(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_4

ID   LACTH_4; SV 1; linear; genomic DNA; STD; FUN; 1513537 BP.
XX
AC   CU928168;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome D complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1513537
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1513537
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1513537
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="D"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0D"
FT                   /db_xref="taxon:381046"
FT   gene            <796..>2658
FT                   /locus_tag="KLTH0D00110g"
FT                   /old_locus_tag="KLTH-ORF12822"
FT   CDS_pept        796..2658
FT                   /locus_tag="KLTH0D00110g"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12822"
FT                   /product="KLTH0D00110p"
FT                   /note="similar to uniprot|P38724 Saccharomyces cerevisiae
FT                   YHL047C ARN2 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to the
FT                   siderophore triacetylfusarinine C"
FT                   /db_xref="GOA:C5DDD7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDD7"
FT                   /protein_id="CAR22295.1"
FT                   /translation="MPEYQQGGPSLGSESTPNENYGKANVVQTEKEFSHDSKNEPELGD
FT                   KLQITKRIVIRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQ
FT                   THSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRY
FT                   AAGSIFYYIGLVGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPE
FT                   KNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQ
FT                   LFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVPFFIYWESK
FT                   LALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSL
FT                   YSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVV
FT                   WGITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRL
FT                   LKALGDPTLALEAYNMPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLL
FT                   TFFLRDPPLTEDYGQKLEDDEYVKHDDPITDWIAERFSSFKKHE"
FT   gene            complement(<2951..>6727)
FT                   /locus_tag="KLTH0D00132g"
FT                   /old_locus_tag="KLTH-ORF12818"
FT   CDS_pept        complement(2951..6727)
FT                   /locus_tag="KLTH0D00132g"
FT                   /gene_family="HOG000190843" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12818"
FT                   /product="KLTH0D00132p"
FT                   /note="no similarity"
FT                   /db_xref="GOA:C5DFV4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV4"
FT                   /protein_id="CAR22296.1"
FT                   /translation="MEKISDRFAAIHGFLIKTNRDGTKRITCPNISSLKPTKKEVQRIL
FT                   ELKLQNLAVYLGMKEDLIYVDCPLLFETVTSEQRYFYSTEDGMKAVRSGRTNSANTRRS
FT                   IEYRVLPITLPNKTRKYLCQTGKKLPEMPLEHEIATPRQESEAETATVPQASEDLDVFH
FT                   TLHCDKLVFTNRDRRLFRSFAMDRTLYEVESVAILKHCHREAISKTTKTNSFGEPLVTK
FT                   YKLETLEIHGKHAGVLLFLIANLHQLSLGQQVERPTVDSELLLDRIGELHNTEAKAAHL
FT                   QQLLYIVLKEERYMDLANLFTRLLLFRLSAHFDIRKDLEVEEMETVRERMSATGVWIKC
FT                   VIISEKSEDQLNIFQEESHNIWSKFTTLYHKVAKESDQTMTMNINRVPPDCIRVYGKTF
FT                   GREYIKSFYSDMQYEFDQQWSKLDRVLTMTPVESTGKMLLENYRIPWAGHGYRANFSLK
FT                   DMFPQWIHDQVSPSMRQPLTQLDKREVLGAIDKMTVALMWMIWLAAGVPYTFSELQVLA
FT                   CGGDQQNIYVDSERRCVQIITRSFKKGNLKEDFKWLDKRTSYYLVYYVTVLRKTQISVL
FT                   GENYEAFEPPKEGEVDLEGIWEHIEGKCNMSKKEASALIMDQYLFLDAKLGQLMSRRRF
FT                   LKPSEEHPNYVASPERLSFKQLKFGRMGLLRQYLASSLNDSKPVKTARIDLAMCRFAAS
FT                   SARDYMDELGDSEDVDDPDAMGDLEVLEESMWQCEQSERFMTRTWHEEIAKQWIRWVGL
FT                   DEEEEIHHPLTYSVGEIVLQKEALCPDDLVHAGRELYGKSFTFRNSDQYLACVNAYLSN
FT                   KKIIAVQAPPGLGKTLVFQLPLMCYTMRKLSLVSFVFVPFVGLLAGTMCRLEASGNLRV
FT                   GSVEKLLNETRCKENSLLDVYVGTFNDAAAEDFIKMINFWSLLYPEKKLGLLAFDEFQN
FT                   LYDEKSHSEVSFPSLKRVQFGRFRRIILTSATCEQGSAQGALQELGFRGREGTNFTWER
FT                   SQAGRSVDVPIFLRNYVQEPAVMHVYKHALRMRGNGVGQVKQFLRSLFAYDPDAKAALV
