(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_3

ID   LACTH_3; SV 1; linear; genomic DNA; STD; FUN; 999246 BP.
XX
AC   CU928167;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome C complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-999246
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-999246
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..999246
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="C"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0C"
FT                   /db_xref="taxon:381046"
FT   gene            <3..>904
FT                   /pseudo
FT                   /locus_tag="KLTH0C00110g"
FT                   /old_locus_tag="pseudo-Klth0C-3-904"
FT   gene            <1448..>3175
FT                   /pseudo
FT                   /locus_tag="KLTH0C00132g"
FT                   /old_locus_tag="pseudo-Klth0C-1448-3175"
FT   LTR             4613..5029
FT                   /locus_tag="KLTH0C00154t"
FT                   /old_locus_tag="Klth0C.LTR.1"
FT   gene            <6403..>7366
FT                   /pseudo
FT                   /locus_tag="KLTH0C00176g"
FT                   /old_locus_tag="pseudo-Klth0C-6403-7366"
FT   mobile_element  8607..9116
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLTH0C00198s"
FT                   /old_locus_tag="dnatranposon.11"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            complement(<9795..>10538)
FT                   /locus_tag="KLTH0C00220g"
FT                   /old_locus_tag="KLTH-ORF14425"
FT   CDS_pept        complement(9795..10538)
FT                   /locus_tag="KLTH0C00220g"
FT                   /gene_family="HOG000078538" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14425"
FT                   /product="KLTH0C00220p"
FT                   /note="similar to uniprot|P40586 Saccharomyces cerevisiae
FT                   YIR042C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE0"
FT                   /protein_id="CAR21801.1"
FT                   /translation="MVAQNLYGQEIGDPLPNWAGREGPHRTVFEGNYCRLEPLNVQNHG
FT                   LQLFQAFSNAKDDRMWTYLPVGPFKDYPEYKKIATKFEQDQETVHYAVISKEGNRALGS
FT                   LSLMRADVSNGTIEIGFVMFSPKLQKTTASTEAQFLLMKHVFDGLGYRRCEWKCDSLNA
FT                   PSRNCALRLGFTFEGTFRNAAVYKGRSRDTQWFSIIDTEWQDIRKSFELWLKAGNFLEG
FT                   KQNKKLAAIRNEVKESKDVKKDHVQ"
FT   gene            <12563..>12979
FT                   /locus_tag="KLTH0C00264g"
FT                   /old_locus_tag="KLTH-ORF14421"
FT   CDS_pept        12563..12979
FT                   /locus_tag="KLTH0C00264g"
FT                   /gene_family="HOG000190841" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14421"
FT                   /product="KLTH0C00264p"
FT                   /note="some similarities with uniprot|P53053 Saccharomyces
FT                   cerevisiae YGL263W COS12 Protein of unknown function member
FT                   of a family of conserved often subtelomerically- encoded
FT                   proteins"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE1"
FT                   /protein_id="CAR21802.1"
FT                   /translation="MMFFGLTLALITGLLINFAMKRVATDSMMELQFMKEIAAIKPGID
FT                   MKDCDVLAARMNTYLSSNSVLATPYYFYNGKSCYPFFRKNYLQPRLIVKYASYQNANIA
FT                   SGSQPFVHKAIKIHEERANEDWEGILNKSRRFEQ"
FT   gene            <14835..>16043
FT                   /locus_tag="KLTH0C00286g"
FT                   /old_locus_tag="KLTH-ORF14417"
FT   CDS_pept        14835..16043
FT                   /locus_tag="KLTH0C00286g"
FT                   /gene_family="HOG000022188" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14417"
FT                   /product="KLTH0C00286p"
FT                   /note="similar to uniprot|Q2TZW5 Aspergillus oryzae
FT                   AO090011000693 Protein involved in biosynthesis of
FT                   mitomycin antibiotics/polyketidefumonisin"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE2"
FT                   /protein_id="CAR21803.1"
FT                   /translation="MFKQQSNDKPDEAVSSRFFPEHSLSVDDLKVICSRKASLSTYPLA
FT                   SSIQENIPIYELTAFSDSDQNTVSMLKDEWYHILHSGPGVFVMKAMYHTKEYEKVLESA
FT                   SSSFEKILEREKGNSTDSKGDHFAAEGSNDRIWNSLSKHAFEDPNSFFEYYSNPWLAHV
FT                   CDAWLGPRYQITAQVNNVKPGSLPQECHRDYHLGIQGRSKCVRYPRGLQIASQYLTLQG
FT                   AVAHSNMALESGPTRFLPFSQTFEPGYIAYQLEQFRDFFLQNYVVLPLELGDGVFFNPA
FT                   LFHGAGANTTKAFLRSANLLQISSAFGKPMETIDSLPIVKLCWILLKERYTRDGLSSRV
FT                   SAFINAVFNGYPYPTNLDKRLPAQNSMMPESEQDIAIRGLQNSWSTEKVMETLRQMKID
FT                   SKA"
FT   gene            <20027..>21216
FT                   /pseudo
FT                   /locus_tag="KLTH0C00308g"
FT                   /old_locus_tag="pseudo-Klth0C-20027-21216"
FT   gene            <25162..>26811
FT                   /locus_tag="KLTH0C00330g"
FT                   /old_locus_tag="KLTH-ORF14404"
FT   CDS_pept        25162..26811
FT                   /locus_tag="KLTH0C00330g"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14404"
FT                   /product="KLTH0C00330p"
FT                   /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
FT                   YLL055W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE3"
FT                   /protein_id="CAR21804.1"
FT                   /translation="MTQSQSSSSLEEHPVTVTGKENPGFDSSDNEVGLVLPSSPEKESS
FT                   DTKDFKVITSRDADVTLRFLEENDHLVEPITPEEERKLSRKVMWIVVSLTALINLILYA
FT                   DKAVMSYAAIFTFFEDTGLTQNKYNNANTLFYFGYIVGQGNLFFLQKFPLSRVMFVMTA
FT                   LWSIIIFLHCTAYNYQGVYALRFFLGFVESIGVPSLNTTMGQFLTPQEKSATAPVFYAA
FT                   CMGVTIPVGFIAYGVLNITNSSIPTWKIFSIIIGCCTFLSSVLIFLVYPSNPTDAKFLS
FT                   KKEKIWVIRRVQQTTGSSIEQKTFKPYQAKEALKDPISWIFGAFFLLQQLANNLTYQQN
FT                   LLFEDLGNITALDSTLVSVASGGFAVVMAIIASTFLMYKKNFIAFSVVVWSLPSFVGSI
FT                   GAATLPWHNSIGLLAFVCLACPVFGIPWILMFSWNAQTCSGYTKKMTRNAIVMFWFGIS
FT                   NIISPQLWQERDAPRYIPAWIVQIVLSFFLAPSLALVIWFILRRRNKERLAKLDSAGKQ
FT                   IGVIEENGERTEVNVALLDLTDLENEAFIYPL"
FT   gene            complement(<28541..>30217)
FT                   /locus_tag="KLTH0C00352g"
FT                   /old_locus_tag="KLTH-ORF14401"
FT   CDS_pept        complement(28541..30217)
FT                   /locus_tag="KLTH0C00352g"
FT                   /gene_family="HOG000178876" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14401"
FT                   /product="KLTH0C00352p"
FT                   /note="similar to uniprot|P40445 Saccharomyces cerevisiae
FT                   YIL166C Hypothetical ORF, memberof the Dal5p subfamily of
FT                   the major facilitator family"
FT                   /db_xref="GOA:C5DDE4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE4"
FT                   /protein_id="CAR21805.1"
FT                   /translation="MGFREPPAPKDQTRTVPENESNILNETNHKESFLVDVENVSTSSS
FT                   SADNIFADPNVANYYSSIYEKCQYECRHLFDPEFTWSQKEERKVRWKNDWYVTFWTFFM
FT                   FTALDFDRSNISQALADDMLENLNLTTNDYNTANTINLICFLASELPSQLISKKIGADV
FT                   WIPMQICLWSFVSISQAAIKSKTGFYVTRALLGAMQGGFICDVCLWMSYFFTSKELPFR
FT                   LSLFYIANPMTTVWSSLLSFGLLKIKTGGLMNQSWRWLFLIEGIFTLIVGVASFFKMPP
FT                   SPAQTKAWYRKKGWYTDREEKIVVNKVLRDDPTKGDMHNRQPVRPKELLKTLLDYDLLP
FT                   IYIVRFLGDIGSTPAKSYMTLTLRKLGFSTYKTNALSIPYNIIAVITMLLAGYFSEVVN
FT                   QRALIIMGTPIWVLVFLFPLRYWPGSQVDVWGTYAILTILLGQAPIWPLTISWCSANSN
FT                   SVRTRAVSAAVVNIFSQASNIVSANIYRDDDKPLYHRGNEALIGTAFAAIASCLFAKFY
FT                   YIWRNKQKDNKWSTLSEEEKSYYLANTTDQGNKRLDFRFVH"
FT   gene            complement(<32017..>33147)
FT                   /locus_tag="KLTH0C00374g"
FT                   /old_locus_tag="KLTH-ORF14397"
FT   CDS_pept        complement(32017..33147)
FT                   /locus_tag="KLTH0C00374g"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14397"
FT                   /product="KLTH0C00374p"
FT                   /note="similar to uniprot|P32804 Saccharomyces cerevisiae
FT                   YGL255W ZRT1 High-affinity zinc transporter of the plasma
FT                   membrane responsible for the majority of zinc uptake
FT                   transcription is induced under low-zinc conditions by the
FT                   Zap1p transcription factor"
FT                   /db_xref="GOA:C5DDE5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE5"
FT                   /protein_id="CAR21806.1"
FT                   /translation="MSGSEPWWQQYDPDTVTISDDSVPDSWKICTIDGVYFGGNSYSGS
FT                   LGARISSIFVILFMSTFFTLFPVIAARSKRLKVPKYVYLFARYFGTGVIVATAFIHLLD
FT                   PAYGEIGPQSCVGMSGNWSKYSFCPAIILFTVFSIFIVDLASDVYVKRRFGITHGHGDE
FT                   IENAIVKRQEATNNNVDIESHNLGHSADSDDKSKKSYDVVSNASTEIVTQSFESQIGAF
FT                   LILEFGVIFHSVMIGLNLGTTDDEFSTLYPVLVFHQSFEGLGIGARLSAIEFPKNKWWW
FT                   PYALCVAYGLTTPICVAIGLGVRTTYDGNSYTVNVVSGVLDAISAGILMYTGLVELLAR
FT                   DFIFDENRTNDISKLLFMVNCTLWGAGLMALLGKWA"
FT   gene            complement(<33868..>35277)
FT                   /locus_tag="KLTH0C00396g"
FT                   /old_locus_tag="KLTH-ORF14393"
