(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2

ID   LACTH_2; SV 1; linear; genomic DNA; STD; FUN; 893706 BP.
XX
AC   CU928166;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome B complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-893706
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-893706
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..893706
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="B"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0B"
FT                   /db_xref="taxon:381046"
FT   gene            complement(<1655..>3538)
FT                   /locus_tag="KLTH0B00110g"
FT                   /old_locus_tag="KLTH-ORF15985"
FT   CDS_pept        complement(1655..3538)
FT                   /locus_tag="KLTH0B00110g"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15985"
FT                   /product="KLTH0B00110p"
FT                   /note="similar to uniprot|P25596 Saccharomyces cerevisiae
FT                   YCL073C and similar to uniprot|P36173 Saccharomyces
FT                   cerevisiae YKR106W"
FT                   /db_xref="GOA:C5DC55"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC55"
FT                   /protein_id="CAR21365.1"
FT                   /translation="MIRVASTIKILRSINTNHKMITGGIKAYELKEEKFDVTEHDIESV
FT                   ADSNKSSKLGSGFLKVKEMEIMSSTCSGKSARAALLASAFLCGFGYYLDYITRSVYTGY
FT                   ATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEA
FT                   RDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIV
FT                   QSANPAKNWRFDIGMWAFLFPISALPFIIFLLYFTRQASKTAEWKEIQGDNKEPSVRIV
FT                   YWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGFVSFMFFL
FT                   AWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLYPVLLVSVNESSKSAT
FT                   RILWLPTFVACTGSIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYHYRGGASSHSGII
FT                   GASVVLGTGSAIFTQSLIVNLQTMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQT
FT                   MYKQLYKRLEDSSLAATAFSSPYEFIELYPWGTPERTQMIYAYREVQKKTMLVSLVLTG
FT                   PLFLLILFTKDRKLGDNVTAETTQSDEDPMLTWILKRFNKIKAGWKQKSQS"
FT   gene            <4664..>6370
FT                   /locus_tag="KLTH0B00132g"
FT                   /old_locus_tag="KLTH-ORF15981"
FT   CDS_pept        4664..6370
FT                   /locus_tag="KLTH0B00132g"
FT                   /gene_family="HOG000247960" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15981"
FT                   /product="KLTH0B00132p"
FT                   /note="similar to uniprot|P36172 Saccharomyces cerevisiae
FT                   YKR105C Hypothetical ORF"
FT                   /db_xref="GOA:C5DC56"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC56"
FT                   /protein_id="CAR21366.1"
FT                   /translation="MTEIETGQNSEYNRKISDETKDLSVKQSACIAPDASKRNRVKLFL
FT                   SLLSLGLSMFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSA
FT                   VLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNE
FT                   KSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFIFFYNPE
FT                   GADLLEKGSQTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLALTFGG
FT                   QTHPWKSGIVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQRAILNAN
FT                   FTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGVIIKKTGH
FT                   IKPLLVFGSAMGVLGSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALITCHVQLDR
FT                   TSPSYGADMLETTSVNALLKSLGTTVGSILSTMVFSTSLHNKMKNSNILFEVSGELDSI
FT                   ASYRLDHFDGPRSEMGCMLNDSIRNTFWMALGSSVVAFLCSLLVSRRKVSM"
FT   gene            complement(<7385..>9055)
FT                   /locus_tag="KLTH0B00154g"
FT                   /old_locus_tag="KLTH-ORF15979"
FT   CDS_pept        complement(7385..9055)
FT                   /locus_tag="KLTH0B00154g"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15979"
FT                   /product="KLTH0B00154p"
FT                   /note="weakly similar to uniprot|P38090 Saccharomyces
FT                   cerevisiae YBR132C High affinity polyamine permease,
FT                   preferentially uses spermidine over putrescine; expression
FT                   is down-regulated by osmotic stress; plasma membrane
FT                   carnitine transporter, also functions as a low-affinity
FT                   amino acid permease"
FT                   /db_xref="GOA:C5DC57"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC57"
FT                   /protein_id="CAR21367.1"
FT                   /translation="MSKKENFELAVTTLEEGETTTIHDVGAETIRSLEGQAPSLEERIA
FT                   RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVM
FT                   VTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDKIPKA
FT                   ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGF
FT                   KNWSNPGAFAEYISKGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF
FT                   RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPH
FT                   IVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKRGVPIYCCVAVLLVCGL
FT                   AYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFL
FT                   PYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFV
FT                   KPVEMDLFSGIAELAEEDAYWEENPPKMNLLDKAFGFIL"
FT   gene            <10791..>12137
FT                   /locus_tag="KLTH0B00176g"
FT                   /old_locus_tag="KLTH-ORF15977"
FT   CDS_pept        10791..12137
FT                   /locus_tag="KLTH0B00176g"
FT                   /gene_family="HOG000223058" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15977"
FT                   /product="KLTH0B00176p"
FT                   /note="similar to uniprot|P10356 Saccharomyces cerevisiae
FT                   YER152C Hypothetical ORF"
FT                   /db_xref="GOA:C5DC58"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC58"
FT                   /protein_id="CAR21368.1"
FT                   /translation="MKSIINLFKGYASHDLLPRKDIIEATSEVLQPEVREYDYNDEDRH
FT                   PLVYGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNILVQTTL
FT                   PHTGYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSAN
FT                   GEREQKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDI
FT                   LIISDDVYDLLRLDDDNGSGALIPSPPELRFPHLDRESISAANTFGNTISNCTFSKIIA
FT                   PGLRTGYQETANANLATQLASGGANVSGGTPCQLNSMIVATMIKNGAVERIVHNFVSVL
FT                   RERAMVLAESIKLYLPKGTQYSECKGGYFSWCTLPVGYDSSKIVEEVSHEGVLLADGSH
FT                   FEVSGDKRNWGERSVRLSISYVTAAEIQEAVKTWGQFCEKHRYLSSKGS"
FT   LTR             14631..15046
FT                   /locus_tag="KLTH0B00198t"
FT                   /old_locus_tag="Klth0B.LTR.1"
FT   gene            complement(<17460..>18851)
FT                   /locus_tag="KLTH0B00220g"
FT                   /old_locus_tag="KLTH-ORF15975"
FT   CDS_pept        complement(17460..18851)
FT                   /locus_tag="KLTH0B00220g"
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15975"
FT                   /product="KLTH0B00220p"
FT                   /note="highly similar to uniprot|P07991 Saccharomyces
FT                   cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse)
FT                   catalyzes the second step of arginine degradation
FT                   expression is dually-regulated by allophanate induction and
FT                   a specific arginine induction process not nitrogen
FT                   catabolite repression sensitive"
FT                   /db_xref="GOA:C5DC59"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC59"
FT                   /protein_id="CAR21369.1"
FT                   /translation="MILARGKVAGLRRVFHHGGAFLASSQAFKMSTLNTDLSSETTVQY
FT                   EKAYSAHNYHPLPVVFQKAKGAKVWDPEGKQYLDFLSAYSAVNQGHCHPDIIAALVDQA
FT                   SKLTLSSRAFSNNVFSAFAKFITEYFRYESVLPMNTGAEAVETGLKLARRWGYMKKGIP
FT                   ENEAIILGAKDNFHGRTLGALSLSTDEEARKFFGPFLESITAKIPGTDGQYLRYGNIED
FT                   VELAFKNAGDRIAAILLEPIQGEAGIVVPPVEYLQKVQELCRKYNVLLICDEIQTGIAR
FT                   TGKMLCYEHSPNVKPDVILLGKAISGGILPVSCVLSSKEIMGCFEPGSHGSTYGGNPLS
FT                   SRVAIAALEVVKKENLVERAKTLGEFFQSELKKLQQEAGGIISDVRGRGLLTAIVIDPS
FT                   KSNGRTAWDLCLLMKDQGVLAKPTHDHIIRLAPPLVISKEDLMKGVEAIRASLKLLPNA
FT                   AKSNH"
FT   gene            <21501..>22836
FT                   /pseudo
FT                   /locus_tag="KLTH0B00242g"
FT                   /old_locus_tag="pseudo-Klth0B-21501-22836"
FT   gene            <23546..>24871
FT                   /locus_tag="KLTH0B00264g"
FT                   /old_locus_tag="KLTH-ORF15969"
FT   CDS_pept        23546..24871
FT                   /locus_tag="KLTH0B00264g"
FT                   /gene_family="HOG000148525" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15969"
FT                   /product="KLTH0B00264p"
FT                   /note="highly similar to uniprot|P40896 Saccharomyces
FT                   cerevisiae YJL213W Hypothetical ORF"
FT                   /db_xref="GOA:C5DC60"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC60"
FT                   /protein_id="CAR21370.1"
FT                   /translation="MQLTAIDVNERNNKSLEDLVTPWKIPPLKDYYIKNANLVDVREGI
FT                   TKPGAHIFTSGGFITNICFSDHEADKCTSDKFEIIDATGKFVMPGLFDNHVHVTSVPGE
FT                   TDLSKTLNMPKTRALMRVRHKLEGALARGFTTLRGCGGAESYIKAAVIEGSVIGPRLLT
FT                   CGHAISQTGGHGDMRPADLPGEAFDSCSCHMNDLGVVADGAAECYKVAREELRRGADFI
FT                   KIMAGGGVASPTDKITNLQFCDDEVTALVKVAKTYNTYVTAHAYTPEAIKACVSYGVKG
FT                   IEHGNLLDEETAQLMAKAGCYLTPTLVTYKIMASDQFSTFLSGSNREKNTQVLYRGIEA
FT                   LRIAKKNGVKICYGSDLLGSLGGYQTQEFFIRGRYLSTHEVLLSATITPAEMNGLQDQI
FT                   GEIKPGFIADMLLMNSNPLENITVLDEPESNLVFVMKEGRVY"
FT   gene            <25467..>26243
FT                   /locus_tag="KLTH0B00286g"
FT                   /old_locus_tag="KLTH-ORF15967"
FT   CDS_pept        25467..26243
FT                   /locus_tag="KLTH0B00286g"
FT                   /gene_family="HOG000001121" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15967"
FT                   /product="KLTH0B00286p"
FT                   /note="similar to uniprot|Q12288 Saccharomyces cerevisiae
FT                   YLR126C Hypothetical ORF"
FT                   /db_xref="GOA:C5DC61"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC61"
FT                   /protein_id="CAR21371.1"
FT                   /translation="MSKIAILNANPPQEALKRWGSFADMAIEMFEATKASFLNSTVEYE
FT                   VYNVYEKDFPTVLELCNGDYLGLHITGSTSDAYAIDIEWVNILRKLLQNLLKNGAHPPI
FT                   SGICFGHQILASALGSEVRRNPKGYEGGITRLEITKEALKLGLFQNSTSPLPSCEFYAS
FT                   ESHSDFVKNVPHGYINTLTSKKCDVQGLYKRNVALTFQCHPDFISEVCIKCNEGTYSRG
FT                   EINADELAHMKESGRQRNNDGRFFATYIWMLFTNVL"
FT   gene            complement(<26947..>28719)
FT                   /locus_tag="KLTH0B00308g"
FT                   /old_locus_tag="KLTH-ORF15963"
FT   CDS_pept        complement(26947..28719)
FT                   /locus_tag="KLTH0B00308g"
FT                   /gene_family="HOG000220641" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15963"
FT                   /product="KLTH0B00308p"
FT                   /note="highly similar to uniprot|P53051 Saccharomyces
FT                   cerevisiae YGR287C Hypothetical ORF"
FT                   /db_xref="GOA:C5DC62"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC62"
FT                   /protein_id="CAR21372.1"
FT                   /translation="MVSMPNHPETEPKWWKEATVYQIYPASFKDSDNDGWGDMKGIYSK
FT                   LDYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFKVIEKTHKLGMKF
FT                   ITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDKNGAPIPPNNWKSYFGGSA
FT                   WTFDEKTQEFYLRLFASTQPDLNWESEECRKAIYESSVGFWLDHGVDGFRIDVGSLYSK
FT                   VPGLPDAPIVDKDSEWQSSDPLTLNGPRIHEFHQEMNKFMRDRVKDGREIMTVGEMQHA
FT                   PNEVKKMYTSASRHELGELFNFSHTDVGTSPLFRYNLVPAVLKDFKVSLAELFEYINGT
FT                   DCWSTVYLENHDQPRSITRFGDDSPKYRVVSGKMLSVLLTALTGTLYIYQGQELGQINF
FT                   KNWPVEKYEDVEIRNNFRVIKEEHGENSVQMKKFLEAVALISRDHARTPMQWSGEEPNA
FT                   GFSGPDAKPWFYLNESFREGINVETEEKDPDSVLNFWKKALKFRKEHKDIAVYGYDFEF
FT                   VDLENKKLFSFTKKYGKKTMFTTLNFSSDEVDFEFPNDVSYSLAFGNYDEGQVDASSKT
