(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE18

LACTH_2.PE18         Location/Qualifiers
FT   CDS_pept        55345..56889
FT                   /locus_tag="KLTH0B00528g"
FT                   /gene_family="HOG000190808" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15928"
FT                   /product="KLTH0B00528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DC72"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016048"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC72"
FT                   /protein_id="CAR21382.1"
FT                   /translation="MTIDHTAKRSSELEVGNAKRAQLTSPKRKNLIVNAFIMGSAGNQS
FT                   VGIWKHPQDKSAELYQSPEYWINLAKLLERGKFNAVFLADVLGPYDVYKGPANVGPVAK
FT                   AGSQWPISDPSYFIPLMAAVTTKLAFGMTISTISEQPYHLARRLGTLDLLTNGRVGWNI
FT                   VTSYLDSASRNLLDGKNLPPNEERYARAGEYVDVIYKLFLSSWRDESFKADKKTGVFTD
FT                   PEGLRHINHVGKYFNVPGPAITHPSQQKLPVIIQAGTSAKGKDLSAKNAEVVFLASLTP
FT                   EALGASIKEIKQIATTKYHRNPSKIKFIGLVTVILGDTHEEAENKYNEYKANYSDEEGA
FT                   KAMFSGWTGVDIDKFEDDEVLSNVDHIAIASAVKKWQTAYPRVEKWTKRAIIDEIKVGG
FT                   SGPVLIGTPQEVASEIQNWVDISDIDGFNFAYTVLPQSFEEIIDKLLPELEKLGLFWHD
FT                   YPNASDSSKYLTFREQLFGEPSLDKTHPASDLRWKADETREAYEARIGEALKKLVL"
     atgacaattg accacacagc gaaacgcagc tcggagctcg aggtcggaaa cgccaagaga        60
     gcgcaattga cgtctccaaa gcgcaaaaat ttgatcgtca acgccttcat catgggatct       120
     gcaggtaacc aatctgttgg aatctggaaa catccccaag acaagtccgc ggagctctat       180
     caatcaccag aatattggat aaatctcgcc aaacttctcg agaggggaaa gttcaatgcg       240
     gtcttcctgg cagacgtact gggaccgtat gacgtatata agggtcccgc gaacgttggc       300
     ccggttgcca aggctggatc acaatggccc atctcggacc ctagctattt tatcccactg       360
     atggcagcag tgactacaaa actcgccttt ggaatgacca tttcaaccat cagcgagcag       420
     ccgtaccact tggccaggcg cttgggaacg ctcgacctgc ttaccaacgg aagagttggc       480
     tggaatatag tgacgtctta cttggacagc gcttccagaa atttgcttga cggcaagaat       540
     ctgcctccta acgaggagcg ctacgcccga gctggtgaat acgttgatgt tatctacaaa       600
     ttgtttctaa gttcatggag agacgaaagc ttcaaggctg ataaaaaaac aggagtgttc       660
     accgaccctg aaggccttag acacatcaat catgtgggca aatacttcaa tgtacctggg       720
     ccagctatca ctcatcctag ccagcaaaaa ctaccagtta taattcaggc tggcacttcg       780
     gccaaaggaa aagatctttc tgcaaaaaac gctgaggtag tttttcttgc tagcttgact       840
     ccagaagctc tcggcgcttc tataaaagag ataaagcaga ttgcgactac aaaataccat       900
     aggaatccat cgaaaatcaa gttcattgga ctggttactg ttatattggg agatactcat       960
     gaagaggcag aaaataaata caacgaatac aaagcaaact attccgatga ggagggagcc      1020
     aaggccatgt tttcgggttg gacaggcgta gatattgaca agttcgagga cgacgaggta      1080
     ctttctaacg ttgatcatat tgccattgca tcggcggtca agaaatggca aacagcctat      1140
     cccagagtgg agaagtggac aaagagggct atcatagatg aaatcaaggt tggtgggagc      1200
     ggccctgtat tgatcggaac cccccaagaa gttgcaagtg aaattcagaa ctgggtggat      1260
     atctctgaca tagatggttt taactttgcg tacacagttc ttcctcagtc tttcgaagag      1320
     attatcgaca aactgctgcc tgagcttgaa aagctgggat tgttctggca tgattaccca      1380
     aatgcttccg actcttccaa gtacttaact ttcagagagc aattgtttgg ggagccatcg      1440
     cttgataaga cacacccggc ctcggacttg agatggaaag cagatgaaac gagagaggct      1500
     tacgaagcaa gaattgggga agccttgaaa aaattagtgt tgtag                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page