FT   CDS_pept        complement(33868..35277)
FT                   /locus_tag="KLTH0C00396g"
FT                   /gene_family="HOG000189191" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14393"
FT                   /product="KLTH0C00396p"
FT                   /note="similar to uniprot|P00635 Saccharomyces cerevisiae
FT                   YBR093C PHO5 One of three repressible acid phosphatases a
FT                   glycoprotein that is transported to the cell surface by the
FT                   secretory pathway induced by phosphate starvation and
FT                   coordinately regulated by PHO4 and PHO2"
FT                   /db_xref="GOA:C5DDE6"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE6"
FT                   /protein_id="CAR21807.1"
FT                   /translation="MISQALVLLAASLTEAAPVLKQGKASTADVSKIGTQEKLFPYLAG
FT                   SGPHYDYPLSYGIPKEIPEQCTLQQVQLFARHGERYPTQNKGKAIASTYKKLHDFNGTF
FT                   TGALEFLNEDYEFFVQDTANYEELTTWDNILDPINPYVGELDAQKHARQFLFQYGELLE
FT                   NHTSFPIFTSNSKRVHDTANFFAKALGDRYNVSLQIIDEDPSMGANTLTPIESCTVYNE
FT                   SEQADVMNEYSDAYLVNLAGRLNTENSGLNLTKSDALNLFSWCAFEVNVKGYSNICDVF
FT                   TADELVSFAYYDDMTSYYEDGPGNSLGSTVGGVNFNASVELLKQHEELDNKVWLSFTHD
FT                   TNIVNYLSAIGLFDDGNKLPTDHVPIQNHVYHKSWMVPQGARVYTQLYQCGNSSYVRYV
FT                   VNDVTIPIETCQSGPGFSCELNDFVDYASTRLEGQNYIENCKISSSSNQTSLTFYWDYT
FT                   QKTYNASLIHS"
FT   gene            <38245..>39039
FT                   /locus_tag="KLTH0C00418g"
FT                   /old_locus_tag="KLTH-ORF14388"
FT   CDS_pept        38245..39039
FT                   /locus_tag="KLTH0C00418g"
FT                   /gene_family="HOG000141879" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14388"
FT                   /product="KLTH0C00418p"
FT                   /note="similar to uniprot|Q12512 Saccharomyces cerevisiae
FT                   YOL154W ZPS1 Putative GPI-anchored protein transcription is
FT                   induced under low-zinc conditions as mediated by the Zap1p
FT                   transcription factor and at alkaline pH"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE7"
FT                   /protein_id="CAR21808.1"
FT                   /translation="MSKEIGTFRRNGLVLLTSIVCIGTLIAGFVLAIIAERDAVNIKNT
FT                   RKTFTTVATGEWANAQFPRLHKSCNATDVDFLTRTMNETMEVASYAKEQLLVKGANDTI
FT                   YKRWFGDGELYDVLGVVDGIANMTKTDVLLRCDDVDGLCAANPNYYAGHHREKADAETV
FT                   ICDYFYESRAWLSDICANGTLKDFPPPRYAGIDMIHRYFHVSFINLDEYIGEYTEEVED
FT                   VLDLAKSNSTFAVRNVDNYLYYLADVYSSDKISGGCLGLDGV"
FT   gene            complement(<39458..>47005)
FT                   /locus_tag="KLTH0C00440g"
FT                   /old_locus_tag="KLTH-ORF14387"
FT   CDS_pept        complement(39458..47005)
FT                   /locus_tag="KLTH0C00440g"
FT                   /gene_family="HOG000190844" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14387"
FT                   /product="KLTH0C00440p"
FT                   /note="some similarities with uniprot|P32768 Saccharomyces
FT                   cerevisiae YAR050W FLO1 Lectin-like protein involved in
FT                   flocculation"
FT                   /db_xref="GOA:C5DDE8"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE8"
FT                   /protein_id="CAR21809.1"
FT                   /translation="MVRHLIRIDTTTSYANMSWQTLCLTVSALLLNAVCAKDLGNVFTS
FT                   LSFVGYSDYNYAVDKVWRADLDFAITPEMNVQMGDTFQLVAPNVLKFYPSRTIGSSGYV
FT                   EIKDASGSIIANCLIQNGFHASAQSTLDCSISKTDIYKASGSLSIDFVVNFGGSADSTA
FT                   LKAASSVSKGKNTLTWNGLSATANFNLPGSFTSVSSSNFKSYDTLFPNRDNLQESFYLG
FT                   NTCSSTFSDTIKISYSGTPSNNGQLASCSDIQVHIAKSFNDFNMPVEARALSSNSYTLS
FT                   CSGSSITVTASNIPAGYHIFINANQLMDRSISNVQYVNRYTESMVCNGKTSTNQYPRSI
FT                   TFVGGSAEGWGSQETLQWYTTTTGWTGSYTTTVTSTTPVIGTDGALTPEPIIVIETPTK
FT                   ALTSTTYTPWGGSETVTYSTATTTFTGPDGIPTTETIYYVETPTVGIESTTYTPWTGSE
FT                   TVTYNTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGS
FT                   DGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVET
FT                   PTVGIESTTYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWT
FT                   GSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGTETSTFSTETTTF
FT                   TGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYY
FT                   VETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYT
FT                   PWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTET
FT                   TTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTET
FT                   IYYVETPTVGTESTIYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPSVGTEST
FT                   IYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFS
FT                   TETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPT
FT                   TETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGT
FT                   ESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGTETS
FT                   TFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDG
FT                   VPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGIPTTETIYYVETPT
FT                   VGTESTIYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPSVGTESTIYTPWTGT
FT                   ETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGSETVTFSTETTTFTG
FT                   SDGVPTTETIYYVETPTVGTESTIYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVE
FT                   TPSVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPW
FT                   TGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGTETSTFSTETTT
FT                   FTGSDGVPTTETIYYVETPTVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIY
FT                   YVETPTVGTESTTYTPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTY
FT                   TPWTGSETVTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTIYTPWTGSETVTFSTE
FT                   TTTFTGSDGVPTTETIYYVETPTVGIESTTYTPWTGTETSTFSTETTTFTGSDGVPTTE
FT                   TIYYVETTTVGTESTIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTES
FT                   TIYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGIESTTYTSWTGRFTSTY
FT                   STDVLTFTGSNGVHTTETLYYVETPNLPFFPNTSVIFSTSTASVPTQISTSSTVSISTP
FT                   TVASTSGTSVLSSTSSFEGSSSSEMTSMPTVSSSATSVPESSSSYPSSNSLLSSTHSYS
FT                   QESSVTTLASTTFGESSSSSSAITASFETKPLTSPEPSTSSSSSSSVFSLATETITHES
FT                   STTVLTYGSTTTLMPSSSSVLSSASSGTNSDVTSTSTERSSFSPSSSFVEIRPSSTLSA
FT                   STETSPFGTTTSTADRSSHTTTSASTATSLTDSQTFSAPGPSSPVISVTTETVTESGST
FT                   TVVVSTSTSESDTSSPSSSSSASIQSTSTILTSTEPTTSAPSSSASTVTSDRTETTFAE
FT                   STPASSSGITSTTGVTETASEERSVTPSSATASASLGWMSSERPVGSTTTEPAQLSSSM
FT                   VTPVESAASSGTSSGQASVTTSDIVTPLESNTLSGTSSTVTPAITTGTPSSTASVTSEQ
FT                   RSSLTTSSSAIISLSTASVSQSSTLQSVSTYEGAANKLGLGLLFALPLALI"
FT   gene            complement(<49362..>51074)
FT                   /locus_tag="KLTH0C00462g"
FT                   /old_locus_tag="KLTH-ORF14372"
FT   CDS_pept        complement(49362..51074)
FT                   /locus_tag="KLTH0C00462g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14372"
FT                   /product="KLTH0C00462p"
FT                   /note="highly similar to uniprot|P23585 Saccharomyces
FT                   cerevisiae YMR011W HXT2 High-affinity glucose transporter
FT                   of the major facilitator superfamily expression is induced
FT                   by low levels of glucose and repressed by high levels of
FT                   glucose"
FT                   /db_xref="GOA:C5DDE9"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDE9"
FT                   /protein_id="CAR21810.1"
FT                   /translation="MSSSATPMNNRSNNNTDLAIAGTSTNLDSQSATPSNKMSDDAFDI
FT                   KGSPAAEAHEIPQKPLSEYILVMCLCLMVAFGGFVFGWDTGTISGFVNMTDFKRRFGDY
FT                   NTTTEEYYLSNVRTGLIVAIFNIGCAVGGLTLGRLGDMQGRRLGLMAVILVYVVGIVIQ
FT                   ISASGKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLG
FT                   YCTNYGTKTYTNSVQWRLPLGLCFLWAIFMIGGMVFVPESPRYLIEKGRFEEAKRSIAK
FT                   SNKLDTEDSGVLAEVDLINAGVEAEKLAGNARWGELFSPRGKILQRVIMGCVIQSLQQL
FT                   TGNNYFFYYGTTIFQAVGLDDSFQTSIILGVVNFMSTFVGLYTVEKFGRRKCLLWGSAA
FT                   MSVCFVVFASVGVTKLYPNGKDMPTSKSAGNAMIFFTCLFIFFFATTWAPIAYVIVSET
FT                   YPLRVKNRAMAMSVGSNWIWGFLIGFFTPFITSAIGFYYGYVFMGCLVFSFFYVFFFVC
FT                   ETKGLTLEEVNEMYEEGVLPWKSESWVPALRRDESYDVNETHEDGKPFYKRFV"
FT   gene            complement(<52014..>53858)
FT                   /locus_tag="KLTH0C00484g"
FT                   /old_locus_tag="KLTH-ORF14369"
FT   CDS_pept        complement(52014..53858)
FT                   /locus_tag="KLTH0C00484g"
FT                   /gene_family="HOG000007619" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14369"
FT                   /product="KLTH0C00484p"
FT                   /note="similar to uniprot|P36102 Saccharomyces cerevisiae
FT                   YKL025C PAN3 Essential subunit of the Pan2p- Pan3p poly(A)-