FT                   VGENVATTELFTEVSQEFSAAYVHSDLTTEEKLKRVQSFIKDKSLQLLIGTKQVVEGLD
FT                   IEGLRMVILLDYYPRVAEYIQCVGRVRGSGTCIALWQDPPPQVENDQPRVDYDKCFTSQ
FT                   ICKYYELPQRVHAGCCGSFESVTEEAKSLFHRVVLEEEVNDVCSQKTTRDEDSEQGRER
FT                   KIARTDVIASADDSNEVSGVNKRPQDDTAITKA"
FT   LTR             complement(7718..8133)
FT                   /locus_tag="KLTH0D00154t"
FT                   /old_locus_tag="Klth0D.LTR.1"
FT   gene            <9418..>11267
FT                   /pseudo
FT                   /locus_tag="KLTH0D00176g"
FT                   /old_locus_tag="pseudo-Klth0D-9418-11267"
FT   gene            complement(<12199..>13608)
FT                   /locus_tag="KLTH0D00198g"
FT                   /old_locus_tag="KLTH-ORF12810"
FT   CDS_pept        complement(12199..13608)
FT                   /locus_tag="KLTH0D00198g"
FT                   /gene_family="HOG000189191" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12810"
FT                   /product="KLTH0D00198p"
FT                   /note="similar to uniprot|P24031 Saccharomyces cerevisiae
FT                   YBR092C PHO3 Constitutively expressed acid phosphatase
FT                   similar to Pho5p; brought to the cell surface by transport
FT                   vesicles; hydrolyzes thiamin phosphates in the periplasmic
FT                   space, increasing cellular thiamin uptake; expression is
FT                   repressed by thiamin"
FT                   /db_xref="GOA:C5DFV5"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR016274"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV5"
FT                   /protein_id="CAR22297.1"
FT                   /translation="MWLENNMLMALAGLYTAHALSIPKKYKADVKNIGTQEHIFPYLAG
FT                   SGPYFSYPNDYGISADTPSGCEISQIQLLARHGERYPSKSKGKKLLKTWNTLQHFPYQF
FT                   NGSLSFIDDDYEFFIQDLDNLEMETTTENSVNAINPYTGEMDAKKHAQEFLAQYADFLE
FT                   DNREFAVFAASSQRVHDTAQFFIDSLGDKFNISLQVVSEEPSAGANTLSPGYSCPAWNP
FT                   DEYEDIIGSYSTTYLKAIAERLNRENSGLNLTVTDAYNLFDWCAFELNARGYSEICDVF
FT                   SPEELIHYSYYDDLTAYYEDGPGYPLIQAVGALYFNASIKLLQQSEQLDQKVWLSFTHD
FT                   TDILNYLTTVGLFDDEKKLDPSYIPFRNHVFHKSWFIPQGARVYTQKYRCSNESYIRYV
FT                   VNDAVIPLENCSDGPGFSCEANKFYKYAENRTANQDFYQSCNVSSVSNITELTFFWDWN
FT                   TTHYNATLLKE"
FT   gene            complement(<17298..>17885)
FT                   /locus_tag="KLTH0D00220g"
FT                   /old_locus_tag="KLTH-ORF12803"
FT   CDS_pept        complement(17298..17885)
FT                   /locus_tag="KLTH0D00220g"
FT                   /gene_family="HOG000090267" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12803"
FT                   /product="KLTH0D00220p"
FT                   /note="highly similar to uniprot|P40893 Saccharomyces
FT                   cerevisiae YJL217W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR009784"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR015987"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV6"
FT                   /protein_id="CAR22298.1"
FT                   /translation="MTDSPWSKGSWLNAPSQVTIDNDRLKITTDEKTDFWRQTFYGFTR
FT                   DSGHFFGIKTGSSFTAELRVQGSYESLYDQAGIMVRIDSKNWIKAGIEVSDGQKMLSSV
FT                   LTTGVSDWTTAVYNGNAYDFWLRVTVENGVLRLQVSSDKKRWPLVRLAPFPSSEEYFVG
FT                   PMACTPKRGGLNVTFSDWKLTPPLKRELHDLS"
FT   gene            complement(<20418..>21098)
FT                   /locus_tag="KLTH0D00242g"
FT                   /old_locus_tag="KLTH-ORF12799"
FT   CDS_pept        complement(20418..21098)
FT                   /locus_tag="KLTH0D00242g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12799"
FT                   /product="KLTH0D00242p"
FT                   /note="some similarities with uniprot|P36034 Saccharomyces
FT                   cerevisiae YKL219W COS9 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV7"
FT                   /protein_id="CAR22299.1"
FT                   /translation="MDERNIEEYLVGSHNESIGHSRLPRDVFHNWFQYEVVRHKFYFAV
FT                   AVIQVILFIISTHNFFQAQKNANKILTVTGAVYLSSVVIYFTGLIFFQVERGFVTTAAN