FT                   LKPWEGRIYINESA"
FT   gene            <29891..>31591
FT                   /locus_tag="KLTH0B00330g"
FT                   /old_locus_tag="KLTH-ORF15955"
FT   CDS_pept        29891..31591
FT                   /locus_tag="KLTH0B00330g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15955"
FT                   /product="KLTH0B00330p"
FT                   /note="highly similar to uniprot|P54862 Saccharomyces
FT                   cerevisiae YOL156W HXT11 Putative hexose transporter that
FT                   is nearly identical to Hxt9p, has similarity to major
FT                   facilitator superfamily (MFS) transporters and is involved
FT                   in pleiotropic drug resistance"
FT                   /db_xref="GOA:C5DC63"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC63"
FT                   /protein_id="CAR21373.1"
FT                   /translation="MSEPGVKLDRVSSNPVEGSTKPGSISSHEKLDIEREKDLHNFPPH
FT                   ENDIELPKQPLSHYFSISILCLMIAFGGFIFGWDTGTISGFVNLSDFVRRFGSRNSKGV
FT                   YYLSKVRMGLIISIFNIGCAIGGIVLSKIGDVYGRRIGLISVTIVYVIGIIIQISSTDK
FT                   WYQYFIGRIISGLGVGGIAVLSPMLLSEVSPKHIRGMLVNLYQLLGTMGIFLGYCTNYG
FT                   TKKYTDSTQWRVGLGLCFAWAMLMISGMLFVPESPRYLVEAGKLEEAKRSLSRSNKVLI
FT                   DDPAIAAELDAISAGVESERLAGDATWGELLSTKTKVIQRVIMGIMIQSLQQLTGDNYF
FT                   FYYGTTIFKSIGLEDSFETSIIIGAVNFFSSFIAIYTIERFGRRTCLLWGAASMFCCFI
FT                   VFASVGVTKLWPEGPDHPGISSKGAGNCMIVFTMFFIFSFATTWAGCCYVIVSETFPLR
FT                   VKSKGMALSTAANWMWGFLISFFTPFITGAINFYYGYVFMGCLIFAYFYVFFFVPETKG
FT                   LTLEEVDIMWLESVPAWNSSSWVPPTRRSADYVVDTSSKNFFSKFFSKN"
FT   gene            complement(<31952..>34756)
FT                   /locus_tag="KLTH0B00352g"
FT                   /old_locus_tag="KLTH-ORF15954"
FT   CDS_pept        complement(31952..34756)
FT                   /locus_tag="KLTH0B00352g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15954"
FT                   /product="KLTH0B00352p"
FT                   /note="weakly similar to uniprot|P25611 Saccharomyces
FT                   cerevisiae YCR106W RDS1 Regulator of drug sensitivity
FT                   transcriptional regulator"
FT                   /db_xref="GOA:C5DC64"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC64"
FT                   /protein_id="CAR21374.1"
FT                   /translation="MEHQHPIKIQKRNRPSFVCQECRRRKIKCDKKRPRCSRCVDTGLP
FT                   CTYLASGSRSAADWHISGDETSIWTGESVTTTESRTPGESGAATSEAHSEALGDEQLAL
FT                   PQASTRCRCSCGSCCGYGTTFAYADGSGRRAPTSASAHEIYVNFGNPEDTMVAHEQMRY
FT                   LHKPFSALAMMQRDHFLRAFAGSVTGVILTGMHSAPANGNPESFTYDGKLNSRQDSNNE
FT                   GRGTQEIPVNVFMEEIKKTNMLMNRRRAGNDLIKLVFFQNPWSFDDNVGSTSAYPAELV
FT                   SLVTNIQDILPDVAALRFLLDCFYEAVYPLHPFLDVPSFEKVLSEVLKARSDGSQRYNI
FT                   MLGTSALHNKLENLAILLVVLKISQAALNMQQDPLKSATAKKLDIFGHNNIKDDVIILA
FT                   QKCLNALNFLRLPNENTFCCLLFLWIYQSYDLDDVNFSLPPHVALVLGTLSHLSVILGL
FT                   HNDPSMYPRLVESSQFHSSFLNYRRKLWMGVVSVRTNELLLNGNSLESTHALMSSFLKR
FT                   GREDKESYMSSVIQDEGQENSFDTRLHEFAHKEYELRRIWTKLNSACNSLDKPILLSEI
FT                   EIIISRAEITLSQLFPLTDITEISSFSCPEKGTVKCAESKAEIDYNAIRACKTYANNLR
FT                   GRIIILNISMALTVHFENLCRNEPDRYLEYYRKYLKLTFRRSLEIVKLLKKLPDNMEKN
FT                   SLFSRYKYALTRITLDSVLRTLIPMCSILFKLSFAERQLKMSVKSERVLYEKDDHSDSS
FT                   HSLQMIVNVKESLAQALRSLISLQSTNWGLGFLSCYRLVCMAKYVLHLVDIDMLPEVTN
FT                   RFWEYEKNYKQVPESIANRIFLKWGLKFKESKAIKDDLFNPNVLGAMDSDLLESFKTIL
FT                   ESLELWKLTENTPEVNDVSSLSDRNEQLSEEVAEDAQGFSLDILDYFKVFEDEYSGESF
FT                   PSIF"
FT   gene            complement(<36075..>37979)
FT                   /locus_tag="KLTH0B00374g"
FT                   /old_locus_tag="KLTH-ORF15952"
FT   CDS_pept        complement(36075..37979)
FT                   /locus_tag="KLTH0B00374g"
FT                   /gene_family="HOG000141820" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15952"
FT                   /product="KLTH0B00374p"
FT                   /note="similar to uniprot|Q08989 Saccharomyces cerevisiae
FT                   YPL277C Hypothetical ORFs"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC65"
FT                   /protein_id="CAR21375.1"
FT                   /translation="MQTRRLSFLVAAGGILVLLVFSSSRLFQTNDILSSLTSPAKTSEE
FT                   TSTAVSLIRWDNYLDYTRKLDFENSTALFNSVRAALRQSSSDIHPVGVSYFPAVIPQGT
FT                   LMYHAGSKVPTTFEWLAMDHEFSYSFGLRSPSYGRKSLQKRRGGPGRGPGGDKKPGGSN
FT                   TSVNTPDKPSRGPGLTSSQKMLTYRATRDLNKFLYLDGASAAKTETGEMDTQELLSNVA
FT                   EKKLNLSGDGENGGMQERIFAARICEWGKPFGLDGIIRVEVGFEVVLCNFSSSAVELVS
FT                   ALELVNPSEHLGLPPPSVISKENGWPLDDDGNLIEEDLTDEQKALLDKEDSWQQVLENF
FT                   YGVKSFNWLRAGAVHDKGERRIQLDYRHLVTGINRTVINPDPNNRRLLNDGTSWENQLK
FT                   IVEDLEQVLSIGFDASQSTDWQIVFDEVVDKFAPILRMLSGILQRDDSSSENIAINATA
FT                   ITLNFSLRFKAKDDVKNQYGNDREFAVYQYVRPLKDLRTNSDFLVWSASVNVVRKVVDA
FT                   IYDVNELLLPIVRSHMGKESGASIEAAQAVTRAQQEIDDLIEDLGWIELHYRCEKVCKW
FT                   DEICYTPSWGPSPMGMTVPGSPNAGTGTHYDADRQRLVIDSALRCLSLNELLGNRGHF"
FT   gene            complement(<38234..>42757)
FT                   /locus_tag="KLTH0B00396g"
FT                   /old_locus_tag="KLTH-ORF15949"
FT   CDS_pept        complement(38234..42757)
FT                   /locus_tag="KLTH0B00396g"
FT                   /old_locus_tag="KLTH-ORF15949"
FT                   /product="KLTH0B00396p"
FT                   /note="similar to uniprot|P32386 Saccharomyces cerevisiae
FT                   YLL048C"
FT                   /db_xref="GOA:C5DC66"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC66"
FT                   /protein_id="CAR21376.1"
FT                   /translation="MMQFATETEKLRSTVAFLYSFLVPLSGGSFVLLGWDLLRLYWASQ
FT                   RNACGYEAPEADASTSLISRKPEHQITEHASSYPQLEWRVLCESSQQDCEQVVKKVFGK
FT                   ELLKSYAELLTIILCIVLELSLQRAVNRTQEEAPWILSSQIFWFSLLVSSLCRIVSLHR
FT                   GGKSFITFQKLRALNFLLFGFIFCVKVLHFTLVFLRSQVKSLEGKYVTGGTFLAGVLSI
FT                   LALSSQQSFGLTDPPLNQNDAPPAPEGSSSIFHSLTFSWLDGLIFRRSQKQLRFQDIFD
