLLSAFFLRDHR
FT                   LENAVALEDVDEKSSRKSDELEARIEDNTETKGFERYGI"
FT   gene            <141289..>142134
FT                   /locus_tag="KLTH0A01584g"
FT   CDS_pept        141289..142134
FT                   /locus_tag="KLTH0A01584g"
FT                   /gene_family="HOG000000866" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0A01584p"
FT                   /note="similar to uniprot|P24867 Saccharomyces cerevisiae
FT                   YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
FT                   involved in entry into the mitotic cell cycle and
FT                   regulation of morphogenesis localizes to sites of polarized
FT                   cell growth"
FT                   /db_xref="GOA:C5DBD2"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/TrEMBL:C5DBD2"
FT                   /protein_id="CAR21089.1"
FT                   /translation="MRRCGMWAGGACGGQSTLSITASNENSVKMSDTKVLKILFKSPVT
FT                   DDMIRYLTNTTLSVLPCAREPRQAYPSPPSSPGAASKRALPSLMTFITRLVRYTNVYTS
FT                   TLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLILSAKYHNDSSPQNKHWAAYTDGL
FT                   FCLDDVNLMERQLLQLLDWDLRVEEQELCDALEPLLEPIRHDLARSRKAMARNYYHQRN
FT                   MSTCSSTSTLVSTPSLPSLASMKSLTAMKSLPSLPRLPSKASLYAPLYSQCDYSSATLV
FT                   "
FT   gene            <142562..>142659