FT                   KVQFLKELITIRPGIDMIEWDILATKANTIFYNESVLTSPYYFYDGASCYSFFRFVFLL
FT                   PYLRRKEACFADENSPDEIRRFISQAIKVYQEKADRKWQLILNKILSGRTNTSRWHSNF
FT                   CFKN"
FT   gene            complement(<21321..>22868)
FT                   /locus_tag="KLTH0D00264g"
FT                   /old_locus_tag="KLTH-ORF12798"
FT   CDS_pept        complement(21321..22868)
FT                   /locus_tag="KLTH0D00264g"
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12798"
FT                   /product="KLTH0D00264p"
FT                   /note="similar to uniprot|P17064 Saccharomyces cerevisiae
FT                   YER056C FCY2 Purine-cytosine permease and similar to
FT                   uniprot|P40039 Saccharomyces cerevisiae YER060W FCY21
FT                   Putative purine-cytosine permease"
FT                   /db_xref="GOA:C5DFV8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV8"
FT                   /protein_id="CAR22300.1"
FT                   /translation="MPLKSDVEVQTSDRLTETTSVLPQDDHVNKGAASCNRYFAFLDAI
FT                   NAALGTETKGIEPTTEDERNDASLLNASTMWFSANMVIAAFSVGVLGPIVFELNFWGCV
FT                   VAVVVFAFLGVLPVAFYSVFGAELGLRQMVLSRYLLGNLTARIFAMINIIACIGWGAVN
FT                   TIASAQLLHMVNPHGARCPPWAGCLIIVLSTIIVSFFGYRVIHIYEKWAWVPNLAVFLI
FT                   VIARVRINGSFTIGHWEEGANTAAGILSLGGIVFGFATGWTTYASDYTVYMPSTINKYK
FT                   VFFAVTAGLMLPLCFTILLGAAAGRAAMNNELYRYYYDKESTGGLLYAILVPKSLGGFG
FT                   QFCCVVLAMSTVANCIPNMYSIALGTQSLWQPLAKVPRVFWTVTGNFVTLAIAIPAYYK
FT                   FASFMTTFMDAIGYYLSIYIGISISEHFVYRRGRFQNYIVADWSSWDRLPVGYAGCAAL
FT                   FVGGVGVALGMCQSYWSGEIGRLIGDYGGDIGFELGLGFSVITYNVLRPLELKFVGR"
FT   gene            <25172..>26821
FT                   /pseudo
FT                   /locus_tag="KLTH0D00286g"
FT                   /old_locus_tag="pseudo-Klth0D-25172-26821"
FT   gene            complement(<28125..>28883)
FT                   /locus_tag="KLTH0D00308g"
FT                   /old_locus_tag="KLTH-ORF12793"
FT   CDS_pept        complement(28125..28883)
FT                   /locus_tag="KLTH0D00308g"
FT                   /gene_family="HOG000141879" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12793"
FT                   /product="KLTH0D00308p"
FT                   /note="similar to uniprot|Q12512 Saccharomyces cerevisiae
FT                   YOL154W ZPS1 Putative GPI-anchored protein transcription is
FT                   induced under low-zinc conditions as mediated by the Zap1p
FT                   transcription factor and at alkaline pH"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFV9"
FT                   /protein_id="CAR22301.1"
FT                   /translation="MFENFKVMKITNLLSCTSLLAAISLSAPVEYSSNATISSYVEYNS
FT                   DIPGWARPTFPELYQTCNSTKRRILQSFIEDSLEVSAYAKDRLLNYGAEDVFFQRWFGN
FT                   GSIITVLGTLDHLVEASKAGFVFRCDDIDGLCLKNPTTYPGYHRQTADKETVICDLFFQ
FT                   SKKPLVNICYEGAIKDVGPKHYAGVDILHRYLHISSMNMNGFIGEFVEEFDDLAEFASG
FT                   NSTFAVRNVDSYLYYMADVYSSSVVPGGCL"
FT   gene            <29951..>31029
FT                   /pseudo
FT                   /locus_tag="KLTH0D00330g"
FT                   /old_locus_tag="pseudo-Klth0D-29951-31029"
FT   LTR             31772..32188
FT                   /locus_tag="KLTH0D00352t"
FT                   /old_locus_tag="Klth0D.LTR.2"
FT   gene            complement(<33818..>34939)
FT                   /locus_tag="KLTH0D00374g"
FT                   /old_locus_tag="KLTH-ORF12786"
FT   CDS_pept        complement(33818..34939)
FT                   /locus_tag="KLTH0D00374g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12786"
FT                   /product="KLTH0D00374p"
FT                   /note="weakly similar to uniprot|P53344 Saccharomyces
FT                   cerevisiae YGR295C COS6 Protein of unknown function member
FT                   of a family of conserved often subtelomerically-encoded
FT                   proteins"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW0"
FT                   /protein_id="CAR22302.1"
FT                   /translation="MNKACVPDKEAQNDFLPKFFYKSSLRWALDQLMRMPLFYLLLSSI