FT                   ribonuclease complex which acts to control poly(A) tail
FT                   length and regulate the stoichiometry and activity of
FT                   postreplication repair complexes"
FT                   /db_xref="GOA:C5DDF0"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF0"
FT                   /protein_id="CAR21811.1"
FT                   /translation="MDKANAEWAKDIPCKNITIYGFCKYENDGCIFNHGSTKANATSPG
FT                   PKFNAKTASSFTPSKVLNSKNSTSAAIKAEKVAKALTTAVEQPTTSSPLAMKSAPFTAS
FT                   YNPYAANFTPVGSAGTSTPPPASSSHPGFNPYSAPAGINNTGDAPMQSSASFIPGSPAP
FT                   FAQEAPGRHTNFPSIYPPSHSILQYHLYAPDPPLHLKVPLKANERTPEMLFIPNDIREE
FT                   LLKKNQAALQVFPSGGNLPEIVGDYFGLVPLEFHNRASNKERYQGHQNSLYKVFSNFDG
FT                   KIYIMRRIHDVKIKESVQIFKPFQDWKKLVNSNVVGVRDAFVTRAFSDSSLCLVHDYYP
FT                   QSSSLYETHFVSFNPTPITQDLLWSYLVQLCSAIQAAHSFNLAFQNICLDKVIVTGNPG
FT                   RIKIGDSCLHDILYFQEDTDATKEQQKDFVDLGTLLRDLAAKSTGSQDTDIESLVVDND
FT                   FKQVLNYLLEPKSLKTLPELMALFSHKILPVLSSLQTYAEYTESILARELENARLFRLM
FT                   CKLNFIFGRMESRIDINWSESGEKFPIILFYDYVFHQSDESGKPVMDLTHVLRCLNKLD
FT                   AGIGEKLMLVTPDEMNCFITSYKELKDLIDSTFRALSQ"
FT   gene            <53979..>54803
FT                   /locus_tag="KLTH0C00506g"
FT                   /old_locus_tag="KLTH-ORF14366"
FT   CDS_pept        53979..54803
FT                   /locus_tag="KLTH0C00506g"
FT                   /old_locus_tag="KLTH-ORF14366"
FT                   /product="KLTH0C00506p"
FT                   /note="similar to uniprot|P40579 Saccharomyces cerevisiae
FT                   YIR035C or to uniprot|P40580 Saccharomyces cerevisiae
FT                   YIR036C Hypothetical ORFs"
FT                   /db_xref="GOA:C5DDF1"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF1"
FT                   /protein_id="CAR21812.1"
FT                   /translation="MSKVVLVTGASKGIGRAIVDVLCSSGEDIKVLGIARSVDDLEALK
FT                   TKHQGKFDYLCADITDTAAIVGYVKKINKNYGSLDAVIANAGVLAPVQSVARADVMQWK
FT                   QLFDVNFFSIVSLVSELLPSLKKSSQGDVILVSSGASVKPYVCDKHHNRFAKEITTNNQ
FT                   KQYAWGAYGASKAALNQFAQILALEEPQIKTVALAPGVVNTQMQDAIRDELGPPNMTPE
FT                   ALKRFTDLREKNELLEPEIPATIYANLALHGIPATINGKYLRYNDELLKEYR"
FT   gene            <55308..>56156
FT                   /locus_tag="KLTH0C00528g"
FT                   /old_locus_tag="KLTH-ORF14364"
FT   CDS_pept        55308..56156
FT                   /locus_tag="KLTH0C00528g"
FT                   /gene_family="HOG000238771" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14364"
FT                   /product="KLTH0C00528p"
FT                   /note="highly similar to uniprot|P15700 Saccharomyces
FT                   cerevisiae YKL024C URA6"
FT                   /db_xref="GOA:C5DDF2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006266"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF2"
FT                   /protein_id="CAR21813.1"
FT                   /translation="MLRTAFRARIGPQTALRTVKTSQLLLPRAARFYSSNGGSQQPKSR
FT                   GKLLVLMGALALGSTLFSINYQKNPPVAFVEEENDKKTQRPAFSEKEVSVIFVLGGPGA
FT                   GKGTQCANLVRDFQFVHLSAGDLLRAEQNRSNSKYGELIKHYIKEGLIVPQEVTVALLK
FT                   QAIQESYEKGQKRFLVDGFPRKMDQAVTFEEEIVPSKFTLFFDCPESVMLKRLLERGKT
FT                   SGRSDDNVESIKKRFKTFIDTSMPVVKHFEEQGKVVTVSCDHDMNEVYNQVKAAVKDKI
FT                   L"
FT   gene            <56455..>57318
FT                   /locus_tag="KLTH0C00550g"
FT                   /old_locus_tag="KLTH-ORF14363"
FT   CDS_pept        56455..57318
FT                   /locus_tag="KLTH0C00550g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14363"
FT                   /product="KLTH0C00550p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF3"
FT                   /protein_id="CAR21814.1"
FT                   /translation="MDDGCLIDFLLEDDFATMNADSSCLDSKWLVEKDCICDDRVIKRP
FT                   NRKTKSRTKSKRRSLCKELLDESIDELVNLIIKDTKLSLTIGSEPNQRTKVPQTVSSSK
FT                   KKSRREGWTNKIGDDQGLLTVFGGEQLAGEFAFNLLDVPEPDVTTESNKKKKVKRNRTR
FT                   NGASKKAESHPIEPTDQSYAATKGHGHSSAPNSNAEKDAAVKKGKNKKKKRKGQADDEN
FT                   KLKGNAKDSTKSNSQPRAESRDRESQRKDKSPINSSSKSGPPVHGKRSSRKKTKSASSS
FT                   NNDQSC"
FT   gene            complement(<57378..>59540)
FT                   /locus_tag="KLTH0C00572g"
FT                   /old_locus_tag="KLTH-ORF14361"
FT   CDS_pept        complement(57378..59540)
FT                   /locus_tag="KLTH0C00572g"
FT                   /gene_family="HOG000160791" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14361"
FT                   /product="KLTH0C00572p"
FT                   /note="similar to uniprot|P09798 Saccharomyces cerevisiae
FT                   YKL022C CDC16 Subunit of the anaphase-promoting
FT                   complex/cyclosome (APC/C) which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition required for sporulation"
FT                   /db_xref="GOA:C5DDF4"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF4"
FT                   /protein_id="CAR21815.1"
FT                   /translation="MSRGNTPSQHNSTLAISPLVGSRSLQVPQQRNAANASSTRQWSGS
FT                   HRAAQTPHHSVTYSPLVQKIQNNASLATPAPVQDHGSTAGLLASMTKNGLFGPTMPSTL
FT                   RKVSILGDARRQSTSIDNAASDAAGAEDRVADDRLVQDIDIAQLPAAEKLRLWRHDSLM
FT                   QHQYRTAEYIGDKVYAMTGDPNDAFWLAQVYYNSGSYIRAVELLTRNNLDTSSVMCRYL
FT                   TALCLIQLKKYEDALDIVGETNPFRDPLGNHVKNQDGGIKLESSMCYLRGKIFSALNNF
FT                   DKAKESLKEALLVDVKNFEAFDELISKNLLTPTEQWTFISSLDFSDLDDNEELIKSLYI
FT                   TKLSKYLNLDQVHNAHEFLGEEYKLDNNTDLIQSNADTLFTQCKFSECLKLCEEALEKD
FT                   EFNFSILPIYISCLYELGGKNKLFLVSHKMAENFPKHPITWFGVGAYYMCTNKISEARK
FT                   YFSKASILDPSFSQAWIGFAHTYAVEGEHEQAVSAYSTASRYFPGTHLPNLFLGMQYLL
FT                   MGTLPLAEEYFALAYDICPYDPLLLNEMGVLYFKKNDYLKAKRYLKKAWEAIKALDSES
FT                   KSWISIHTNLAHTYRKLGDNERAVKCFRLVLETTGKDADTLCALGYVYLRMNRIEKAID
FT                   SLHSSLALRPSNQAAQDLLKQALDVNLSTVLDESHPLVISSKLQEQGTGTASKKRTANI
FT                   LDVHGVAKKLKHGQDSSDDEDSMDLE"
FT   gene            <61284..>62402
FT                   /locus_tag="KLTH0C00594g"
FT                   /old_locus_tag="KLTH-ORF14356"
FT   CDS_pept        61284..62402
FT                   /locus_tag="KLTH0C00594g"
FT                   /gene_family="HOG000143704" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14356"
FT                   /product="KLTH0C00594p"
FT                   /note="highly similar to uniprot|P38998 Saccharomyces
FT                   cerevisiae YIR034C LYS1 Saccharopine dehydrogenase (NAD L-
FT                   lysine-forming) catalyzes the conversion of saccharopine to
FT                   L-lysine which is the final step in the lysine biosynthesis
FT                   pathway"
FT                   /db_xref="GOA:C5DDF5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF5"
FT                   /protein_id="CAR21816.1"
FT                   /translation="MAPVILHLRAETKDQEARAALTPTTVEKLLSKGFKIYVEESDQST
FT                   FDIDEYRKVGAEIVPKGSWVNAPKDRLIIGLKELPEDNFPLVHEHIQFAHCYKNQAGWQ
FT                   DVLGRFKRGHGILYDLEFLENDQGRRVAAFGFYAGFAGAALGLKDWAFKQTHADSEDLP
FT                   GVTPSPNEQELVKDVTKDYQAALKKGAKKPTVLIIGALGRCGSGAIDMLRKAGIPEKNI
FT                   IKWDMKETARGGPFQEIAQADIFINCIYLSKPIAPFINSTLLNSNSRRLRSIVDVSADT
FT                   TNVHNPVPVYTVATVFSKPTVLVPTTKGPKLSVISIDHLPSLLPRESSEFFARDLLPSL
FT                   EQLPDRENAPVWARARALFYRHCARLERQSKF"
FT   gene            complement(<62501..>63724)
FT                   /locus_tag="KLTH0C00616g"
FT                   /old_locus_tag="KLTH-ORF14352"
FT   CDS_pept        complement(62501..63724)
FT                   /locus_tag="KLTH0C00616g"
FT                   /gene_family="HOG000001086" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14352"
FT                   /product="KLTH0C00616p"
FT                   /note="similar to uniprot|P20484 Saccharomyces cerevisiae
FT                   YKL021C MAK11 Protein essential for cell growth and
FT                   replication of M dsRNA virus contains four beta- transducin
FT                   repeats"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF6"
FT                   /protein_id="CAR21817.1"
FT                   /translation="MSQNQFRIVVGSYEHNLLCLSLNLSLPSPLFTPIFHFQAHSLSVK
FT                   CLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITSLKFSRGAAIPNQDGDDSE
FT                   KPVTHGNSKWLLSASEDHNLVVWRVKDWENFGTLKGHSARINDFDIHPSNRIAISVSED
FT                   HSIRLWNLMTVKKAGILKLKKYNQNGQFVRWCGDNGEFFAVALLNKVLIYKTSTAKVHR
FT                   EIDVGRSTIMHLEVEKINDKQYIVVALGNGSVSMYQGEQLFKDDADEAEEAEKTGDAEE
FT                   TPITPEYTLQGHATRVKDFKFYRNEFGHYLVTISSDGKIVVWDMSNREQVAVYDCGERL
FT                   NCLAICDESVERYEMMKKRVAEEADLGEQSEVEEDTEDLKSIMLGTNKKKSKKSRSKKN
FT                   KKVKVQLE"
FT   gene            complement(<63995..>67252)
FT                   /locus_tag="KLTH0C00638g"
FT                   /old_locus_tag="KLTH-ORF14351"
FT   CDS_pept        complement(63995..67252)
FT                   /locus_tag="KLTH0C00638g"