FT                   LQPKYRTLPVIKRYSDRSHGCTSLIKRLTAFCWKSIIMQCTWSLAGAIASFMPTLQMKK
FT                   ILEYIENPSGSNIRVAWVCVFVMIVSKIIAALCESQAVYLGARVCFQLKSIITAEISRK
FT                   ALKQSLFSSESKTRCGATNGEVINLVAIDSTAVSELCGSLHYLVQAGIMTTVAISLLYQ
FT                   MLGWSAFVGVSVIIILLPFNVKIATLMQTYQSEALAMTDKKTNAISAMLGSIKNVKFLC
FT                   WENHFQELIMGFRSSECSFLTKKLFCWATLHLVWFLTPTLVTAATFGASIYLQKQKITV
FT                   ASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQRIEKFLNRSNTKKHEILKDSFTEM
FT                   GFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSI
FT                   RVPRGYMHDDRCSFAFCSQTPWITNATVKENIVFSSQFNTKRYQEVLHACGLEEDILEM
FT                   QEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVDPGMAVWIFQKCIM
FT                   GPLMKGKTCILATHNIALVQKHADMIILLDNGRVSKIGKARDFNFDSEFDYSKPSKLEK
FT                   AEMKPNKKPKKEMILQPDTGFSREEHKEDGSIKIEVYNWLVKHLGGWRTITAFTMLLCL
FT                   THGIEMTQNLWIKIWCSSGDGANEHYKSSIYYLSTYAAIGLFHASVTTLIMLKFLCIGL
FT                   EASSKVFAEILNRVLHAKMTFFDFTPAGRILNRITRDFEILEQELMVLLLQLLFAITSL
FT                   GAILLLISVIATKFLIFAFLLGIIYAVMITSYIPAFRDLKRYEGITRSPIFEQFSELLS
FT                   GFVTIRGFGKEKSCMGQLFRKLDLNNRPAYYVSVVQLWLCLRVEVLGSLVLGATATLSL
FT                   LNAKELGAGLAGLALTYAMPFSQSALWTATVSSNVEIKMTSVERIKEYTEIDCEDTKAG
FT                   ALINTQWSGGAEISFDHVYVRYAPHLPDVLKNVSFTLLPNSKVAIVGRTGSGKSTVMMS
FT                   LFRLIELTNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFGRYSDQE
FT                   LTHFARRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDE
FT                   ATASIDHETDATIQQVVRDFSSGGIVITVAHRMSTIIDYDQVIVLDSGIVKENNHPYLL
FT                   LKQNGAFHQMCKESGEYERLEDAAKKAYQKGLSQARSAPRNSESKC"
FT   gene            complement(<44522..>46297)
FT                   /locus_tag="KLTH0B00418g"
FT                   /old_locus_tag="KLTH-ORF15941"
FT   CDS_pept        complement(44522..46297)
FT                   /locus_tag="KLTH0B00418g"
FT                   /gene_family="HOG000234158" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15941"
FT                   /product="KLTH0B00418p"
FT                   /note="highly similar to uniprot|P43550 Saccharomyces
FT                   cerevisiae YFL053W DAK2 Dihydroxyacetone kinase required
FT                   for detoxification of dihydroxyacetone (DHA) involved in
FT                   stress adaptation"
FT                   /db_xref="GOA:C5DC67"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC67"
FT                   /protein_id="CAR21377.1"
FT                   /translation="MSQKQFKSDGNIVAPYLLGLARSNPGLTVIEHDRVVFRAASAPSA
FT                   KNKPKVTLVSGGGSGHEPTHAGFVGDGALDAIAAGAIFASPSTKQIFSALKAVESPKGT
FT                   LLIVKNYTGDIIHFGLAAERAKAAGMNVELVAVGDDVSVGKKKGSLVGRRGLGATVLVH
FT                   KIAGAAASHGLELSEVAKIARAVVENSATIAGSLDHCTVPGHKPENNLGPDEYEIGMGI
FT                   HNESGTERRSPLPSIPQLVTELLPLVLGEKEDNTFVEFSPEEDVVLMINNMGGMSNLEL
FT                   GYATEVVSEQLIKKFSIVPKRTMSGTFITALNGPGFGITLLNASKAGPDIMRYFDYPTN
FT                   ASGWNQNYHSAQEWKVLAGGKVPTAPPLETVKNEKPSGVTANYETFSKILQSGIAKVKE
FT                   VEPKVTWYDTIAGDGDCGTTLVSGGRALEEAIQKHTLRLTDAAHGIEDIAYIVEDSMGG
FT                   TSGGLYSIYLSALAKGISDSGDKTLTVDTFREASKTALDALYKYTRARPGYRTLIDALQ
FT                   PFVEALNSGQDPRTAVDAAFKGAEKTRKMDALVGRASYVAKEELSKLDDEGGLPDPGAV
FT                   GLAALLDGLVSAAGY"
FT   gene            <46950..>48908
FT                   /locus_tag="KLTH0B00440g"
FT                   /old_locus_tag="KLTH-ORF15939"
FT   CDS_pept        46950..48908
FT                   /locus_tag="KLTH0B00440g"
FT                   /gene_family="HOG000000829" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15939"
FT                   /product="KLTH0B00440p"
FT                   /note="similar to uniprot|P43549 Saccharomyces cerevisiae
FT                   YFL054C Hypothetical ORF"
FT                   /db_xref="GOA:C5DC68"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR012269"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC68"
FT                   /protein_id="CAR21378.1"
FT                   /translation="MVGESIMPSSSSSSSISSSSSDVPRATREQRGREGETEQVKWSGN
FT                   LKDSSQKTKRGDRTSVDVGVARGVSSGRKATHTEGTKNVLSRLTPLNKPAAEDAQPRHQ
FT                   KRHPVGTAFSSPNLKSLNTPLSREQARLMEYYLSTAVPRSNNNYVDPLYRHLNPSVGST
FT                   KSRPVWSLNQPLPHVLDHSLAEKMLKKNTDVKSRASSRPESREMSRAGSLASMNDWKKL
FT                   IGRSGSWRKLNDVEAQIPGATKNSGLTRNRKHSQSQIEFANNQRRAHHAASFQLGDESC
FT                   TPSLRGEDVPAQIQNQKQAGTAPTAEELLEKRFRSSLDGATPLDGGRLGTGDSESEQLA
FT                   FTNYWAKIRYRLREPFAEFLGTLILVIFGVGGNLQATVTNGSGGSYESLSFAWGFGCML
FT                   GVYVAGGVSGGHINPAVTISMAIFRKFPWKKVPVYIFAQIVGAFFGGAMAYGYFWSSIT
FT                   EFEGGTHIRTAASGACLFTNPKSYVTWRNAFFDEFIGASMLVGCLMALLDDSNSPPTNG
FT                   MTALIVGFLVAAIGMALGYQTSFTINPARDLGPRIFASMIGYGPHAFHLTHWWWTWGAW
FT                   GGPIAGGIAGALVYDIFIFTGCESPVNYPDNGYIEHRVSKILHAEFHPHDSPKSSEVVV
FT                   EEGSNSKDGSTKSNSAH"
FT   gene            complement(<49413..>51011)
FT                   /locus_tag="KLTH0B00462g"
FT                   /old_locus_tag="KLTH-ORF15936"
FT   CDS_pept        complement(49413..51011)
FT                   /locus_tag="KLTH0B00462g"
FT                   /gene_family="HOG000093932" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15936"
FT                   /product="KLTH0B00462p"
FT                   /note="weakly similar to uniprot|P38866 Saccharomyces
FT                   cerevisiae YHR176W FMO1 Flavin-containing monooxygenase,
FT                   localized to the cytoplasmic face of the ER membrane;
FT                   catalyzes oxidation of biological thiols to maintain the ER
FT                   redox buffer ratio for correct folding of disulfide- bonded
FT                   proteins"
FT                   /db_xref="GOA:C5DC69"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC69"
FT                   /protein_id="CAR21379.1"
FT                   /translation="MTKDARKEIKSVAIIGAGVAGLTSLFELLNTRKDGTTNLAYSSDG
FT                   KFDEANTNENKNPAFQKIVGFELKSSIGGIWSPNFDTPDFIEQKDLDSERYDDPLFLRP