FT                   VIDIVWFSIGNKLHSFWIHVPVFSSLLLQIKVTKAISNSIQRLCEIVIEEGPGMQEEQW
FT                   DIAAARMNSHFYEQGLWPNSCCLYSGRQCHAAFRHLVMTPYNKKEEQIQASYSLDQQLP
FT                   LEEQAAKVYIESVSRWWNTYTANLESSAQFHIENTLPQQEYRSKASWCFFKFIEVVMGQ
FT                   SSFGGMCFYSILLSLFFTSFTSFKNYDSLLGVWIGNAAGFSICGPLLFFVLRGADLDAP
FT                   HLMAFWASVVAIEPHGDINKWGLVASHTNHYWNALNEESPRNFFFDSMDCRKAFKNRFS
FT                   TSLLRNKGNSHIYSDLRKYIEEALEASKEINEK"
FT   gene            <35809..>37278
FT                   /locus_tag="KLTH0D00396g"
FT                   /old_locus_tag="KLTH-ORF12784"
FT   CDS_pept        35809..37278
FT                   /locus_tag="KLTH0D00396g"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12784"
FT                   /product="KLTH0D00396p"
FT                   /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
FT                   YOL119C MCH4 Protein with similarity to mammalian
FT                   monocarboxylate permeases which are involved in transport
FT                   of monocarboxylic acids across the plasma membrane mutant
FT                   is not deficient in monocarboxylate transport"
FT                   /db_xref="GOA:C5DFW1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW1"
FT                   /protein_id="CAR22303.1"
FT                   /translation="MLMPSMLQKPTRAFLHGLKDLRKDHFEDSRFEAPTTSGYEGSAEE
FT                   RRLFGAELQAKRGNVQETPLSNELVEEIEIFEQEGGFQAWLVVFGSFMGLIPVFGTVNS
FT                   LGAIESYISKHQLASESSTVVSWIFSIYLSLTFSSCIIAGGYFDRNGGRDPLCVGTILF
FT                   TGAIIATADCKTVWQFILAFSVLGGISSGILMTPLVSCVATWFLKKRGLATSIATIGGS
FT                   VGGVIFPVMLRSLYSKVGFSWALRILALICFSCLACSIIFARERQKPESKPFHTKTEAF
FT                   KWYLNSSLNWRYFLDWKFLFASLGMGFAENSLTASSTYLASYSLARGNSEEVSYALIAT
FT                   TNAVGIFGRYIPGYLADRWTGRFNMVIITVSLAAFFNLVMWLPFGGNVKVLWAYSILYG
FT                   FTTGTILSLPPVCIGQISRTTDFGKRYSSAYFLEALMTIPVIPVGGAIIGSGKISNYND
FT                   FIVYSSMMMIAASICFIISRSICTGFRMCKF"
FT   gene            complement(<37778..>39463)
FT                   /locus_tag="KLTH0D00418g"
FT                   /old_locus_tag="KLTH-ORF12780"
FT   CDS_pept        complement(37778..39463)
FT                   /locus_tag="KLTH0D00418g"
FT                   /gene_family="HOG000061335" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12780"
FT                   /product="KLTH0D00418p"
FT                   /note="similar to uniprot|P16467 Saccharomyces cerevisiae
FT                   YLR134W PDC5 Minor isoform of pyruvate decarboxylase"
FT                   /db_xref="GOA:C5DFW2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW2"
FT                   /protein_id="CAR22304.1"
FT                   /translation="MTTVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVN
FT                   CCNELNCSFAAEGYARTKGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTND
FT                   SSDHRLLHHTIGTHNYDYQYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYI
FT                   EVPTNMASAICAPPGPISSLVNSVPTPKDVLSQAVNASVDFINSHLKPTLLAGPKLKCA
FT                   DAQKAFLRLAEALKCAVAVQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTIC
FT                   AGCIFTDYSTTGWTALQPSSHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKS
FT                   LIEYNRLRQSPPLIKAADPKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLP
FT                   KGALFEVEMQWGHIGWSVPASLGYAVGAPDRRIITMVGDGSFQMTAQEVSLMVRLRKPI
FT                   IIFLINNYGYTIEVEIHDGPYNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIE
FT                   KAQANVSGPTLIEIQINRDDCTNELITWGHFVALANARPPKKTT"
FT   gene            complement(<40316..>41296)
FT                   /locus_tag="KLTH0D00440g"
FT                   /old_locus_tag="KLTH-ORF12778"
FT   CDS_pept        complement(40316..41296)
FT                   /locus_tag="KLTH0D00440g"
FT                   /gene_family="HOG000213793" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12778"
FT                   /product="KLTH0D00440p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DFW3"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW3"
FT                   /protein_id="CAR22305.1"