FT                   /gene_family="HOG000113576" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14351"
FT                   /product="KLTH0C00638p"
FT                   /note="similar to uniprot|P40578 Saccharomyces cerevisiae
FT                   YIR033W MGA2 or to uniprot|P35210 Saccharomyces cerevisiae
FT                   YKL020C SPT23, ER membrane proteins involved in regulation
FT                   of OLE1 transcription"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF7"
FT                   /protein_id="CAR21818.1"
FT                   /translation="MVQQDTHMMETELLEDFLFAESQQQQQQQQEQQEQQHQQPGSYGG
FT                   GDGEEQHGDDLFSTFINTDMLLQPSNYTLQPQHTSSMMLGVGAPDLLNGFSEPRQPRKS
FT                   ISPLGGTSDIQSPAPSISTGLTTPPQAMSYSQGCERLVDRSLQFGRTKPIQSAYLNSSD
FT                   FLDIPEDTLPYKLVVSGMPSASRVETQIKLELSISPPPREYIVHLPTDCITKQKWYLED
FT                   DITTYPREIQNEILYLESFLVCASNGKPTYVCSRCVKREQRRASRRKSGLCDNMLWCNN
FT                   ENRRAVVFNSKQVFSIKDVNCTPQFKSFDLSTRIVCYCRHHKEPEGFKILFVLRNANQE
FT                   VLAKSLTGPIMIMDKKSNRDAAANTSLQDSVADSNNNTDGSRSERSEIPNVTSTSDFSG
FT                   MENHKPRDDFMHLSVKGEHMLSPTSMGGDSSEAHATDANVVESYGPRGAASSVSLPDKA
FT                   SGYKRKRSSPDYNSTAIGFSPQNFTKPHANSNFSKSLSASSSNHSIPLLNQPAHNNPTA
FT                   AMMTATNSMLREISDLAEVPQAPRPYINRVIPSQGPVKGGIEVTLLGSNFKPGMIVKFG
FT                   QNRALSTQCWSESTLVTYLPPSSRAQEVLVTVFEKEEEQPEVLGTMSNSKAIFTYVDDT
FT                   DRQLIELALQIVGLKMNGKLEDARNIAKRIVGHEGNSSNSTPSPSANNAPQNSYNIGMG
FT                   QVLYSDESLLLKVIKLLNSSSNLSMCDEEGQTMLHLACLKGYYHLASALVRKGARVDAK
FT                   DSFGFLPLHFACLNGDARIIRLLVQCKATVHAETINGSSPRALFIANHDTDDERYEDYL
FT                   NEVLDALDTDSSSEEYSCNMLRKLSDSSFQSSVFDAESLASLNDNIQVHISKMAEDTLS
FT                   DDDEDLDGYEEDGDECLLQDDDDSIATADNSQSQDSALIATSQEAHRHSGQFENSIWNR
FT                   VLNAFNDDLPKYEDLFPVLDRERNKKSLLANRNPTELTATQSSTAEDSQTSSEDEEDAL
FT                   QARLNRFFQQRQNFRNDKMLLFFWLPVAIILLSSFLIFEFGHDGNRIHHLSQAVSEYLR
FT                   VGLANVMLGNERVKGAFKGSLHSLQAGAAVAGGIEGS"
FT   gene            <68274..>69221
FT                   /locus_tag="KLTH0C00660g"
FT                   /old_locus_tag="KLTH-ORF14347"
FT   CDS_pept        68274..69221
FT                   /locus_tag="KLTH0C00660g"
FT                   /gene_family="HOG000188957" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14347"
FT                   /product="KLTH0C00660p"
FT                   /note="similar to uniprot|P29703 Saccharomyces cerevisiae
FT                   YKL019W RAM2 CAAX farnesyltransferase alpha subunit"
FT                   /db_xref="GOA:C5DDF8"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF8"
FT                   /protein_id="CAR21819.1"
FT                   /translation="MSDAPEFQYDDIEPLPISGGQEGELCQIMYDGEYRTVMGIARALL
FT                   QKLEFSERALHATSQAIDLVPAFYTMWNYRFQIVKALYGTDGAELNRELDWLDEFTLNN
FT                   PKNYQIWSYRQALLRLHPSPEFQRELPILQSMIDDDTKNYHVWSYRRWCVLFFGDFTNE
FT                   LQFASSLIARDVYNNSAWCHRMFVLKNQVPKGPPAEALTGELHYTKKQIELAPQNISSW
FT                   NYLRGLYDEFLDGKADPAIMEFALSFTPGIFAADASDTGPQIQSSYALEFLARAYAKNE
FT                   DTFAQARKAYQALSDHFDPIRKNFWAYKIRSLTA"
FT   gene            <69344..>70501
FT                   /locus_tag="KLTH0C00682g"
FT                   /old_locus_tag="KLTH-ORF14344"
FT   CDS_pept        69344..70501
FT                   /locus_tag="KLTH0C00682g"
FT                   /gene_family="HOG000243638" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14344"
FT                   /product="KLTH0C00682p"
FT                   /note="similar to uniprot|Q02256 Saccharomyces cerevisiae
FT                   YIR026C YVH1 nitrogen starvation-induced protein
FT                   phosphatase"
FT                   /db_xref="GOA:C5DDF9"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016278"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDF9"
FT                   /protein_id="CAR21820.1"
FT                   /translation="MGHLIASTPHRPSKFPFSTHNLLREVAKYQYLMSTIDRILGNIYV
FT                   GSVQPIIDHVPLRTDYNISHILSVMKFEVLPEYLVRKSYTLKNVAIDDDETTDILQYID
FT                   ETNRFIDSCLFPHEPEYDPRKVDFRKKPQQGGVYVHCHAGVSRSVTFIVAYLMYRYRLN
FT                   LKSALYAVKRKHPGAQPNDNFMEQLKIYQDMGSYHVDIDNQAYKVWKLTNSVKEDGTGE
FT                   NILAQEDTFKHNDQKRLQEMTPEELSAVTVIRCKKCRQKLALSTSFIQHEPPSKESTEG
FT                   HFIRRAAGGRRIIGIQQSQDSCSHFFVEPLNWMKDELQGKQELEGKFSCPGCSSKVGGY
FT                   NWKGSRCSCGKWMVPAIHLQNAKVDQIAFAKKALPNMVGSELTKE"
FT   gene            complement(<70539..>71513)
FT                   /locus_tag="KLTH0C00704g"
FT                   /old_locus_tag="KLTH-ORF14343"
FT   CDS_pept        complement(70539..71513)
FT                   /locus_tag="KLTH0C00704g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14343"
FT                   /product="KLTH0C00704p"
FT                   /note="some similarities with uniprot|P40577 Saccharomyces
FT                   cerevisiae YIR025W MND2 Subunit of the anaphase-promoting
FT                   complex (APC) needed for meiotic nuclear division"
FT                   /db_xref="InterPro:IPR008402"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG0"
FT                   /protein_id="CAR21821.1"
FT                   /translation="MNFDLPDSLQLAIDTVSGRDHGCSLENLPVFRAREDHTASRNDPK
FT                   SLGSRGRRQTDRETKSKFYTMPPLAAYSAFSEHPFYHVHKATGSKFDPFEMRLELSEKQ
FT                   QESIRMLGWDSIRPVGIGFTMKERKDLAKLEAKEQERQQQQGSHGVRDLLSTDRPQENV
FT                   NTPQQTTLPHEAVIRSLTPPDMDINLDQDIHEDETSYDYDDEFARIEPDDDVAEPHNAR
FT                   DDNYERAERTVQQFIETSHIEGVSHPYDMENNYQHSYNYSDNEDSGSLALPPVTIPDIE
FT                   AYDVGINGPEIADINSGGASPPLPRQRRQRLRSPFDVDDLGCD"
FT   gene            complement(<71655..>71891)
FT                   /locus_tag="KLTH0C00726g"
FT                   /old_locus_tag="KLTH-ORF14341"
FT   CDS_pept        complement(71655..71891)
FT                   /locus_tag="KLTH0C00726g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14341"
FT                   /product="KLTH0C00726p"
FT                   /note="similar to uniprot|Q3E7A7 Saccharomyces cerevisiae
FT                   YKL018C-A"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG1"
FT                   /protein_id="CAR21822.1"
FT                   /translation="MLSYEKSDLKRYIRRYLDWGEGLYERLVRVAKRSAYFRKETPLDG
FT                   FLDGMFKRVEELGRGPVSEGLSREQATAAARRR"
FT   gene            <72171..>73157
FT                   /locus_tag="KLTH0C00748g"
FT                   /old_locus_tag="KLTH-ORF14340"
FT   CDS_pept        72171..73157
FT                   /locus_tag="KLTH0C00748g"
FT                   /gene_family="HOG000176477" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14340"
FT                   /product="KLTH0C00748p"
FT                   /note="highly similar to uniprot|P36104 Saccharomyces
FT                   cerevisiae YKL018W SWD2 Subunit of the COMPASS complex
FT                   which methylates histone H3 on lysine 4 and is required in
FT                   transcriptional silencing near telomeres"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG2"
FT                   /protein_id="CAR21823.1"
FT                   /translation="MSLDISRETLLGFKAVKTFKPGENEVAPVTSLSFDDHGRYLLAAS
FT                   ANDNMHLYDAMNCRFLNTIASKKYGCHSAKFTHAQNECVYSSTMKSFDIRHLNLETNQY
FT                   LRYFTGHGALVSDIQISPLNDTFLSASYDESVRLWDMRVSKAQAIVPSLVPNCIAYDPS
FT                   GLVFALGNPENCEIGLYNLRQLKNGPFLVIKVHPSFNQWSKIEFSNDGKYILLASSAGK
FT                   QVILDAFDGSQLFELAGTKSFPLREFMDAGSACFTPDGRFTLSTDYAGKIALFNHADSI
FT                   SGRTLKPCGSINAAPESCPRSIAFNPKYSMFVTADESVDLYVYDKPI"
FT   gene            complement(<73182..>75161)
FT                   /locus_tag="KLTH0C00770g"
FT                   /old_locus_tag="KLTH-ORF14337"
FT   CDS_pept        complement(73182..75161)
FT                   /locus_tag="KLTH0C00770g"
FT                   /gene_family="HOG000185831" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14337"
FT                   /product="KLTH0C00770p"
FT                   /note="similar to uniprot|P34243 Saccharomyces cerevisiae
FT                   YKL017C HCS1 Hexameric DNA polymerase alpha- associated DNA
FT                   helicase A involved in lagging strand DNA synthesis
FT                   contains single-stranded DNA stimulated ATPase and dATPase
FT                   activities replication protein A stimulates helicase and
FT                   ATPase activities"
FT                   /db_xref="GOA:C5DDG3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG3"
FT                   /protein_id="CAR21824.1"
FT                   /translation="MNKVIGERFLECIAHEQSQDTELTARLLETLPLSQLVSKGLAINH
FT                   LTLQNVRSGLAGRLYVELGPDTAIDQEIIRGDVRNGDLVVIRPSGAKKDAFSCEGVVTK
FT                   CSEKCITVAVDEAQEKDALNLYSSLRLYLLKTTNTITYKRMQSTLRKLCEFDGVPQNEV
FT                   IQYLLDAPVFTSQTQPLKVDFFNPDLNTSQKKAIEFSLQNRISIIHGPPGTGKTHTVVE
FT                   LVHQLYNKGQRVLVCGPSNIAVDTILERLAKVMPGESLLRIGHPARLLESNLSHSLEVL
FT                   SKSGDAGAITKDISKEIDDTIASIKKLKSYKQRKEQWKEVRELRKELKLREKKVISDLV
FT                   LSARVVVSTLHGSSARELVDCYKHTDHIFDTLIIDEVSQSLEPQCWIPLIAHYKSDIQK