FT                   PTEAPSELYNRGYTFSEPLITERPDTPSPKTWAASGIYQHLYSNVPQRYLRNSFIPYSE
FT                   NQEKQNSNIAPLITNYSITESLLDFAKTHRLEKHIRVNSEVVKIKKVSNGSWRLTVKEN
FT                   PKNSSLTRWYEEDFDAVLVSNGHYSIPYIPRIEGLSKWVARYRDSVLHSKSFREFDKFK
FT                   NKRCLFVGTGLSGIDILQYVFPVAKEVIVSRTPDKEEIYPWLTKAATSEGLIKKPRIKE
FT                   LRPSENRKVIFQDGSIVEGVDHIIFSTGYHWHYPFLNEGVSGLSVIKSGQKVLKDSASM
FT                   VDGLFLDTFSIDDPSLAFVGVTVTPLKWPSFELTASAIAGVWANASSLPSKDSQLSAIS
FT                   QRKKEMGENLLFHYFPPMHIKELMARLEHFLPKGRKAADIIDLKHLSDFEKAAEVAERL
FT                   FYLLKNEEIELSETL"
FT   gene            complement(<51712..>53412)
FT                   /locus_tag="KLTH0B00484g"
FT                   /old_locus_tag="KLTH-ORF15934"
FT   CDS_pept        complement(51712..53412)
FT                   /locus_tag="KLTH0B00484g"
FT                   /gene_family="HOG000141577" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15934"
FT                   /product="KLTH0B00484p"
FT                   /note="weakly similar to uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="GOA:C5DC70"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC70"
FT                   /protein_id="CAR21380.1"
FT                   /translation="MTVEEKLNGEVTEVGDVASSDQSIKVAAVFKEYEPEKEVLSEVDQ
FT                   IIREYELEDHRELLTRGALWANNPGILETESYSDEDRRVAKQAQERPLSSLSKHMLLAA
FT                   LCTSCAAINFGMDESAIGGAVLQYQKQFNITDPNIQGLTVAAPYLAAACLGSPLTIYLD
FT                   NYVGRKWIVFLSCFIGFAGSLIQGFSNGLGCLLFARLFLGIGMGLNSSTVPIYTAECSP
FT                   AISRGAILMLWQTFIALGVCLGSVFNRAFVNISGSLSWRLMIGSSAVAPFVTGILIFFP
FT                   PESPRWLIAHGKTRESLYSLMKLRPHELSGARDFYILHQSLKFESELENQLSSWQQFLS
FT                   LFTNRRNRFALIVSLIGILGQQYGGVNILVSYTTTILTNAGVDSVTAIAGSIGIGGGCF
FT                   LATFLSTQLIDRFGRRKMLLFTLPMEALCLFWLGGVLNVNDAQSRLGAGLASMYVYVLF
FT                   YGAGIGPVSFTLVAETSSITVRMAHSATCMFVNWILDFCLSMTWPKMESSMTASGGLYF
FT                   YGAFNIVVWILTFLCIPETMRFTLEQLDEIFKVGVSAHIKKSLHRIVRN"
FT   gene            complement(<53662..>54858)
FT                   /locus_tag="KLTH0B00506g"
FT                   /old_locus_tag="KLTH-ORF15932"
FT   CDS_pept        complement(53662..54858)
FT                   /locus_tag="KLTH0B00506g"
FT                   /gene_family="HOG000248798" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15932"
FT                   /product="KLTH0B00506p"
FT                   /note="weakly similar to uniprot|P53912 Saccharomyces
FT                   cerevisiae YNL134C"
FT                   /db_xref="GOA:C5DC71"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC71"
FT                   /protein_id="CAR21381.1"
FT                   /translation="MYKRKLESVDVGSILVSQMQERHLKRISIRSGPLIGVEAPLPLFQ
FT                   QAAVVKSFEEEIIVSDQIPVPQRLEDHEILIRNKYTGLNHVDWKSKKYRFNIHSFPWIN
FT                   GRESSGIVVRRGAKVDRDRFPIGAEVFLASTCYRELKTSTFQEFTVFDSRLVWRLPREI
FT                   LPDGTTRKRFGLDFAAGVGVPLVTAGSALSSFVDFNEIGKADQGRSLVVWGGSSSVGIF
FT                   TIQLARNLGIFKNIIAVSSLRYEDYLKELGATAVIDRTLPSEELVQKFQELCPTGVDYG
FT                   VDVISKKTAELVLEILKDGKGTKKSLVCLSGAPGEDVRAKYPDIKVEAVGIKRFHEDLV
FT                   FGETFVKFTSDLFEKGQLNPVRSVKVFKGFEKFGVGLRNGLKELEERGSSAEKFVVRL"
FT   gene            <55345..>56889
FT                   /locus_tag="KLTH0B00528g"
FT                   /old_locus_tag="KLTH-ORF15928"
FT   CDS_pept        55345..56889
FT                   /locus_tag="KLTH0B00528g"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15928"
FT                   /product="KLTH0B00528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DC72"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC72"
FT                   /protein_id="CAR21382.1"
FT                   /translation="MTIDHTAKRSSELEVGNAKRAQLTSPKRKNLIVNAFIMGSAGNQS
FT                   VGIWKHPQDKSAELYQSPEYWINLAKLLERGKFNAVFLADVLGPYDVYKGPANVGPVAK
FT                   AGSQWPISDPSYFIPLMAAVTTKLAFGMTISTISEQPYHLARRLGTLDLLTNGRVGWNI
FT                   VTSYLDSASRNLLDGKNLPPNEERYARAGEYVDVIYKLFLSSWRDESFKADKKTGVFTD
FT                   PEGLRHINHVGKYFNVPGPAITHPSQQKLPVIIQAGTSAKGKDLSAKNAEVVFLASLTP
FT                   EALGASIKEIKQIATTKYHRNPSKIKFIGLVTVILGDTHEEAENKYNEYKANYSDEEGA
FT                   KAMFSGWTGVDIDKFEDDEVLSNVDHIAIASAVKKWQTAYPRVEKWTKRAIIDEIKVGG
FT                   SGPVLIGTPQEVASEIQNWVDISDIDGFNFAYTVLPQSFEEIIDKLLPELEKLGLFWHD
FT                   YPNASDSSKYLTFREQLFGEPSLDKTHPASDLRWKADETREAYEARIGEALKKLVL"
FT   gene            complement(<57160..>59163)
FT                   /locus_tag="KLTH0B00550g"
FT                   /old_locus_tag="KLTH-ORF15926"
FT   CDS_pept        complement(57160..59163)
FT                   /locus_tag="KLTH0B00550g"
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15926"
FT                   /product="KLTH0B00550p"
FT                   /note="similar to uniprot|P33413 Saccharomyces cerevisiae
FT                   YHL016C DUR3 Plasma membrane urea transporter expression is
FT                   highly sensitive to nitrogen catabolite repression and
FT                   induced by allophanate the last intermediate of the
FT                   allantoin degradative pathway"
FT                   /db_xref="GOA:C5DC73"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC73"
FT                   /protein_id="CAR21383.1"
FT                   /translation="MSEFVLNQGYGYGIVLGLGALFSVLMIALSWAIAKFLNQKQDSER
FT                   FTTASRNVKQGLISSAVVSSWTWPATLLTSNLWTYSYGIVGAYWYSVTGCFQILVFTLV
FT                   AIEIKLKCPGIHTIAEVAKVRFGKWGHFCYLFYSLGTNVIVSGMILLGGSQGIAYTTGM
FT                   NIIAACFLLPVSVCIYTLFGGLQATFLSDWSHTIVIYIMVIVSIVTVYCTSDLIGSPDK
FT                   MYDLLKDMGESFPLESSANGSYLTFANKDIILTAWNALLGGAATVFMDPSYSQKAIAAG
FT                   SKEVMRGYMLGGICWQIIPLGLGTSMGLASLALTKNPAFFTYPNKLTDLEAGRGLSLVY
FT                   AMTAIFGKSGAACAVVMVFMSATSAMSAELISCSSILTYDFYKTYVNPKASGKQLVYVS
FT                   HLNVIGFSLCMGALAVVFNYIGVTLGWLFSFVGIALGPAFFGLLGMLFYKKMNTMALVV
FT                   GVPSATLCGIVGWVASATRYSSDGRVDKASLSLSEPLAFGNFISVFSSGIFVWILSQVK
FT                   SQSWNFNEMNETYFETQIADDADSDEIEFSQVSKESVKDLRKHIFITKILVFCQFIIFL
FT                   IIIPLSMYGTKYIFSRKLFRGYVCIIIIWAFLAAMWIIFYPLYESKSNLIFVFKKLIGK