FT                   /translation="MAQNKESSTMKAGLNPVKVVVVGTGSVGSTTAYTLLLSGMVAEIV
FT                   LIDINKDKADGEGMDLNHAAPMTTDCRVYVGDYPDCANAAIVIITGGANQKPGQTRMDL
FT                   AAKNAKIMQEIIPNIVKNAPDTILLLATNPVDVLTSISYKLSGFPASRVIGSGTLLDSA
FT                   RLRYNLSKYYNISSESIGAFIIGEHGDSELPVWSLASIAGMRLRDYCEKSNQKFDQDAL
FT                   EKIFEKTRSAAYDIIKRKGYTAYGIAAGLVRIVETILKNEGSLLTVSTVGDYFGVKQVA
FT                   LSVPTKVDRTGAHHIVGLSLDDNEIEEVKKSGQNIKSVCSRLGFD"
FT   LTR             43700..44116
FT                   /locus_tag="KLTH0D00462t"
FT                   /old_locus_tag="Klth0D.LTR.3"
FT   gene            complement(<44278..>45819)
FT                   /locus_tag="KLTH0D00484g"
FT                   /old_locus_tag="KLTH-ORF12773"
FT   CDS_pept        complement(44278..45819)
FT                   /locus_tag="KLTH0D00484g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12773"
FT                   /product="KLTH0D00484p"
FT                   /note="similar to uniprot|Q12300 Saccharomyces cerevisiae
FT                   YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="GOA:C5DFW4"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW4"
FT                   /protein_id="CAR22306.1"
FT                   /translation="MGILQTLFHAEEDIQGSKFRAIFIGLFVAFGGILFGYDTGTISGV
FT                   LAMDYVKEHFTSRGHFTANETSLITAILSAGTFCGAMLAPLASDTIGRRLGLIISTLIF
FT                   AVGVVLQIAATGQNLLIVGRVIAGAGVGVLSAIVPLYQSEASPKWIRGAVVSCYQWAIT
FT                   IGLLLAACVNQGTHARNDSGSYRIPIALQLLWAIIMFIGMVILPESPRFYIMKEKVPEA
FT                   RKALSKLRGLPEEHEVIQNELEEISANYNYERSFGSTSIWDCFKPANHQLKRIFIGIAI
FT                   QALQQLTGINFIFYYGTQFFQNSGIKDPFIIQLIMNVVNVVMTVPGIALVEIAGRRNLL
FT                   LWGAIGMCVSELIVAAVGTALPDSFSANKTLIAFSCTFIASFAATWGPLAWVVVGEIFP
FT                   LRVRAKSVAVCAASNWLFNFAIAYATPYLVDSEHANLQSKVFFIWGGCTFLCFLFVYFF
FT                   IYETKGLTLEQIDELFEVCPSARYSKNFVPSSGPAVDVSNISDSDKAVVEVLEKV"
FT   gene            <47320..>49170
FT                   /locus_tag="KLTH0D00506g"
FT                   /old_locus_tag="KLTH-ORF12767"
FT   CDS_pept        47320..49170
FT                   /locus_tag="KLTH0D00506g"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12767"
FT                   /product="KLTH0D00506p"
FT                   /note="similar to uniprot|P38731 Saccharomyces cerevisiae
FT                   YHL040C ARN1 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to ferrirubin
FT                   ferrirhodin and related siderophores"
FT                   /db_xref="GOA:C5DFW5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW5"
FT                   /protein_id="CAR22307.1"
FT                   /translation="MSIEKETATGVQSSAYPIEADDKDSHRELNEYGLPDKLRVTRHIV
FT                   IKKTEILAAQYDSWYYRVILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIG
FT                   VVNNVIGAASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNI
FT                   GYVGVILVLLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGM
FT                   WAFIFPLSCVPLIACMIHMRIKARKTPEWIALKQEKSYFQTNGLWDTLVELFWKLDVVG
FT                   VLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPY
FT                   GLIKDRGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWS
FT                   PIFSLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWT
FT                   YPVNISVQSATSHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADL
FT                   AAAAYASPYTFIVSYAWGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDL
FT                   TDEVAHSGLEKGEYIVKDQTDPISDWFSSKWSRLRERKEN"
FT   gene            <50179..>50808
FT                   /locus_tag="KLTH0D00528g"
FT                   /old_locus_tag="KLTH-ORF12760"
FT   CDS_pept        50179..50808
FT                   /locus_tag="KLTH0D00528g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12760"
FT                   /product="KLTH0D00528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW6"
FT                   /protein_id="CAR22308.1"
FT                   /translation="MSLFDTQYKGIQSVTQRYTLASRARSKMMRCASQGKGQDLDLRVL
FT                   VGHANLLDRVMESLHTEEEEEVSTSDEEEPVELGITSEVGSGHVTFALPQPLETVYECD