FT                   LVLAGDDKQLPPTIKTEDNTKVKNTLGTTLFDRLVKKYGDSFRNLLDTQYRMNSEIMEF
FT                   SSIKMYDGKLKAADSVASWTLVDLPATECNENTEVPLIWYDTQAGDFPERAEDQDSGSL
FT                   VSSKYNENEAFLALHHVTSLIDSNVPQECIGIISPYNAQVAFLKKTVHPQYPLVEISTV
FT                   DGFQGREKEVIILSLVRSNDKFEVGFLSDQRRLNVAMTRPKKQLCVIGNMETLERSGIE
FT                   YLKDWVRWSEEHSEIRYPDLSEIL"
FT   gene            complement(<75339..>75863)
FT                   /locus_tag="KLTH0C00792g"
FT                   /old_locus_tag="KLTH-ORF14333"
FT   CDS_pept        complement(75339..75863)
FT                   /locus_tag="KLTH0C00792g"
FT                   /gene_family="HOG000201694" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14333"
FT                   /product="KLTH0C00792p"
FT                   /note="highly similar to uniprot|P30902 Saccharomyces
FT                   cerevisiae YKL016C ATP7 Subunit d of the stator stalk of
FT                   mitochondrial F1F0 ATP synthase which is a large
FT                   evolutionarily conserved enzyme complex required for ATP
FT                   synthesis"
FT                   /db_xref="GOA:C5DDG4"
FT                   /db_xref="InterPro:IPR008689"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG4"
FT                   /protein_id="CAR21825.1"
FT                   /translation="MSIAKSAANKLDWASVISSLKLTGKTATQLTSFKKRNDEARRKLL
FT                   ELQAQPTAVDFSYYRSVLKNSEVVDKIESFYKSYKPVTVDVKKQLSTIEAFESQALENA
FT                   KETEKFVAQELKDLSDTLKNIESARPFDQLTVEELAKARPDIDAKVEEMVKKGRWEVPG
FT                   YKEKFGDLTVM"
FT   gene            <76637..>79141
FT                   /locus_tag="KLTH0C00814g"
FT                   /old_locus_tag="KLTH-ORF14330"
FT   CDS_pept        76637..79141
FT                   /locus_tag="KLTH0C00814g"
FT                   /gene_family="HOG000248496" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14330"
FT                   /product="KLTH0C00814p"
FT                   /note="similar to uniprot|P25502 Saccharomyces cerevisiae
FT                   YKL015W PUT3 Positive regulator of PUT (proline
FT                   utilization) genes zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="GOA:C5DDG5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG5"
FT                   /protein_id="CAR21826.1"
FT                   /translation="MMQEVNSVAMEDAGLDQPTEYLPSASYEGVVSDSDEMSSRTSKRR
FT                   IKRSGLACVRCRRRHAKCSGEKPCSTCVAANIACEYMEPNKKLVVSMKYLQKLQSDLAE
FT                   MKRENIKLQASVKNIAPQDAAEAGPSNRPSDVKFHKNTVDQSTLGSSSAASASSRAATT
FT                   DDEEIVPNFTERRGRLVASRTGQQYFVGSSSMTLFGMEIQSLIPKRLASRKRDGRELTS
FT                   LEVDGTPRAPVQPIDEILQEEGNAYKIVLSKNDGTNDISVNFSLPSYSYAILLVDTFVT
FT                   YNDGCFYFFNEGIVKEQLKAVYEGGTALPDHTLQTIWFCKVLLIFATGEMYLGTANNMN
FT                   GSKLPSKAGAKLPGSGFFEQASKIFSCLFSSGRIENVTKPGGLEVMLLYAFYLQVADCT
FT                   VASYFYFGQALRACLIMGWHVDAQRDSITRFELEHRRRLWWTVYMFERMLSSKAGLPLS
FT                   FTDETITTELPDDFDMSSPPAGCEHYIFPEAEYITNCVKITQINAQILNKLYQRQPGSN
FT                   ILPVLKEIVLQLIEWRRTLSGFLQADFQRKDFKISRLSTNIFTEYFQGMNLAIRPLLFH
FT                   FASIQLKRSETSDTYINLQDYSPTISALLNCSLQASINTIRSLWYLKLQNMVALFGYMD
FT                   REYLFTAACTLVLFNAAFGIHDQTAEHLDHALLTFTKMRNLGNNPAGHRRAQLLRLMSS
FT                   LDFKGSMKELIQNHVDDLRPDAQFENHGDKEAEIVSYVSTESDVVRISPSASVSLEGDF
FT                   RADSPKEGEIVRENNASTFEPFSLDSKSDIQKFLAGLENVDTSENELWKEISHQAMWLG
FT                   NAMDPTGPVGDEDTTGGLNFFE"
FT   gene            complement(<79382..>84553)
FT                   /locus_tag="KLTH0C00836g"
FT                   /old_locus_tag="KLTH-ORF14327"
FT   CDS_pept        complement(79382..84553)
FT                   /locus_tag="KLTH0C00836g"
FT                   /gene_family="HOG000141826" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14327"
FT                   /product="KLTH0C00836p"
FT                   /note="similar to uniprot|P34241 Saccharomyces cerevisiae
FT                   YKL014C URB1 Nucleolar protein required for the normal
FT                   accumulation of 25S and 5.8S rRNAs associated with the
FT                   27SA2 pre-ribosomal particle proposed to be involved in the
FT                   biogenesis of the 60S ribosomal subunit"
FT                   /db_xref="InterPro:IPR021714"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG6"
FT                   /protein_id="CAR21827.1"
FT                   /translation="MSHFRGRFAQTGGAGKPQSQKHGGSSMMDDGVFDKLQSVISEIDL
FT                   LNEGVSNDYQPVISFFSSKFAAQIIQSWSYHAQVNNHQKFSSCTSRLAKALRVLGSDSS
FT                   TLIYGSNLVRSILQENTKVLYRGLNNMKPSITNPTLRLLRQIIAFNKGQHVDDFLTCFD
FT                   MSLPSLPRLLSPTKAELSDLEHTIKNPELSMRFNFIQFWLCLIENATPILRKAVLTENP
FT                   KIMSAWYKHMTKIDSVKLLIQTLNTLINFVLKERSLKRVTKCKILNESLISKIHYFYSS
FT                   TNADLVHHTDLFFESYSSVKGDGVTFSDDKIWFTEPVYSSAGAGSGSTGALVVINNKKF
FT                   YLYNKLLFTMLTFFKPWEDEIQLNRVKKVLENVPELVAPYSHYLGTLGNHDPRMTSYWF
FT                   GMTLLLGRMMNLPVPPKVREVQTDKHPSSHLVMESIIPCTITKSALTKSLSHNVNLIKQ
FT                   MGCQLLVFSFKKLDIVINLYDEKGWSSAKSELINLFKARIPELSSISSALEAAGQAQNE
FT                   NKVLSASLSVILNYYSKFFPLNFSITLPSDNIFVTIMKSDTFSGLDLVMLDNFLHFQQF
FT                   NNSHTKWYNPNAGENSIFTSLLRLASSANATNSITNKVKELLENLLNFTVLFNNDELLA
FT                   SPVLVLINSLQVIMRSESCRSSAQESKIWKLLDETVARCMKTPYKYVDMSVPYENCSPF
FT                   LVALIEQWSFVDKQTPFELVLRWMLIYLRSCYFVREPIESLKPLLEAAPSISSDLQSEY
FT                   LNFENYDDSLDLLQGQDYLLSNNAPYSFFQHITLVSTSDLDQVARYPTNELDIAGLLTR
FT                   IQFLLKADTSSMKLQKFCAIVDNLLMKAANYTLSQDDFKQKFASTKYFEKVTIAADIDT
FT                   ENELVCEKSAYVTNSMLEVYLQLDEDVSEVSAYIHHLWGERLPQWSSNPDLMSILIKGL
FT                   QILSDSQLSEIQLRLLLNNQDLLPLILTEMVKRGTTLPGTRFMELLALKSEKITDVLSE
FT                   YLTKKLVENPNFESIISLALEDAISYPIIIDCLAYEEGAKKIMGFLDLIKCESLCINVA
FT                   AAISDKAKDTEASHFVDRALHSACDDLSKLSVLDFEAAMKLFYDCHANASEDLKHNVLG
FT                   FLISQNEYRFSPWAAKIVELYNVKGDHNISTWMQKSVLYITKTFAERNHLSSKFSEFLQ
FT                   NFKGLLFKVNIWSLGVQSILETQVEVILGGMWVGRAEALEYLNILLLGASNSQVNSNKM
FT                   LQLLLNNEQSSLNDQKTNSHARFLTSSIMSRLFHLDAAKNATPIVQEKLLLSYNGSVSA
FT                   DDRIIFDVLKEIESRTLSSWTNNVFVWDFQEDFEEDQADDTPLLTKEREGLVLTIKRAR
FT                   INTTIENFACEQPSIPQFASGNVEDTWHRLVAFEEAIELTYQNFERKVYDPLFILLLVA
FT                   NNKELFRNDNSDLESQSQASFFDMRKVVVSGLLELVILSLSERNETKDVALALIYKMID
FT                   SLKHGGSFKDSNIFHIFLMKVAYTFHTEKDQEVSPLVWYMISRLSSILTQPSSVLYEKA
FT                   YKWVLASPSVQPQHLPLYDAVVVTRPTEDGEHYYKYLNWFLEAIQRGIKSEDDIKLLRS
FT                   RNLLEWMMNLLNSPYINLGQRNTLNLLVYRIQRIETGGPTLITRYAGVSFLEALREGSS
FT                   EGLVGVSTETLANTKNKLRLKQFLVSQQLDVNYSELGAGYAAVSKSQKRLAEWMEGDVD
FT                   NVLKRLCTIGNQTSHQTNLNYPFMHV"
FT   gene            <84727..>85731
FT                   /locus_tag="KLTH0C00858g"
FT   CDS_pept        84727..85731
FT                   /locus_tag="KLTH0C00858g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0C00858p"
FT                   /note="similar to uniprot|P40576 Saccharomyces cerevisiae
FT                   YIR024C (putative) involved in cell cycle control"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG7"
FT                   /protein_id="CAR21828.1"
FT                   /translation="MLILPITCRCEVNGESKLGRELEPLKTECPAFQLFLGASKKAEIG
FT                   QNNLVASIAEAATARITSTLVTRAIKSRWNPTNNLIKMWNFSRLASRISRRLYSSSFPH
FT                   ASSKNPGNSKFDKTMLKPALVIVLFGSMLTNVMEQQKRNSELERRYGMKLGVLQDLIDK
FT                   VKHGEDSSIDIDKELALVNKLFERFEISKYVELEEEASKVRKLNDQADVISQNEIAARL
FT                   NGKKPVDDETSLRELFRDIMKDIDDIPVARNEESKQHDSKVVSSDQNKAIYQVEMKTVP
FT                   ESEIQTNERVLTEEAKNEKQRLKFRPATDSHVIVENPGEYSTAAEDHKVSKFL"
FT   gene            complement(<85841..>89098)
FT                   /locus_tag="KLTH0C00880g"
FT                   /old_locus_tag="KLTH-ORF14323"
FT   CDS_pept        complement(85841..89098)
FT                   /locus_tag="KLTH0C00880g"
FT                   /gene_family="HOG000094358" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14323"
FT                   /product="KLTH0C00880p"
FT                   /note="similar to uniprot|P21657 Saccharomyces cerevisiae
FT                   YIR023W DAL81 Positive regulator of genes in multiple
FT                   nitrogen degradation pathways contains DNA binding domain
FT                   but does not appear to bind the dodecanucleotide sequence
FT                   present in the promoter region of many genes involved in
FT                   allantoin catabolism"
FT                   /db_xref="GOA:C5DDG8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG8"
FT                   /protein_id="CAR21829.1"
FT                   /translation="MTNNTLDNWNSGASGGQGSGNVNNSMLNLNDDYTNILNNLGNSQS
FT                   QLLGDDLANRHDSQSSQQSPYNLPNLNARPSNEKQPNLDLLLQHYQELFSRSSGGSGDN
FT                   SPDPSGVVAPNTNSKALAAQENKSVIAEKPCDHCRRRQIKCVIAPDLPNCVQCENKGIK
FT                   CAYSELPSSRVPTDIVPDKQKRSRVDENVDVHELLKRAKLNNNDSVSQYYSDLLQNLNQ
FT                   SSNSRNPSGPSQYPTRSNQLNPFMMYGTPGLNDQASKSGTASVHNGASPAYLSGNTTYN