FT                   ASTDSSADLSQTDTSSIEREKLDKTSINVAAI"
FT   gene            complement(<60243..>61859)
FT                   /locus_tag="KLTH0B00572g"
FT                   /old_locus_tag="KLTH-ORF15923"
FT   CDS_pept        complement(60243..61859)
FT                   /locus_tag="KLTH0B00572g"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15923"
FT                   /product="KLTH0B00572p"
FT                   /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
FT                   YLL055W Hypothetical ORF"
FT                   /db_xref="GOA:C5DC74"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC74"
FT                   /protein_id="CAR21385.1"
FT                   /translation="MLATESDRSSGSLSLENADKILVNIVENEIGQSEDQIEDKVTTSR
FT                   DADVTLGFLLDNNVLVPAVSYEEERRLARKVLWTIVPLCALIDFVLYADKATASYTSIF
FT                   GMWKDTNLDQNKYSNSTTLFYVGFIIGQVNLLFLQKFPVGRVVAALSFFWSLIIYLHTV
FT                   TTSYQGIYALRFFLGFVEAIAVPALNVTMGQFLTAEEKSWTAPLFYTTCLGNEIVVGFI
FT                   AFGILHAKPAFAIWKLFMIVIATISLLVTILVLFLYPNNPTDARFLNLKEKIWVIRRVQ
FT                   RTTGSSIEQKVIKKQQIIEALKDPVSWLFCAFFFCNQLSNNLVYQEKLLFKEIGISTLG
FT                   STLVSVAYGSFSVTCAVIASSIIRKKKNSTAYSVVFWTLFPLVGSIAMVTLPWDRTYAL
FT                   LAMICICAPKGIAWILMFSWTSTSTSGHTKKITRNALIMFWYGVANIIAPQLWRANDGP
FT                   RYYPAWIVQIVFAFFLAPISALAIRYILARRNEERKSSLDGGTPLGLIKSTDIESASTI
FT                   KGNIALLDLTDLENDHFIYPL"
FT   gene            <64332..>66188
FT                   /locus_tag="KLTH0B00594g"
FT                   /old_locus_tag="KLTH-ORF15917"
FT   CDS_pept        64332..66188
FT                   /locus_tag="KLTH0B00594g"
FT                   /gene_family="HOG000247960" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15917"
FT                   /product="KLTH0B00594p"
FT                   /note="similar to uniprot|P36172 Saccharomyces cerevisiae
FT                   YKR105C Hypothetical ORF"
FT                   /db_xref="GOA:C5DC75"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC75"
FT                   /protein_id="CAR21386.1"
FT                   /translation="MSVCLDNQTTASLSDREVVEGTKEDIHEKVTGGILEKADSANSGA
FT                   NSVAKDSENGQAAPSEPETAISPLTGLRFYVCFASLALSLFLAALDILIVGTIMETVAA
FT                   KFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSM
FT                   TMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAF
FT                   ATHVTWRWCFYINLPIGGLAFFFFLFSYNPNGENTFENFKILLGRIKRISYSQLLTVSF
FT                   YRRLFRTLVFKFDFFEFALSSAGFTLVLLALTFGGNRYDWNSGTIIAYFVVGILLIIAS
FT                   FVYDFVVFDRVKPQTDRIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNMQVVYIVQYF
FT                   QLVWGDSAWKASIHLIAPVISTVITVLFCGIITRKTGHVKILLVVGGIVIPVASGILTL
FT                   LGPKSSSSAKIGLLILPGISFGSVMNGSLLSSQLQIQKNHPLFRFDFIAVTTFNAFVKM
FT                   LGMAFGGIMSNMIFTTSVRNELSKIKPPLPHSQSVDGLISWWYKNYAGRDSAEVHVFMN
FT                   GIKDVFWAALGLAAIAAVACFCSSNKKVDIEKPEGDEEKNGK"
FT   gene            complement(<66965..>67327)
FT                   /locus_tag="KLTH0B00616g"
FT                   /old_locus_tag="KLTH-ORF15914"
FT   CDS_pept        complement(66965..67327)
FT                   /locus_tag="KLTH0B00616g"
FT                   /gene_family="HOG000190836" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15914"
FT                   /product="KLTH0B00616p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC76"
FT                   /protein_id="CAR21387.1"
FT                   /translation="MDSTAEQSQTIVPCGYVYNLTVTSNTSAMEGWCCGTAARTGSDPR
FT                   DDRLLNGTSAITCNNGNTYLQVFNGTTYEDGYLCGLGLPGAYQFPLTETKNAASRLGPR
FT                   WAQAFLLISLLIHLFA"
FT   gene            complement(<67583..>67654)
FT                   /locus_tag="KLTH0B00638r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.23"
FT   tRNA            complement(67583..67654)
FT                   /locus_tag="KLTH0B00638r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.23"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<68588..>68659)
FT                   /locus_tag="KLTH0B00660r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.22"
FT   tRNA            complement(68588..68659)
FT                   /locus_tag="KLTH0B00660r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.22"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   LTR             complement(68720..68981)
FT                   /locus_tag="KLTH0B00682t"
FT                   /old_locus_tag="Klth0B.LTR.2"
FT   gene            complement(<69489..>69854)
FT                   /locus_tag="KLTH0B00704g"
FT                   /old_locus_tag="KLTH-ORF15907"
FT   CDS_pept        complement(69489..69854)
FT                   /locus_tag="KLTH0B00704g"
FT                   /gene_family="HOG000190836" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15907"
FT                   /product="KLTH0B00704p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC77"
FT                   /protein_id="CAR21388.1"
FT                   /translation="MNSTAEQSQIIIPCGRIYNLTVTSNTSVLEGWCCGIAASSGADDR
FT                   EQTLSHEFSSISCGDNTMLQITANTTVMDGYFCGSGMANPSNAGQSSLTQTNAASDLAP
FT                   RWTQFFILLSFFMQYFA"
FT   gene            complement(<70106..>70177)
FT                   /locus_tag="KLTH0B00726r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.21"
FT   tRNA            complement(70106..70177)
FT                   /locus_tag="KLTH0B00726r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.21"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<71137..>71208)
FT                   /locus_tag="KLTH0B00748r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.20"
FT   tRNA            complement(71137..71208)
FT                   /locus_tag="KLTH0B00748r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.20"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<71519..>71890)
FT                   /locus_tag="KLTH0B00770g"
FT                   /old_locus_tag="KLTH-ORF15904"
FT   CDS_pept        complement(71519..71890)
FT                   /locus_tag="KLTH0B00770g"
FT                   /gene_family="HOG000190836" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15904"