FT                   SDSDSDNDDEATSSDYDSDSDGEFSSDSDNESEDESDEEGFSNFGKSRNYTLTGSDAAT
FT                   TPVLRKHGGGNLYLFSLTGDGADTAERGRDLAARNGEAAGPRVLCV"
FT   gene            <51882..>53270
FT                   /locus_tag="KLTH0D00550g"
FT                   /old_locus_tag="KLTH-ORF12754"
FT   CDS_pept        51882..53270
FT                   /locus_tag="KLTH0D00550g"
FT                   /gene_family="HOG000243799" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12754"
FT                   /product="KLTH0D00550p"
FT                   /note="highly similar to uniprot|P07262 Saccharomyces
FT                   cerevisiae and to YAL062W uniprot|P39708 Saccharomyces
FT                   cerevisiae, GDH3 NADP(+)-dependent glutamate dehydrogenase,
FT                   synthesize glutamate from ammonia and alpha- ketoglutarate;
FT                   rate of alpha-ketoglutarate utilization differs from Gdh1p;
FT                   expression regulated by nitrogen and carbon sources"
FT                   /db_xref="GOA:C5DFW7"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW7"
FT                   /protein_id="CAR22309.1"
FT                   /translation="MSPIAHEPEFQQAYEEVVNSLKDSTLFDKQPKYQKVLPIVSVPER
FT                   IIQFRVTWENDKGAQEVATGYRVQYNSAKGPYKGGLRFHPTVNLSILKFLGFEQIFKNA
FT                   LTGQALGGGKGGLCVDLKGRSDNEIRRICYSFMRELSRHIGQDTDVPAGDIGVGGREVG
FT                   FLFGAYKSYKNSWEGVLTGKGLNWGGSLIRPEATGYGLVYYTQAMIDFATKGKESFAGK
FT                   RVAISGSGNVAQYAALKVIELGGTVVSLSDSKGSIIAQNGITAEQVEAITEAKVQFKTL
FT                   EQIIGEYSAFSNNKIKYLAGARPWVHVGEVDVALPCATQNEVSGDEAKALVAAGVKFVA
FT                   EGSNMGCTAEAAHIFEGERLSAKSASEPAVWYAPGKASNMGGVAVSGLEMAQNSQRMSW
FT                   SREQVDQELKKIMVNCFNDCLSTAREYTNEDNAEALPSLIKGANLVGFIRVADAMFDQG
FT                   DVWA"
FT   gene            complement(<53475..>55136)
FT                   /locus_tag="KLTH0D00572g"
FT                   /old_locus_tag="KLTH-ORF12749"
FT   CDS_pept        complement(53475..55136)
FT                   /locus_tag="KLTH0D00572g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12749"
FT                   /product="KLTH0D00572p"
FT                   /note="weakly similar to uniprot|P54862 Saccharomyces
FT                   cerevisiae YOL156W HXT11 Putative hexose transporter that
FT                   is nearly identical to Hxt9p, has similarity to major
FT                   facilitator superfamily (MFS) transporters and is involved
FT                   in pleiotropic drug resistance"
FT                   /db_xref="GOA:C5DFW8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW8"
FT                   /protein_id="CAR22310.1"
FT                   /translation="MKAFKLKNIFAKAEDRPTPPQIYNWRIYGTALVASTASVLIGYDT
FT                   GFVGGCFANKYFLANFGLVEGEARTDDTISNLISCFHAAAFFGALFSYPLSHYWGRKRA
FT                   LIIAAAVATVGAAVMLGSVTGHLAPMYIGRVFTGLTVGASTNLTVVYLSEVSPAPIRGQ
FT                   IIAAFEIGWRVGDLVGFWINYGINQHIAPGNKQWIIPVGVQVIPAALFFIGSLIMCESP
FT                   RWLFQMHRDQEAIKNLCFLRNLPDDDGYMIWEINSIRESIATQNEEIGPGLLDPAREVF
FT                   IRNRKYAKRLVISSILLVIPNFMGIQSINYYSPKIFSSIGVKGTNATLFSSGMFGVVKF
FT                   ICTFIYILFIVDNLGRRKAFLASASMCSLCFWYLGAYLKVNDPTKPGATPKPGGKAAIG
FT                   FMFIWTASFILAFSGGPFVWSSEVFEQNIRTFVQAINAAMSWVPIFIMTRLTTTMIDHM
FT                   KYGIFFFFAAIAALAIPFVFFFVPETKGIALEDMDQLFARGLPAYKAHKVVTSKSEDTV
FT                   LEIQNSASQFFSDQGSKKGTQKLVEDADVGESASKV"
FT   gene            <57414..>59309
FT                   /locus_tag="KLTH0D00594g"
FT                   /old_locus_tag="KLTH-ORF12740"
FT   CDS_pept        57414..59309
FT                   /locus_tag="KLTH0D00594g"
FT                   /gene_family="HOG000141798" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12740"
FT                   /product="KLTH0D00594p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DFW9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFW9"
FT                   /protein_id="CAR22311.1"
FT                   /translation="MDFQPKRKRSVHGCLTCRTRRKKCDENKPVCGGCERNFVQCTWPQ
FT                   HTGGRVRRKRGEAAELTSDRSSTSADPAAGQGFEFHIICGPRTPVFNRSGTLAFEAYSK