FT                   TNNPIAQKMAYTPPPIQYPRSSFYVGPTSVFDINLVNHVKLDKIDQVQLSKTLALRKVA
FT                   PNVQFLLRDDLNQQLYMKQEQEIDMVEKLVHPHGKILVDIFFKLIHPQYPILHERVFLE
FT                   KYSRSYRELTAPLLAALYSLSLQWWDFHPQLIGFPKPDVVNQLNEIALRTFFDVVERPK
FT                   LSIIQTGLLILQCRSESSSNWVICSEIVALAEDLGLGIDCQDWRLPGWERGLRRRLAWA
FT                   VWLEDKWASMMEARYSHLILGRNWLVKMLADEDFPESSPVINDSNGNNKMNYQGLKDVT
FT                   SPVGNISMLDMTPTGEDFKNGKLLFQHMVSLSIILGEVMDTFYTLGALKTVTKIEQVLK
FT                   LAKPLQLKMREWYHSLPSQLSMNNFQQRRFTSNASLTLSYFAVELTLHRKIITTLNSET
FT                   SPQLVQVCRLAAKTRLIAAIEFVRDLKFEHVNSFWYTCSTGNLTLIGTFAALLYVTAPS
FT                   KEESIVFRDCLRNFVWILRMSSKGFEKAENGLKKIHMLLAQIPGLLTDDPVVPQQPQQS
FT                   FVAPPSESPMMPQQQLQQQQQRQQQQQQQQQQQQQQQQQQQQQQQAGQQSYGAALSQSP
FT                   FDPQRSFNQLRQLPPEILQQLASLQNNMPSINSSSSTEETMKPSDHRSVKPSRPEGPEN
FT                   RETLPDFHNMSPELTSLDLRSSPQKNTRAQPEHESSTRPEQAVGSEDTQQSPTKTPGIT
FT                   EKSKILTPQSVYGANGKKANASEQNDDHSREINNYDPKREGSHVSPASLAESNGNDKPV
FT                   DSGNAQKVSRDLEDSATAESKETKSGSGTSSPSSDQT"
FT   gene            complement(<89610..>90125)
FT                   /locus_tag="KLTH0C00902g"
FT                   /old_locus_tag="KLTH-ORF14322"
FT   CDS_pept        complement(89610..90125)
FT                   /locus_tag="KLTH0C00902g"
FT                   /gene_family="HOG000202303" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14322"
FT                   /product="KLTH0C00902p"
FT                   /note="highly similar to uniprot|P33204 Saccharomyces
FT                   cerevisiae YKL013C ARC19 Subunit of the ARP2/3 complex
FT                   which is required for the motility and integrity of
FT                   cortical actin patches"
FT                   /db_xref="GOA:C5DDG9"
FT                   /db_xref="InterPro:IPR008384"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDG9"
FT                   /protein_id="CAR21830.1"
FT                   /translation="MSQSLRPYLTAVRFSLQAALNLTNFSSQVVERHNRPEVEVSNTSA
FT                   ELKLQPMHVSRNEHEQVLIEPSVNSVRVSIKVKQADEIEQILVHKFTRFLEQRAESFYV
FT                   LRRVPIDGFSISFLITNKHTETMKTEKLVDFIIEFMEEVDKEISEMKLFLNARARFVAE
FT                   AYLGEFVY"
FT   gene            <90830..>92524
FT                   /locus_tag="KLTH0C00924g"
FT                   /old_locus_tag="KLTH-ORF14321"
FT   CDS_pept        90830..92524
FT                   /locus_tag="KLTH0C00924g"
FT                   /gene_family="HOG000001088" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14321"
FT                   /product="KLTH0C00924p"
FT                   /note="similar to uniprot|P33203 Saccharomyces cerevisiae
FT                   YKL012W PRP40 U1 snRNP protein involved in splicing
FT                   interacts with the branchpoint-binding protein during the
FT                   formation of the second commitment complex"
FT                   /db_xref="GOA:C5DDH0"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH0"
FT                   /protein_id="CAR21831.1"
FT                   /translation="MSSWKEANDAEGRVYYYNADSGETTWDKPRELFTQLELKLEKHGW
FT                   KTGKTDEGQVYYYNQETGKSCWEIPTFEEHGEEEEAERPHTSDERSTTPAQSNIESYVN
FT                   NSIILNAPVMSQNEAEHVFMEMLKEHQIDSTWSFNKIISELGCKDPRYWCVDDDPLWKS
FT                   QAFEKYLSNRSEDQLLKEHSAVNKFKAAFTAMLSQNKDIRYYTRWTTAKRLFANEPIYK
FT                   HSVVSERTKRQVFQDYVDDLRRNQSEELNKTKQQAKTELQDYLESIMPDKKSLLSWQEL
FT                   STKYLFENSTRFTSNRHFQALSKHDVLMQYITIVEAYTSKTEEELKKLKSANYTKDRIA
FT                   RDHFKELLAEHSKSIRCNSKWEDLYSLFKSDSRFLSLLGRNGSSALDLFMDLVEEKANI
FT                   MKAQKSIANQILIDTSFQWSSDAVQDREKVNEILSKHQQLNSLDTIDRGILVDKMIDDQ
FT                   NQKRAQQAEMIQRLLEQRKKYFLLLLQRVFSSPNAKPETWEKARDVLKGYPEYIDIKEE
FT                   SVKEQIFKEFEPAKGQNTAAAAATGSSALAAPQISRKRQMTPVELDY"
FT   gene            complement(<92590..>93096)
FT                   /locus_tag="KLTH0C00946g"
FT                   /old_locus_tag="KLTH-ORF14320"
FT   CDS_pept        complement(92590..93096)
FT                   /locus_tag="KLTH0C00946g"
FT                   /gene_family="HOG000111516" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14320"
FT                   /product="KLTH0C00946p"
FT                   /note="highly similar to uniprot|P15367 Saccharomyces
FT                   cerevisiae YIR022W SEC11 18kDa catalytic subunit of the
FT                   Signal Peptidase Complex (SPC Spc1p Spc2p Spc3p and Sec11p)
FT                   which cleaves the signal sequence of proteins targeted to
FT                   the endoplasmic reticulum"
FT                   /db_xref="GOA:C5DDH1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR011056"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019759"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH1"
FT                   /protein_id="CAR21832.1"
FT                   /translation="MNLRLELTRFLNLCFALASAFMFWKGLSIVTNSHSPIVVVLSGSM
FT                   EPAFQRGDILFLWNRNELNKVGDVVVYEVDNKEIPIVHRVLREHVDETSGKQLLLTKGD
FT                   NNAGNDIPLYAKRKIYLHKEKDIVGTVKGYIPQLGYITIWISENKYAKMGLMGLIALSA
FT                   LLSNE"
FT   gene            <93347..>94012
FT                   /locus_tag="KLTH0C00968g"
FT                   /old_locus_tag="KLTH-ORF14318"
FT   CDS_pept        93347..94012
FT                   /locus_tag="KLTH0C00968g"
FT                   /gene_family="HOG000262434" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14318"
FT                   /product="KLTH0C00968p"
FT                   /note="similar to uniprot|Q04304 Saccharomyces cerevisiae
FT                   YMR090W Hypothetical ORF"
FT                   /db_xref="GOA:C5DDH2"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH2"
FT                   /protein_id="CAR21833.1"
FT                   /translation="MKVAVFGGAGRVGKILCLALRDNEAFEPLAVVRSGEQANALQESG
FT                   VNASVLDIEKCTVEKITAAIEGCDAVVWTACSGGIAMDRIFTMDLDGAIKAIEATQKAK
FT                   IQRFIMVSAINVDNRDAWWHTALKNNFIAKRTADRILQTSGLQYTILRPGSLHSEQGTG
FT                   KLCSLDSLEQKKPCHYLIEREDVASFIVLALTHPEKTTYKTIPLANGELPMQGFLYVV"
FT   gene            complement(<94049..>95122)
FT                   /locus_tag="KLTH0C00990g"
FT                   /old_locus_tag="KLTH-ORF14317"
FT   CDS_pept        complement(94049..95122)
FT                   /locus_tag="KLTH0C00990g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14317"
FT                   /product="KLTH0C00990p"
FT                   /note="similar to uniprot|Q03702 Saccharomyces cerevisiae
FT                   YKL011C CCE1 cruciform cutting endonuclease"
FT                   /db_xref="GOA:C5DDH3"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015242"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH3"
FT                   /protein_id="CAR21834.1"
FT                   /translation="MHKAGVGRSTLEALDWCCHKSDAKTLKKLAFSVGSRVGTTKAIIT
FT                   ENILDQCGILNQLAAMRTQRGNLSITAVDLGLENFAYSRFSWAASDNIPRLVKWDKIRL
FT                   DGAFIDLKMQKLQLAPKHMALLGQKLTEVLMLDPTDVFVIERQRTRTLGSANVPDPILK
FT                   VNALEYTLFAFLRSKALYSRPAESPGQRLDYIVESSDPKKMTEYWCNSIPTNALLDSTF
FT                   GAGSPKAKLKARSSALTKMLKIALTKSMLMERTNPKFEVPEIINKNLGSLPLAKKFSLF
FT                   DLLGLGEAAGKSKEDDLADSLLHGLAWLQWTKTFEELKNTIEPSRSSTQALEIFKGFVE
FT                   TKSQELSNYSMSCISRL"
FT   gene            <95515..>96648
FT                   /locus_tag="KLTH0C01012g"
FT                   /old_locus_tag="KLTH-ORF14314"
FT   CDS_pept        95515..96648
FT                   /locus_tag="KLTH0C01012g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14314"
FT                   /product="KLTH0C01012p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH4"
FT                   /protein_id="CAR21835.1"
FT                   /translation="MSYDSRSSILRRGFRLSSSRCQRRSTKGACKYKLKSISRATENYC
FT                   VHHLAISVLMPFSRDWVDSQRTSPVPTRPGTVYLGKYSFSRDTLEETRNEEQITDFRTP
FT                   PKSSRSFRTSIKRVFGKQALQQIEPHPDPTKRHHKFRRWLNTPEKEFTCTWSDFEDGLA
FT                   PRTATTSDEARSERSSGNEVASMTHGTGESAYDTLRRERDDSSDVVFEMFSRMFLDSNS
FT                   GATLHEDKLQSEPIKTAGSAPCARSKNRSGKRKHTILRKFRSTLRRSRPRETAGQFTLT
FT                   EKYMGSDENLQRCLDDMDLMPFDLTAPSTAGNSGEFRDASAAAHGHETAFAGGFSDAER
FT                   TYRRRFSNESYDSGFLPGALHVRKIRQCHAERSPHCE"
FT   gene            <97077..>98609
FT                   /locus_tag="KLTH0C01034g"
FT                   /old_locus_tag="KLTH-ORF14308"
FT   CDS_pept        97077..98609
FT                   /locus_tag="KLTH0C01034g"
FT                   /gene_family="HOG000141824" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14308"
FT                   /product="KLTH0C01034p"
FT                   /note="some similarities with uniprot|P36076 Saccharomyces
FT                   cerevisiae YKL088W Protein required for cell viability"
FT                   /db_xref="GOA:C5DDH5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH5"
FT                   /protein_id="CAR21836.1"
FT                   /translation="MVGSTNEASGSTPVSILAKNGNTTREITAYKGGSGGAQNTQESTP
FT                   SYRPAEESTYMNPQKLRVVTSGKDKESNGPAATGQRVESSVGAEQARSASGAGLKSPMS
FT                   ALGTAVSFTVSNIADKISHRGSISARPSSVALAAQANNGVGGGGAQGEEQPPVNTGTPF