FT                   /product="KLTH0B00770p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC78"
FT                   /protein_id="CAR21389.1"
FT                   /translation="MGPSAKQCQTVLPCGGLYNLTITSNTSVMEGYRCGSTERSGVDDR
FT                   DELLSIEIGGINCNANPAFDLYISENTTVIDGYRCGLDSTNYTEYSQCSNTKENGASNL
FT                   SPRWTHIFVFVSLFAYLFG"
FT   gene            complement(<72118..>72189)
FT                   /locus_tag="KLTH0B00792r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.19"
FT   tRNA            complement(72118..72189)
FT                   /locus_tag="KLTH0B00792r"
FT                   /old_locus_tag="Klth0B.tGlu.CTC.19"
FT                   /note="tRNA-Glu (CTC) cove score=64.56"
FT   gene            complement(<72513..>72584)
FT                   /locus_tag="KLTH0B00814r"
FT                   /old_locus_tag="Klth0B.tAsp.GTC.18"
FT   tRNA            complement(72513..72584)
FT                   /locus_tag="KLTH0B00814r"
FT                   /old_locus_tag="Klth0B.tAsp.GTC.18"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            <73357..>74829
FT                   /locus_tag="KLTH0B00836g"
FT                   /old_locus_tag="KLTH-ORF15899"
FT   CDS_pept        73357..74829
FT                   /locus_tag="KLTH0B00836g"
FT                   /gene_family="HOG000158005" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15899"
FT                   /product="KLTH0B00836p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DC79"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC79"
FT                   /protein_id="CAR21390.1"
FT                   /translation="MSSNLSTAPEEGKKVYATRSRDSGTSESIAALPEAMQQTTKYSSE
FT                   TPLLILENESEHDIQYKTCSWVHTSGLMLSEYIVLAIMSFPWSYSVLGIVPGIILTLFV
FT                   ASTVLYTGLTIIDYCERFPHLKNVCDIGQHLFWGQKWAWYATLVCFLANNTLIQGLHVL
FT                   VGAKYLNTVTDHSLCTVKFGVIVACISFVVSVPRTFSSLSKVAYFSAATMFIAVVLAMI
FT                   FAGVQDHPYGYDGTPVTFRAFPEKGTTFVQGMGAFLNIVYTFVGQITYPQFISEMQRPA
FT                   EFRKVLYIVTTCEIVIFTLAGVIIYVYVGNEYMSAPAFGSLTRTFKIIAFSFAVPTIIF
FT                   AGSLYSNVSGRLLFFTFFKRSKHLYSHTTVGWLTWIGILALTWVGAFIIAEVVPFFSDL
FT                   LSLMSSLFDCWFGFVFWGMAYFKLKEAKYQNPRYYSQLTASEKFHFFIAIFLIAVGLFI
FT                   LGPGLYAAIDSIILNYQDDAYGTVFSCASNGS"
FT   gene            <75377..>76294
FT                   /locus_tag="KLTH0B00858g"
FT                   /old_locus_tag="KLTH-ORF15893"
FT   CDS_pept        75377..76294
FT                   /locus_tag="KLTH0B00858g"
FT                   /gene_family="HOG000164438" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15893"
FT                   /product="KLTH0B00858p"
FT                   /note="highly similar to uniprot|P23641 Saccharomyces
FT                   cerevisiae YJR077C MIR1 Mitochondrial phosphate carrier
FT                   imports inorganic phosphate into mitochondria functionally
FT                   redundant with Pic2p but more abundant than Pic2 under
FT                   normal conditions"
FT                   /db_xref="GOA:C5DC80"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC80"
FT                   /protein_id="CAR21391.1"
FT                   /translation="MSAPIPQYSMSDYAKFALAGAIGCGVTHSAMVPIDVVKTRIQLEP
FT                   TVYNKGMVSSFKQIVSAEGAGALLTGFGPTLLGYSMQGAFKFGGYEVFKKLFIDTLGYD
FT                   QAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPSFADGLFGGFSRILREEGAA
FT                   SFYNGFTPILFKQIPYNIAKFLVYERAAEVYFGMVGPKDTLSNTTATGLNLLSGLTAGL
FT                   AAAVVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMVGTLTS
FT                   LQFGIYGTLKKSLGCAPAIEIASK"
FT   gene            complement(<76459..>76767)
FT                   /locus_tag="KLTH0B00880g"
FT                   /old_locus_tag="KLTH-ORF15891"
FT   CDS_pept        complement(76459..76767)
FT                   /locus_tag="KLTH0B00880g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15891"
FT                   /product="KLTH0B00880p"
FT                   /note="some similarities with uniprot|P36036 Saccharomyces
FT                   cerevisiae YKL214C YRA2 Member of the REF (RNA and export
FT                   factor binding proteins) family when overexpressed can
FT                   substitute for the function of Yra1p in export of poly(A)
FT                   mRNA from the nucleus"
FT                   /db_xref="GOA:C5DC81"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC81"
FT                   /protein_id="CAR21392.1"
FT                   /translation="MVKEIAEPVYSNIYDHESGRTAVFEFEAPEKTEEVHRALNEKEIS
FT                   GAKVTVEVFESRSRQSRRSQKKGHRGGRRGPRAPKREKPAQPTADQLDQELENYMNS"
FT   gene            <77624..>78652
FT                   /locus_tag="KLTH0B00902g"
FT                   /old_locus_tag="KLTH-ORF15889"
FT   CDS_pept        77624..78652
FT                   /locus_tag="KLTH0B00902g"
FT                   /gene_family="HOG000248881" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15889"
FT                   /product="KLTH0B00902p"
FT                   /note="similar to uniprot|Q08913 Saccharomyces cerevisiae
FT                   YOR390W Hypothetical ORF"
FT                   /db_xref="GOA:C5DC82"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC82"
FT                   /protein_id="CAR21393.1"
FT                   /translation="MESKEKLDAEPRKTRIGAQLRAEGEVVLQLLFFSILGNYSRLGLV
FT                   RLTDYRGSYVQGPTVLWANLAACFLMGAAQALKPRDVFTPLFFTAVTTGYCGSVSSFSS
FT                   FLVEVFEHATNTAADSGSHSFPNRAYGIMEFLSVLFVQLMVSMCSHLFGLCLAREFSGS
FT                   LETSGSWEASKNARRVRKVLKLAENIARILAVPVLIVQIVLAAVYTNGSRYWTFAAVFS
FT                   FPGTLLRYVLAKYLNPRVKHFPLGTFAANVFGTVLLAIFTLLSRGKLPDGSRIIKFTTT
FT                   NDVVVGLGNGFCGCLTTISTFINEGHVLPLKKTLIYYFTSIAVSFCLIVVTLGSYAWTR
FT                   GI"
FT   gene            complement(<79302..>81446)
FT                   /locus_tag="KLTH0B00924g"
FT                   /old_locus_tag="KLTH-ORF15886"
FT   CDS_pept        complement(79302..81446)
FT                   /locus_tag="KLTH0B00924g"
FT                   /gene_family="HOG000174247" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15886"
FT                   /product="KLTH0B00924p"