FT                   SSSNQLTKFDEDAGRFVATPQFAAETPEELTRWISCCGERQTTKQADAANNTQGTLDDG
FT                   SVETTLDMHMGGIAANVIGVPTGAIIVHASASADRLGWALQRDNWAYGQLLERYRKAEE
FT                   VTDEDLAGIDLREFLFYTCVKGFVPKLDTQYTHPSLTTGATFLPQADRNSIVRSVFACC
FT                   GATYLAWYDLERFQQLSDELYIDCKTQILEYVQSVDNYADEDWLFASLLLLCIRDKNSF
FT                   TGTVDGCVWHLANSFLIISEKYYHRAPAQSLDDPLSDNLLRESIVLQPQERMFLESFIY
FT                   HYSISLLFARDISALPNPCALFRSLSLVLKCPVYDIKGNNDWVSNPLLGLTLDAFEILA
FT                   KLSYIARMPMPLGPTWLGKVVHLKSLCTCYAPPAPTSPDMTEAEWLNYRVTSATGVLVT
FT                   KACDLLAKKIIDYDSFDIDSSDVQMRTREIIQLFKDLPSDHKIWGILPWTLLITGAFCR
FT                   RIEDQIFITRKIEIMAHRAHSYCGLKMSSFLHAIWNSEVGINYLFDRDRLAQVDL"
FT   gene            <59883..>61031
FT                   /locus_tag="KLTH0D00616g"
FT                   /old_locus_tag="KLTH-ORF12737"
FT   CDS_pept        59883..61031
FT                   /locus_tag="KLTH0D00616g"
FT                   /gene_family="HOG000294670" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12737"
FT                   /product="KLTH0D00616p"
FT                   /note="similar to uniprot|P39713 Saccharomyces cerevisiae
FT                   YAL061W putative polyol dehydrogenase"
FT                   /db_xref="GOA:C5DFX0"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX0"
FT                   /protein_id="CAR22312.1"
FT                   /translation="MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHE
FT                   YLDGPIFFPANGKTHAMSGQGLPQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCE
FT                   DRARWPDVKHEREGLCIACKTGNPNCCTDLGFCGLGCQSGGFAEKIVLSERNVVKIPNS
FT                   LPLDVAALVEPISVSWHAVRISKLQPGQTALVLGAGPIGLAAVLALQSHGAGTIIVSEP
FT                   ADTRRQKAEALGAQTFNPTEHGDNVIEALRKLAPGGEGFNFSYDCCGTSETFSAGLHTL
FT                   TPKGVAVNIAVWGPKPIDFYPMDVTTSERFVTGSICYTTQDFEEVVDAMDKGKIDINKV
FT                   KTMITGRERIENGFENGIMDLINNKEKNIKILLTPNNFKELA"
FT   gene            <61224..>61775
FT                   /locus_tag="KLTH0D00638g"
FT                   /old_locus_tag="KLTH-ORF12734"
FT   CDS_pept        61224..61775
FT                   /locus_tag="KLTH0D00638g"
FT                   /gene_family="HOG000094086" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12734"
FT                   /product="KLTH0D00638p"
FT                   /note="similar to uniprot|P39715 Saccharomyces cerevisiae
FT                   YAL059W ECM1 Protein of unknown function localized in the
FT                   nucleoplasm and the nucleolus genetically interacts with
FT                   MTR2 in 60S ribosomal protein subunit export"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX1"
FT                   /protein_id="CAR22313.1"
FT                   /translation="MAKKISKHSRAARRLEVEDVEAQTLAKLPRAQNLDLTNKLIRTAS
FT                   KNEQLLEAKMRKKEGSGKRVGKKSIAKGLPENLDKERLEKALNVTSRLDGKVQKAKSRA
FT                   KYVQNARKAGWDRTNESIKRDLALLTASKSDISSKDDKTAEDSMEQDEAYIDEDEGNSS
FT                   TPPQAEATNAFDLLTDDVEA"
FT   gene            <62142..>62582
FT                   /locus_tag="KLTH0D00660g"
FT                   /old_locus_tag="KLTH-ORF12733"
FT   CDS_pept        62142..62582
FT                   /locus_tag="KLTH0D00660g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12733"
FT                   /product="KLTH0D00660p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX2"
FT                   /protein_id="CAR22314.1"
FT                   /translation="MRTLEDITIGGSTYTMADKDALRLGETAQSIVNKIFSRFMLLDAL
FT                   FRGMVFGVGVLVVVFLTAVLLIKIMLASQENGKAKAKSGNRNTSPSSVDNAKSGDQKSR
FT                   NAKSSALNDEDHAHLLSRKVIPINSTDDFTEELEISVMEEDD"
FT   gene            complement(<63033..>64601)
FT                   /locus_tag="KLTH0D00682g"
FT                   /old_locus_tag="KLTH-ORF12730"
FT   CDS_pept        complement(63033..64601)
FT                   /locus_tag="KLTH0D00682g"
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12730"
FT                   /product="KLTH0D00682p"
FT                   /note="highly similar to uniprot|P46367 Saccharomyces
FT                   cerevisiae YOR374W ALD4 Mitochondrial aldehyde