FT                   GSSAASSRQNSVHIPGEFIFFEPTNRPQSASPSANSSAVRKLPHHSNKAIIDSQPGPQV
FT                   PFTEFFQKQDDKKIHILIGATGSVATIKVPAIIDKLFKTYGPDKVSIQLVVTKPAEHFL
FT                   RGLKISTDVKIWRDEDEWCGFKRMGDPVLHTELRRWADVCLLAPLSANTLAKIANGICD
FT                   NLLTSLLRCWTASTPVLVAPAMNTFMYTHPVTKKHLTMLQEDWPFITVLKPVEKVLVCG
FT                   DIGMGGMRDWHDIVDILTKKISEIRGGVGGSDAEEEDGDDDDDEADANAADETDSEDSG
FT                   LDDDDDDDDEDDDDDGEEGNANGSGYRDLKDPQNVEPLAPLRSARSVQGSQS"
FT   gene            <99846..>102080
FT                   /locus_tag="KLTH0C01056g"
FT                   /old_locus_tag="KLTH-ORF14302"
FT   CDS_pept        99846..102080
FT                   /locus_tag="KLTH0C01056g"
FT                   /gene_family="HOG000141856" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14302"
FT                   /product="KLTH0C01056p"
FT                   /note="weakly similar to uniprot|Q08905 Saccharomyces
FT                   cerevisiae YOR381w FRE3 protein Ferric reductase, reduces
FT                   siderophore-bound iron prior to uptake by transporters"
FT                   /db_xref="GOA:C5DDH6"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH6"
FT                   /protein_id="CAR21837.1"
FT                   /translation="MALSGLTARVVYKCAMCGRVLFLEVLFQNCSYLYSMKLPLPIALA
FT                   QFIVSCSAKPSELTYKEIDYVAYSCMYTLSSTAAWCSSDLYGLSCYCTDDNAMGSFLYC
FT                   VHEFLETKNPDTVEEWVYPQCANSTVEGLKQIYENSTNYMVNTSEVPGFNISVPVDFPV
FT                   YVNATMYQYNYMTYNAFWGNLKHANFMGTGAVAYWGLVFLCGTISSMMHRFAPRLTLSL
FT                   NKKSSQLWIVRWYRKNVSLPAAFGTVHTKRNFALGLLPTRLESLIIFGFFVMVLLFQAV
FT                   NIKRTMNNTFFPEKVQEISRYVGDRSGVIANYLMTLTYLLAGRNQIFMWLTGWKQSTFM
FT                   TYHKWVGRFLFLTVFTHTISMLMYTYAEDAYEYYSGSQWWRYGAAATVAGGTMFLQAFS
FT                   WLREKNYEVFLYVHIAMAIVFLLGAWKHIEIFDYQEWAYATLAIWAFDRVVRLVRIFSF
FT                   GVKTAKVCIVSNETLQVTVDRGSWWPFFPGAFGYVHFLKTSIFWQSHPFTVCKTDNNEL
FT                   RLYIKIKRGVTEILYKQLLNEPNYTGEVKIAVEGPYGDKKPAKSYEQVLLYSGGNGIPG
FT                   PYAYAKELGVTANTQKTQFVKLYWVIRHWNSLDWSLEELQALQKYTNIQTVIYVTKAHE
FT                   VKFGDKLLPHFEPSCSSSSIAEKDSAVAITSAAYNDVLQKVLPHIEFREGRPVISDVVR
FT                   EDIEDCQDKNTALITCGHSDMCDEIRQVIAVKVGDHKTSRIDLFEELQTW"
FT   gene            <103368..>103649
FT                   /locus_tag="KLTH0C01078g"
FT                   /old_locus_tag="KLTH-ORF14296"
FT   CDS_pept        103368..103649
FT                   /locus_tag="KLTH0C01078g"
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14296"
FT                   /product="KLTH0C01078p"
FT                   /note="highly similar to uniprot|P87108 Saccharomyces
FT                   cerevisiae YHR005C-A MRS11 Essential protein of the
FT                   mitochondrial intermembrane space forms a complex with
FT                   Tim9p (TIM10 complex) that mediates insertion of
FT                   hydrophobic proteins at the inner membrane has homology to
FT                   Mrs5p which is also involved in this process"
FT                   /db_xref="GOA:C5DDH7"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH7"
FT                   /protein_id="CAR21838.1"
FT                   /translation="MSFLGFGGQPQLNSQQKISAAEAELDLVTDMFNKLVDNCHKKCVQ
FT                   TSYSEGDLNKNESSCIDRCVAKYFETNVKVGENMQKMGNAFAGGPGRV"
FT   gene            complement(<103757..>104485)
FT                   /locus_tag="KLTH0C01100g"
FT                   /old_locus_tag="KLTH-ORF14295"
FT   CDS_pept        complement(103757..104485)
FT                   /locus_tag="KLTH0C01100g"
FT                   /gene_family="HOG000170352" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14295"
FT                   /product="KLTH0C01100p"
FT                   /note="similar to uniprot|Q00873 Saccharomyces cerevisiae
FT                   YKL087C CYT2 Cytochrome c1 heme lyase involved in
FT                   maturation of cytochrome c1 which is a subunit of the
FT                   mitochondrial ubiquinol-cytochrome-c reductase links heme
FT                   covalently to apocytochrome c1"
FT                   /db_xref="GOA:C5DDH8"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH8"
FT                   /protein_id="CAR21839.1"
FT                   /translation="MGSETESTCPVDHTAREAWLKNMSKTDGAEGADAAAKESCPVNHD
FT                   ARKVWLQQAEASNAPEAVECTSDQIPNTPQYKTDVKLPTEREVSSIPRTGTEGQHWVYP
FT                   SQKQFFEAMLRKQWNPNSDDMKTVVPIHNQVNERVWNYIRLWEKGQGGEECGGVQLTSF
FT                   KGDSKKLTPRAWFRSSILGYSKPFDRHDWTVNRCGKDVDYVIDFYSSDTTGGPSVYLDV
FT                   RPKLNSKEGILLRCKKMLGL"
FT   gene            <104968..>106293
FT                   /locus_tag="KLTH0C01122g"
FT                   /old_locus_tag="KLTH-ORF14294"
FT   CDS_pept        104968..106293
FT                   /locus_tag="KLTH0C01122g"
FT                   /gene_family="HOG000038730" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14294"
FT                   /product="KLTH0C01122p"
FT                   /note="similar to uniprot|P08539 Saccharomyces cerevisiae
FT                   YHR005C GPA1 GTP-binding alpha subunit of the
FT                   heterotrimeric G protein that couples to pheromone
FT                   receptors negatively regulates the mating pathway by
FT                   sequestering G(beta)gamma and by triggering an adaptive
FT                   response activates the pathway via Scp160p"
FT                   /db_xref="GOA:C5DDH9"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDH9"
FT                   /protein_id="CAR21840.1"
FT                   /translation="MGCAASTALSADEQDPFLQSKRANDMVERSLQMQKHKEKKEIKLL
FT                   LLGAGESGKSTVLKQLRLLHQGGFGNQERVQYTQVIWADAVQSMKILIIQARKLGIPLD
FT                   CDNPETNRHLFEQKRLLLRARPLEHIDASLAGGSGFLNDYVLKYSETSENKRRTKSTGR
FT                   AQAFQGLEDGDTFNLQELSEGLSEDGTNSALAQSQNVATRSVSSQQIADAISELWKHDR
FT                   GVRQCFARSNEFQLESSAEYYFEHIHNFANPTYVCSDEDILKGRIKTTGITETAFNIGS
FT                   TNFKVLDAGGQRSERRKWIHCFQDITAVLFVLAVSEYDQMLFEDERVNRMHESIMLFNT
FT                   LLNSKWFSNTPFILFLNKTDIFKEKLTRSPIRQYFPEYQGRVGDVDAGLKYFESIFLSL
FT                   NKTGRPVYVHRTCATDTQSMRFVLTAVADLIIQQNLKKSGIL"
FT   gene            <106485..>106904
FT                   /locus_tag="KLTH0C01144g"
FT                   /old_locus_tag="KLTH-ORF14290"
FT   CDS_pept        106485..106904
FT                   /locus_tag="KLTH0C01144g"
FT                   /gene_family="HOG000231799" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14290"
FT                   /product="KLTH0C01144p"
FT                   /note="similar to uniprot|P36077 Saccharomyces cerevisiae
FT                   YKL086W SRX1 Sulfiredoxin contributes to oxidative stress
FT                   resistance by reducing cysteine-sulfinic acid groups in the
FT                   peroxiredoxins Tsa1p and Ahp1p that are formed upon
FT                   exposure to oxidants conserved in higher eukaryotes"
FT                   /db_xref="GOA:C5DDI0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016692"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI0"
FT                   /protein_id="CAR21841.1"
FT                   /translation="MSIQTGGLNKISEIPLSQIRRPIAPVLDFQKIDAMVSTMKGVPEA
FT                   SKTCTIEEASKMDGQLPPIDVVCVRHNGQNFYFGFGGCHRFQAYERIRDQTGKDVLVRC
FT                   KVIPATKDQLKLYVGSSVDDMFGTIDNEASREARQ"
FT   gene            <107662..>108555
FT                   /locus_tag="KLTH0C01166g"
FT                   /old_locus_tag="KLTH-ORF14287"
FT   CDS_pept        107662..108555
FT                   /locus_tag="KLTH0C01166g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14287"
FT                   /product="KLTH0C01166p"
FT                   /note="weakly similar to uniprot|Q08909 Saccharomyces
FT                   cerevisiae YOR385W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI1"
FT                   /protein_id="CAR21842.1"
FT                   /translation="MGSTPSKPITQHTADVPPSLRFCRERHMVLASVFYKTRSLMCFPT
FT                   QHSFEKFLSNSRKIRAEDDGMGVPSLVLEDPYLLSRVFKGDGVRYRIYKYVLCSASDPL
FT                   PHPSCSVVSQADDRIIYKMPFCEVYKAVHGGLQPGYRLVFYTPDGSLNVDLIKHRTSFD
FT                   MDSQLGEWNVKWVRKARSLLLPDKFELLVVGSVAPPPPTTAGAPGAHRSAAYAATRASG
FT                   AAVWARYKDTDTAFLPKITRKLASLNVGEIEIESNAASYGLDEIPWYTQVIACMSLVIC
FT                   TLQQDRKEKRRRNNSM"
FT   gene            <110532..>111533
FT                   /locus_tag="KLTH0C01188g"
FT                   /old_locus_tag="KLTH-ORF14282"
FT   CDS_pept        110532..111533
FT                   /locus_tag="KLTH0C01188g"
FT                   /gene_family="HOG000213792" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14282"
FT                   /product="KLTH0C01188p"
FT                   /note="highly similar to uniprot|P17505 Saccharomyces
FT                   cerevisiae YKL085W MDH1 Mitochondrial malate dehydrogenase
FT                   catalyzes interconversion of malate and oxaloacetate
FT                   involved in the tricarboxylic acid (TCA) cycle"
FT                   /db_xref="GOA:C5DDI2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI2"
