(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE29

LACTH_2.PE29         Location/Qualifiers
FT   CDS_pept        complement(79302..81446)
FT                   /locus_tag="KLTH0B00924g"
FT                   /gene_family="HOG000174247" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15886"
FT                   /product="KLTH0B00924p"
FT                   /note="similar to uniprot|P36037 Saccharomyces cerevisiae
FT                   YKL213C DOA1 WD repeat protein required for ubiquitin-
FT                   mediated protein degradation forms complex with Cdc48p
FT                   plays a role in controlling cellular ubiquitin
FT                   concentration also promotes efficient NHEJ in
FT                   postdiauxic/stationary phase"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC83"
FT                   /protein_id="CAR21394.1"
FT                   /translation="MVKKVFKLSATLFGHEQDVKSVAVMSNDEVATCSRDGSVRLWKKG
FT                   SNDMWQDTILYKVDEFINSLCYDKLSRLLYCGGKDTLINSISPLLGELGQEPEFVLVGH
FT                   KSNVCALNSSQGYILSGSWDATAKVWFQGALKHELVGHKASVWDVKMLPEVGFYLTASA
FT                   DGTVKLWEGEKVLKTFSNLHTDVVRHLDISPDGDQFASCSNDGTIKINDMDGNTLRTLK
FT                   GHESFVYCVKYTPCGGLVSCGEDRSVRVWGPDGAVKQVIRVPAVSVWDLDVLPNGDILV
FT                   GCSDSLARIFTCHEGRVAPQQELDTFAKEVERTAISSQTMGFDESKLSPSEALLNPGKE
FT                   GQVIVVKSPNGVNEAHQYTQGAWTKVGDVVSSAGNDKKKEFEGKMYDYVFDVDVTEGAP
FT                   PLKLPFNANGNAYQAADDFLARYELPASYREEVVRFLITNTTGVSLEQDQSSTSNGQSN
FT                   SIPQSKPMSVLPVREYLDIRSFSPDAIFNGVVKLNAQERSFDDEDLAAIGAALHDVEDN
FT                   YELLFAQASIIRSSWSNKIPAYDIMRLIVEYLPHADAMSEFIEEGLGSAMPQLEMLTVR
FT                   TLANCFKNKKWGTELMSKNAVYDSVFQTIEPNRPQASKTVNLAVSIATLIFNYSVMIIK
FT                   SGNLDLLPTVADALNNKFGPSQMIQDSEEAAYRMLVAYGNLATVEPTLLQFAKSIAWIK
FT                   PVKEKYGHLSRFSHVFADLL"
     atggtcaaga aggtattcaa acttagtgct actctctttg gccatgagca agatgtcaag        60
     tcagttgcag taatgagtaa cgatgaggtc gctacctgct cgagagacgg gtctgtgaga       120
     ctttggaaga aggggagcaa cgacatgtgg caagacacaa ttctttacaa ggttgacgaa       180
     ttcattaaca gtctatgtta cgacaaactt tcaaggctat tgtattgtgg tggcaaggat       240
     actcttatca acagcatatc tcctttgctt ggagaactag ggcaggagcc agaatttgta       300
     ctagttgggc acaagagtaa tgtgtgtgca ttgaacagct ctcaagggta tatcttgagt       360
     ggcagctggg atgccaccgc taaggtttgg ttccagggtg ccctgaagca tgaactggtt       420
     ggacataagg catccgtttg ggatgttaag atgcttcccg aggtagggtt ctatctaaca       480
     gcttcagcgg acgggaccgt taagctttgg gagggcgaga aagtgctcaa aacattctcg       540
     aaccttcaca cagatgtggt caggcatttg gatatcagcc cagatgggga tcagtttgcc       600
     agttgttcaa atgatggtac tatcaaaata aacgacatgg acggaaacac cctgagaacg       660
     ctcaaaggcc atgaaagttt tgtatattgt gtgaagtaca ctccctgtgg tggtcttgtt       720
     agctgtggcg aggacagatc tgtaagggtt tgggggcctg acggcgctgt caaacaagtg       780
     ataagagtcc ccgcggtttc tgtttgggat cttgatgtcc tgccgaatgg ggacatatta       840
     gttgggtgca gtgattcgtt ggctagaatc tttacctgtc atgagggtag ggttgcgccg       900
     cagcaagaac tagacacatt cgcgaaagaa gtcgagcgta ctgcaatcag ctctcagaca       960
     atgggctttg acgaatcaaa actttctcca agcgaagctc tcttgaaccc tggcaaagag      1020
     ggtcaggtga tagtggttaa gagtcctaac ggggtaaatg aggcgcacca gtacactcag      1080
     ggcgcatgga caaaagttgg cgatgttgtc agttcagctg gtaacgacaa gaagaaagag      1140
     ttcgaaggca aaatgtatga ctacgttttc gatgtggatg tcacagaggg agcgccaccc      1200
     cttaaactcc cctttaatgc aaacggcaat gcataccaag ctgctgatga ctttcttgca      1260
     agatatgagc ttcccgccag ttaccgtgaa gaagttgtgc gttttttgat taccaatact      1320
     acaggagtga gccttgaaca agatcagagt tctacatcaa acggtcagtc taattcaata      1380
     ccacaaagca agcccatgtc agttttgcct gtaagagaat atttggatat tcggtctttt      1440
     tctcctgacg caattttcaa cggcgttgta aagttgaatg ctcaagaaag atcatttgac      1500
     gatgaagact tggccgctat tggagcagcg ttgcatgatg tcgaagacaa ctatgaactt      1560
     ctgtttgccc aggcctccat aatccgttct tcgtggtcca acaaaattcc tgcatatgac      1620
     atcatgagac ttattgtgga gtacttgcct catgcagatg caatgagcga gttcatagag      1680
     gaaggtttgg ggtccgcaat gccacaactg gaaatgttaa cggtgcggac tctggctaac      1740
     tgtttcaaaa acaagaagtg gggtaccgag ttgatgtcta aaaacgctgt ctatgattct      1800
     gtgttccaga ccatagaacc caatcgtccg caagcttcta aaacagttaa cctcgccgtt      1860
     tccattgcca ctctgatatt taactatagt gttatgatca tcaaaagtgg aaatcttgat      1920
     ttgctaccca ctgttgcgga tgcgctgaat aacaaatttg ggccttcgca gatgatccaa      1980
     gactctgaag aagcagctta cagaatgctt gtcgcttacg ggaacctagc tacggtcgag      2040
     ccaacgctgc tacaatttgc gaagtcgatc gcgtggatta agcctgttaa agagaagtac      2100
     ggccaccttt ctaggtttag tcatgttttc gcagacctct tatag                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page