FT                   /note="similar to uniprot|P36037 Saccharomyces cerevisiae
FT                   YKL213C DOA1 WD repeat protein required for ubiquitin-
FT                   mediated protein degradation forms complex with Cdc48p
FT                   plays a role in controlling cellular ubiquitin
FT                   concentration also promotes efficient NHEJ in
FT                   postdiauxic/stationary phase"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC83"
FT                   /protein_id="CAR21394.1"
FT                   /translation="MVKKVFKLSATLFGHEQDVKSVAVMSNDEVATCSRDGSVRLWKKG
FT                   SNDMWQDTILYKVDEFINSLCYDKLSRLLYCGGKDTLINSISPLLGELGQEPEFVLVGH
FT                   KSNVCALNSSQGYILSGSWDATAKVWFQGALKHELVGHKASVWDVKMLPEVGFYLTASA
FT                   DGTVKLWEGEKVLKTFSNLHTDVVRHLDISPDGDQFASCSNDGTIKINDMDGNTLRTLK
FT                   GHESFVYCVKYTPCGGLVSCGEDRSVRVWGPDGAVKQVIRVPAVSVWDLDVLPNGDILV
FT                   GCSDSLARIFTCHEGRVAPQQELDTFAKEVERTAISSQTMGFDESKLSPSEALLNPGKE
FT                   GQVIVVKSPNGVNEAHQYTQGAWTKVGDVVSSAGNDKKKEFEGKMYDYVFDVDVTEGAP
FT                   PLKLPFNANGNAYQAADDFLARYELPASYREEVVRFLITNTTGVSLEQDQSSTSNGQSN
FT                   SIPQSKPMSVLPVREYLDIRSFSPDAIFNGVVKLNAQERSFDDEDLAAIGAALHDVEDN
FT                   YELLFAQASIIRSSWSNKIPAYDIMRLIVEYLPHADAMSEFIEEGLGSAMPQLEMLTVR
FT                   TLANCFKNKKWGTELMSKNAVYDSVFQTIEPNRPQASKTVNLAVSIATLIFNYSVMIIK
FT                   SGNLDLLPTVADALNNKFGPSQMIQDSEEAAYRMLVAYGNLATVEPTLLQFAKSIAWIK
FT                   PVKEKYGHLSRFSHVFADLL"
FT   gene            <81585..>83456
FT                   /locus_tag="KLTH0B00946g"
FT                   /old_locus_tag="KLTH-ORF15885"
FT   CDS_pept        81585..83456
FT                   /locus_tag="KLTH0B00946g"
FT                   /gene_family="HOG000189112" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15885"
FT                   /product="KLTH0B00946p"
FT                   /note="similar to uniprot|P32368 Saccharomyces cerevisiae
FT                   YKL212W SAC1 Lipid phosphoinositide phosphatase of the ER
FT                   and Golgi involved in protein trafficking and secretion"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC84"
FT                   /protein_id="CAR21395.1"
FT                   /translation="MAGPLLYSHLGEKIVFKLATPSSEKDVVLSLGPSGQDISLESPEI
FT                   FPTRGKIVKSAALIGCIKLKLNSYAIFAHRVEEFGVLAGHRIFKVVEHTILPLNKGGQR
FT                   DKDEQQYLDLLEMQLSSATLFYSYTYDLTNSAQRNEKLDGSSWKTADTRFFWNHYVTHS
FT                   LRTLAEKCPAAGDFIQPMIFGYAHFIETALNNVPITIGLVTRRSRFRAGTRYFRRGIDS
FT                   DGNVANFNETEQFLLVKKPEGGNSEFFSFLQTRGSVPVYWGEINNLKYKPNLVLGENSS
FT                   LDATAKHFDQQKSLYGENYLVNLVNQKGHELPVKNAYESAVNALNDPMIHYVYFDFHHE
FT                   CRKMKWYRVKLLIDHLQKMGLDPEDTFHKIVSPDGKTVDVVREQKSVVRTNCMDCLDRT
FT                   NVVQSVLASWVLQHEFQIANVVPEGTLWELDLKLLAKFQNFWADNADAVSFSYSGTGAL
FT                   KTDFTRTGKRTRKGAFADFMNSVSRYYQNNLSDGPRQDSFDLFHGNFLPFENSFQSPFP
FT                   DRRPLSIQIVPTVICAAITVIAATVFFPKGHFFSTKNLSFFFVSSAIVILSLRFIFRNG
FT                   EQYVNWPKFNNLGFLTAVQTHNKERTFKGIRYVQSPKFSKPGELKRD"
FT   gene            complement(<83522..>84985)
FT                   /locus_tag="KLTH0B00968g"
FT                   /old_locus_tag="KLTH-ORF15884"
FT   CDS_pept        complement(83522..84985)
FT                   /locus_tag="KLTH0B00968g"
FT                   /gene_family="HOG000280459" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15884"
FT                   /product="KLTH0B00968p"
FT                   /note="highly similar to uniprot|P00937 Saccharomyces
FT                   cerevisiae YKL211C TRP3 anthranilate synthase Component II
FT                   and indole-3-phosphate (multifunctional enzyme)"
FT                   /db_xref="GOA:C5DC85"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC85"
FT                   /protein_id="CAR21396.1"
FT                   /translation="MVFSAKRRVVLIDNYDSFTWNLYEYLCQEGAEVLVYRNDQITLEE
FT                   IDDLKPDCVFISPGPGHPRTDSGISRDCVRHFAGKIPVVGVCMGLQCMFDVFGGTVSYA
FT                   GEIVHGKTSQVTHDNKGIFKDIPQGVAVSRYHSLAGEPLSLPEVLEVTARTENGIIMGV
FT                   RHKNLTVEGVQFHPESILTEAGHVMVRNILNIQGGTWEEHEKLSKEKRVKGSSILDKIY
FT                   AQRQKDVDELSATPGFTLRDLQSNFNQGLAPEVQDFYTKLSSGPKSAVIAEIKRASPSK
FT                   GDIDMNAIAAEQGLKYAKAGASAISVLTEPHWFKGSIQDLVNVRRALDIEFKNAPQDRP
FT                   CVLRKEFIFSKYQILEARLAGADSVLLIVKMLSQDLLLELYNYSKFEVGIEPLVEVSSK
FT                   EEMGRALELNAKVVGVNNRDLHSFNVDLNTTSSLASSVPEGTILLALSGITSGADAEKY
FT                   KKEGVKGLLVGEALMRAANVDSLIKDLSA"
FT   gene            <86383..>87597
FT                   /locus_tag="KLTH0B00990g"
FT                   /old_locus_tag="KLTH-ORF15881"
FT   CDS_pept        86383..87597
FT                   /locus_tag="KLTH0B00990g"
FT                   /gene_family="HOG000233586" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15881"
FT                   /product="KLTH0B00990p"
FT                   /note="similar to uniprot|P32458 Saccharomyces cerevisiae
FT                   YJR076C CDC11 Component of the septin ring of the mother-
FT                   bud neck that is required for cytokinesis septins recruit
FT                   proteins to the neck and can act as a barrier to diffusion
FT                   at the membrane and they comprise the 10nm filaments seen
FT                   with EM"
FT                   /db_xref="GOA:C5DC86"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC86"
FT                   /protein_id="CAR21397.1"
FT                   /translation="MASIIEASAALRKRKNLKRGINFTLMVVGESGSGRSTFVNTLCGQ
FT                   QVVDVSTSIMLPTDRSTQIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSQSFN
FT                   VVSDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKETDVEFMKTLGPL
FT                   VNVIPVISKADSLTPAELKLNKKLIMEDIDYYHLPIYNFPFEENDISDEDYETNMYLRS
FT                   LVPFSVIGSNEVYDLGDGAMIRGRQYPWGTLDVEDSSLSDFVVLRNTLLISHLHDLKDY
FT                   THEILYERYRTEALSGETSSQRANGNSSTAYADSPVASGKSFQHAETDSLNSSKQASAN
FT                   QDTYLAREEQIRLEEERLRAFEERVQQELLMKRQELLQREQELREIEERIEREARIKEE
FT                   SGDLE"
FT   gene            <87881..>88001