(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_2.PE31

LACTH_2.PE31         Location/Qualifiers
FT   CDS_pept        complement(83522..84985)
FT                   /locus_tag="KLTH0B00968g"
FT                   /gene_family="HOG000280459" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF15884"
FT                   /product="KLTH0B00968p"
FT                   /note="highly similar to uniprot|P00937 Saccharomyces
FT                   cerevisiae YKL211C TRP3 anthranilate synthase Component II
FT                   and indole-3-phosphate (multifunctional enzyme)"
FT                   /db_xref="GOA:C5DC85"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC85"
FT                   /protein_id="CAR21396.1"
FT                   /translation="MVFSAKRRVVLIDNYDSFTWNLYEYLCQEGAEVLVYRNDQITLEE
FT                   IDDLKPDCVFISPGPGHPRTDSGISRDCVRHFAGKIPVVGVCMGLQCMFDVFGGTVSYA
FT                   GEIVHGKTSQVTHDNKGIFKDIPQGVAVSRYHSLAGEPLSLPEVLEVTARTENGIIMGV
FT                   RHKNLTVEGVQFHPESILTEAGHVMVRNILNIQGGTWEEHEKLSKEKRVKGSSILDKIY
FT                   AQRQKDVDELSATPGFTLRDLQSNFNQGLAPEVQDFYTKLSSGPKSAVIAEIKRASPSK
FT                   GDIDMNAIAAEQGLKYAKAGASAISVLTEPHWFKGSIQDLVNVRRALDIEFKNAPQDRP
FT                   CVLRKEFIFSKYQILEARLAGADSVLLIVKMLSQDLLLELYNYSKFEVGIEPLVEVSSK
FT                   EEMGRALELNAKVVGVNNRDLHSFNVDLNTTSSLASSVPEGTILLALSGITSGADAEKY
FT                   KKEGVKGLLVGEALMRAANVDSLIKDLSA"
     atggtgtttt cagcaaaaag aagagtagtc ctaattgaca actatgactc gttcacctgg        60
     aacctttatg agtacctatg ccaggaagga gcagaggtgc tagtctaccg taacgaccaa       120
     atcacgctag aggagattga tgatctaaag cccgactgtg tcttcatctc gccaggccca       180
     ggccacccca gaactgactc tggtatatcc agagactgcg ttcgtcactt cgcaggaaag       240
     attcctgttg tcggtgtctg catgggtttg cagtgtatgt ttgacgtctt tggtggaaca       300
     gtatcctacg ctggcgagat cgtgcacgga aagacatcgc aggtgactca tgacaacaaa       360
     ggcatcttca aggacatccc ccaaggcgtg gcagttagca gatatcactc attggcaggc       420
     gagcctcttt cacttcctga agtcttggag gtcacggcta gaacagaaaa tggcatcatt       480
     atgggagtca gacataaaaa ccttaccgtt gaaggtgttc agttccaccc ggagtcgatc       540
     cttacggaag ccggccatgt tatggtcagg aacattctaa acatccaggg tggtacctgg       600
     gaggagcacg agaagctgag caaggaaaag cgcgtgaaag ggtcatctat tctcgacaag       660
     atttacgcac agagacagaa ggatgttgac gagctttctg ccacgccagg tttcacgctg       720
     agggatttgc aaagcaactt taaccaaggt cttgccccag aggttcaaga cttttacaca       780
     aagctttcct cgggccccaa atccgctgtt attgctgaaa taaaaagggc ttctccatcg       840
     aaaggagaca ttgatatgaa cgctatcgct gcagagcaag gcctgaaata cgctaaagct       900
     ggtgcttcgg ctatttctgt tttaacagaa cctcattggt tcaaaggcag catacaagac       960
     ctcgtgaacg taagaagagc cctggatatc gaatttaaga acgcgcccca ggaccgtccc      1020
     tgtgtactga gaaaggagtt cattttcagc aaataccaga ttttggaggc tcgcttagct      1080
     ggtgcagaca gcgtcttgct aatagtcaag atgctttcgc aggaccttct gctcgagctc      1140
     tacaactact cgaagtttga ggtcggcatc gagcctttgg tggaagtgag ttccaaagaa      1200
     gaaatgggca gagccctaga actgaatgcc aaggttgttg gcgtgaataa cagagacttg      1260
     cattccttca atgttgatct caacacaacg agctcgctag cttcctctgt tccagaggga      1320
     actatcctgc tcgcgctgtc tggtattaca agtggagctg atgctgagaa gtacaagaag      1380
     gagggcgtga agggtctttt ggttggtgaa gccttgatga gagctgctaa cgttgactcc      1440
     ttaataaaag acctaagtgc ctaa                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page