FT                   /protein_id="CAR21843.1"
FT                   /translation="MFAKVAKRAFSSSTANPYKVTVLGAGGGIGQPLSLLLKLNHKVTD
FT                   LRLYDLKGAAGVAADLSHIPTNSVVKGFSADAQDGIKSALKDTDVVLIPAGVPRKPGMT
FT                   RDDLFSINASIVRDLAAACAENAPNAAILVISNPVNSTVPIVAEVLKSKGVYNPKKLFG
FT                   VTTLDVIRASRFISEVSGTNPTTEKVNVIGGHSGITIIPLISQTKHKLMDKEKRDALIH
FT                   RIQFGGDEVVKAKNGAGSATLSMAQAGARFANSVLAGLEGEADVIEPSFVDSPLFKSEG
FT                   IEFFASPVKLGPQGVEKIFSIGEISSEEQELLDKCKETLKKNIEKGTAFVKS"
FT   gene            <111667..>112002
FT                   /locus_tag="KLTH0C01210g"
FT                   /old_locus_tag="KLTH-ORF14278"
FT   CDS_pept        111667..112002
FT                   /locus_tag="KLTH0C01210g"
FT                   /gene_family="HOG000235148" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14278"
FT                   /product="KLTH0C01210p"
FT                   /note="similar to uniprot|P36078 Saccharomyces cerevisiae
FT                   YKL084W HOT13 Mitochondrial intermembrane space protein
FT                   first component of a pathway mediating assembly of small
FT                   TIM (Translocase of the Inner Membrane) complexes which
FT                   escort hydrophobic inner membrane proteins en route to the
FT                   TIM22 complex"
FT                   /db_xref="GOA:C5DDI3"
FT                   /db_xref="InterPro:IPR008913"
FT                   /db_xref="InterPro:IPR016694"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI3"
FT                   /protein_id="CAR21844.1"
FT                   /translation="MNLPKGQLVDEQTRCIHWNSPLDVVCFKFKCCESFYACYSCHESQ
FT                   ESHLIKRYNLTSEPTEEVVLCGVCREAMTFEEYRNGLMRTEQLDCPYCGALFNPGCKLH
FT                   YSIYFDM"
FT   gene            complement(<112021..>113283)
FT                   /locus_tag="KLTH0C01232g"
FT                   /old_locus_tag="KLTH-ORF14277"
FT   CDS_pept        complement(112021..113283)
FT                   /locus_tag="KLTH0C01232g"
FT                   /gene_family="HOG000034239" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14277"
FT                   /product="KLTH0C01232p"
FT                   /note="similar to uniprot|Q04749 Saccharomyces cerevisiae
FT                   YMR068W AVO2 Component of a complex containing the Tor2p
FT                   kinase and other proteins which may have a role in
FT                   regulation of cell growth"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI4"
FT                   /protein_id="CAR21845.1"
FT                   /translation="MLDDPGVRLRNAVMVGKLLIVKRILSRFPDLINVIDPSNGWSLLH
FT                   YASYYGRYLTCVHLVQLGHGKSEVLRTFKGNTCVHLALLNGHEQTAHLLLQHFPYCLNM
FT                   KGHKGLTPVQMTCLHDHHQCLSLLLSLGADISVRDDNGNTALHTCLMYGSESCMRMLVL
FT                   EANMEDLESQKLGEWTPADLCQTFELAEAYQKALKEKQARAKLSKRPSYQFVASPLTIP
FT                   QPFFENTGSPLLTSSPAVQSLTSSLPPLPQISTSRRTSVGSQNVWSPRTPIMCAHNTAS
FT                   VNTPSKKLTTKPSISSQMGSASSASLSHQESALSMNSGRNKPQEHFATPKFSRPSTANT
FT                   PSMGKSISTTSITSSDNNTTKNSPLFHDTQTRPVLRAGSRSDSREASRDSVASQKHSMA
FT                   PPKSAPISLLNIPISKLRNRD"
FT   gene            complement(<113435..>114739)
FT                   /locus_tag="KLTH0C01254g"
FT                   /old_locus_tag="KLTH-ORF14276"
FT   CDS_pept        complement(113435..114739)
FT                   /locus_tag="KLTH0C01254g"
FT                   /gene_family="HOG000211778" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14276"
FT                   /product="KLTH0C01254p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI5"
FT                   /protein_id="CAR21846.1"
FT                   /translation="MTGQTQSDLRPPTDIEIEELKKIYGWKKAFKTWWSRADAKENEKK
FT                   LLSTLEFFPGGDSIRNCELLDVDIGNKQHIHEFSIQNIESCSRDYCKDLVMVHGYGAAL
FT                   GLFVRNFDGLSRIPGINLHALDMLGCGLSSRPRFPGTGLISSVIKRGRVTKEEVYEAEN
FT                   FFIDSLEKWRQQRKLDKFVLVGHSLGGYLSCCYALKFPERVEKLVLVSPVGVEKSVFDL
FT                   TKEHTPSHNNASELGPDLSKEVTNSSGRPTTDDPVKTSSSFHVPDEAGNVERVPNMPWI
FT                   FSSMWTYNISPFGLLRSAGPAGPLLSSRWSFRRFSFAENTEQLLTFHEYCYSIFSGSGS
FT                   GEYALTRILAPGVLARVPLLSRVPENLKCDSFWMYGSHDWMSKEAGSVIVRQINKTKGS
FT                   VKADYSVVSDAGHHLYLDNPEEFNQKLAKFLKVDL"
FT   gene            <114880..>116118
FT                   /locus_tag="KLTH0C01276g"
FT                   /old_locus_tag="KLTH-ORF14275"
FT   CDS_pept        114880..116118
FT                   /locus_tag="KLTH0C01276g"
FT                   /gene_family="HOG000154766" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14275"
FT                   /product="KLTH0C01276p"
FT                   /note="weakly similar to uniprot|P54730 Saccharomyces
FT                   cerevisiae YMR067C UBX4 UBX (ubiquitin regulatory X)
FT                   domain-containing protein that interacts with Cdc48p"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR021569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI6"
FT                   /protein_id="CAR21847.1"
FT                   /translation="MSLVSVVYKFSTYKAKAEPGCVLNEVLQKSVVHFKVESENKSWIL
FT                   THHGKELPLTVPLRLLNLPKGAKLELNHCIEKAASEAKMFRVKFQVLGRGVEVVAVQQS
FT                   DSIIKTIENICEKNSWTLDPQVLKLQCFSKVWNYEALVTASFAHLGILEDVAVRLTISN
FT                   SVVPAKPSVEKTPSLVEYKKDHTPPQIAEKPLLHEVLAYVPNETPSTATKQNVADEDYE
FT                   VSIGQFKSYQRTISKSAGSNELLTKRMREEQENAKKHVIDQCNIRVRFPDRACIDINFN
FT                   PDETMNLVYEAIKRCLADRTVSFRLYYSHPHKEIEDSEAKLVADLGFGSKTLLVFETNH
FT                   KGPYLKEELLQKAKTLADAQSAALQEQRGSRTNELGEETSHAQSNKVGESSVKSSAGLR
FT                   MGQKPKWLKLGKK"
FT   gene            complement(<116156..>118810)
FT                   /locus_tag="KLTH0C01298g"
FT                   /old_locus_tag="KLTH-ORF14272"
FT   CDS_pept        complement(116156..118810)
FT                   /locus_tag="KLTH0C01298g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14272"
FT                   /product="KLTH0C01298p"
FT                   /note="weakly similar to uniprot|Q04748 Saccharomyces
FT                   cerevisiae YMR066W SOV1 Synthesis Of Var (putative)
FT                   involved in respiration"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI7"
FT                   /protein_id="CAR21848.1"
FT                   /translation="MISCRDICVRARIGSQLRFYRKRLKPRYNHVPQVSSLQSELLQPR
FT                   ELRLQAHSPESVERDLRRLGFREIDESGPVDDMLVEYLESSKSPFKKSSKHLNSLKSTL
FT                   VNNKSPNQDRMKALFDFLLKESEQEVRRLESMGPEQLQMLQTIHDSEKSEHSAKEISSE
FT                   RELEKAILRELMESSQDEEGRSLLPNTECLFRVLSDLNMNRLAKADIISVEQMVGAFEI
FT                   SKLLPAYKLRQRGILLSGHLIYSLGNVRMDPINESFYIESLVYYGFYKKALELFNTYRE
FT                   KVEKRWWFEMGMMVCLRANHIRQFDKLLEHSLKTFGSDYISPKVLRTAIRKKLYLRNYQ
FT                   CSEKLTKLLINVASAYGLKLSSQQQQNPQGIFFQSETQADLFLNEKEQVTEADFVAIIQ
FT                   YHLFRNREKPALALLAEFVKLPDVDKNLLSTALVHLKLHLLKSFDVLEKDMHSLLSGKD
FT                   MKLLRQAFSNATRRFHVEAIQKKFDTVLFDSISDIASQPVLTQNIEQFVANTNKNLPRN
FT                   PENIQDETVHSKKLHNLLKALLKSGKEDLAASLMKDANSYSSSVKESKLSLDEDDFSGI
FT                   NAHHYAVWIDHYSRKVQKAKNPREKYEYEAKIKEIVEKVNKGNVQYNSVLMTSLLTHFT
FT                   VTANLDNCFNIINPLMDFRCSKTEESKGNRKLLSFFERREITKSLYFQIWKALILYFSR
FT                   FENGLGTTEIRSNQKAWGYKISAERSKITVHPNYDFRTLFKLMVLEDNILPDRPFYHTI
FT                   LQAFIKVRDWAYIPAILRYMRHINGIEIDRKLQRYINGGLKLEYIAVERERLDSQKAEF
FT                   SGVEKFTTPVVNTARRNVENRIKKGDILGETSTDYSLQVEQNILNFLRSYRSHEMERVQ
FT                   QAFEEVGIEVINT"
FT   gene            complement(<119087..>120466)
FT                   /locus_tag="KLTH0C01320g"
FT                   /old_locus_tag="KLTH-ORF14271"
FT   CDS_pept        complement(119087..120466)
FT                   /locus_tag="KLTH0C01320g"
FT                   /gene_family="HOG000248176" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF14271"
FT                   /product="KLTH0C01320p"
FT                   /note="similar to uniprot|P36080 Saccharomyces cerevisiae
FT                   YKL082C RRP14 Required for normal pre-rRNA Processing
FT                   Protein required for cell viability"
FT                   /db_xref="InterPro:IPR007019"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDI8"
FT                   /protein_id="CAR21849.1"
FT                   /translation="MSNSLEERLRINSNAFDGLLSLIPAKYYYDDKTQDQWKAKKKTKA
FT                   QSKLDKRKKLDPEQQNEESASALEVMEAREKNGKPAVIPGQKPSREQEEASSEEEEEVE
FT                   EESTSGDEGASETGENAGQVQAEPKGPVNSKIESEQEDGSKGEEDDEDSIDVIFDDEGN
FT                   KVEAQPESFDKPAAEAASAVEDQPAPPADSKASKKQNLEKLRAKLQEKIQAMKEKRRAP
FT                   GTQVTGALSSREAILAQRKRKEELKRKRTEQNTPKDEDSSDESNSGSDAEGDSETVSKK
FT                   RRVDDGIANDLMFQNIVFDDGSRATSDLQRLRKAREKKGPSKNDIKAHLSATEAKRAKL
FT                   ESEDELVQIQQKEKEKWQRAMLQAEGERMRDDEKLLRKALKRKEAKKRKSAVEWRERKE
FT                   AVATAISDKQKRREENLQIRKENKGKKRNHREKMKRGIKGVAPTKKRAGFEGRLKSGKK
FT                   K"
FT   gene            <122117..>123611
FT                   /locus_tag="KLTH0C01342g"
FT                   /old_locus_tag="Klth0C.mRNA.169.p"
FT   gene            <122390..>122498