FT                   dehydrogenase that utilizes NADP or NAD equally as
FT                   coenzymes expression is glucose repressed"
FT                   /db_xref="GOA:C5DFX3"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX3"
FT                   /protein_id="CAR22315.1"
FT                   /translation="MLSRTGTALRGMPVAATRLGMRFYAQLPLRVPVKMPNGIEYEQPT
FT                   GLFINNKFVRAKQGKTFEVVSPATEEEITHVYEAREDDVEDAIAAADQAFKSGVWSDAD
FT                   PLVRAKALNKLAELIEEDLETIASIETLDNGKAISSARGDVQLVANYLRSCAGWCDKID
FT                   GRLINTGSTHFSYTIRQPLGVCGQIIPWNFPLLMWAWKVGPALATGNTVVLKTAESTPL
FT                   SALYVSQFVPKAGIPAGVVNIISGFGKIIGEALTTHPKIKKIAFTGSTATGRHIYQNAG
FT                   ANLKKVTLELGGKSPNIVFADADLKATVQNIILGIYYNSGEVCCAGSRVYVEESVYDQF
FT                   LEELKAATENVKVGDPFDDATFQGAQTSQMQLSKILKYVEIGRDEGATLVTGGERLGNK
FT                   GFFVKPTIFGDVTEDMRIVKEEIFGPVVTITKFKTVEEVIEKANDSEYGLAAGVHTKDI
FT                   NKAIEVSNRVNSGTVWINTFNDFHHAVPFGGFNASGIGREMGIEALENYTQVKAVRAKL
FT                   TLSGK"
FT   gene            complement(<65886..>68045)
FT                   /locus_tag="KLTH0D00704g"
FT                   /old_locus_tag="KLTH-ORF12725"
FT   CDS_pept        complement(65886..68045)
FT                   /locus_tag="KLTH0D00704g"
FT                   /gene_family="HOG000144405" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12725"
FT                   /product="KLTH0D00704p"
FT                   /note="weakly similar to uniprot|P32336 Saccharomyces
FT                   cerevisiae YOR373W NUD1 Component of the spindle pole body
FT                   outer plaque required for exit from mitosis"
FT                   /db_xref="GOA:C5DFX4"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX4"
FT                   /protein_id="CAR22316.1"
FT                   /translation="MSSKSSPSKQLSESLGRFHISSPSKLKPYMENDKFQDKAFDSQGR
FT                   YPRNGRSYVDKLDSWSVNYGTVQQHGIDSENAELPQWKQYMQGQVVAEKGSQELHAPAD
FT                   LVVTSSLSDISLIPTNTFKKRGTRLPVDETHQLDPENNTTQEKDTELDIDPAREALGVF
FT                   NNVLRHQRSNFFNDDEHKLNSPVRSVSDGYETGSNSSFDSFDPSLSPSIRQSNKKQPHQ
FT                   PRNEARKESPRRPLKLITPEDAGMVFNYKEGVWDQPSATVDVSTSGAQDESSQSKIVSF
FT                   KLPRTRPETSMVDDTPLSTPKVDLKFLSRNRSGENTQVPAGVDKAVRRASRVTSLPADT
FT                   THNLVDNVTSVSDLDTSFRISRGAVVSALVDAIPRKENWVKVRDLSLERRDLESLVGLD
FT                   EMAPSVLELNVSHNKLNSLQGVPKHTISLCCSHNRIGTYCRLDALEHLEDVDMSHNALS
FT                   TNLSLFAACLHLRNINISQNGVTSLQGLSESRLRIDTLNIARNRLIGPLDFADLLSSDQ
FT                   EPNFLTHLRELDLSGNKITTVKNLHLLTGLRVLKLDGNPLETLVGNTNKSLRSLTALGC
FT                   AALRELGDFPQLRILKLSGESLQIQRLPESLEHLELTGITGASSSVMVPWNILPHMLRK
FT                   LRLSRLGFEELPPEFATHCPALDALIITDNELQSAANLFERLPVNLRTLDVRRNPLTQF
FT                   KAESERKMLAEAAAMAAPNLKKIFL"
FT   gene            <68287..>69699
FT                   /locus_tag="KLTH0D00726g"
FT                   /old_locus_tag="KLTH-ORF12722"
FT   CDS_pept        68287..69699
FT                   /locus_tag="KLTH0D00726g"
FT                   /gene_family="HOG000066011" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12722"
FT                   /product="KLTH0D00726p"
FT                   /note="weakly similar to uniprot|Q08887 Saccharomyces
FT                   cerevisiae YOR372C NDD1 Transcriptional activator essential
FT                   for nuclear division"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX5"
FT                   /protein_id="CAR22317.1"
FT                   /translation="MEPSNDEEAFFRVISENMKYAFTSPIATTTQFPTPYSQAHNNTSS
FT                   HTQETERARTHSESQSIVENSMLAESNGASSLSDVNVQPSSVLQLGNEFMLTSPEQFRE
FT                   FLFESPAGINLLHRTPAKTPLRFFNSSAIVSSAQSQSHQSQQNQGHLPQQATNGPLQNQ
FT                   ITPLRNIDVNLMFNSRNKQTNNTSSPSKRYLSLTPYGKRVLSDIGTPYAKLLASSNSAL
FT                   VDFQRARKDVQKSVGPQGSDLRSRGNSNTNKGLSGDLDVGSGHHKASLVSGSDDEIESG
FT                   ADDCGSSPTTIQLNSSVTKSTRDKLGSIGSIPENNITNSDLGPSSEDEHETNIDERLFE
FT                   MEKLPLSPTPKPSKRNDLDVTRIKIPELPKMGSFKSERSSSVPNTAKKTTRKQPKFQII
FT                   VTDANSFNSTRGTVMGGDAVGKKRKPALKRSQSEIVSTTSASSSRGKTKRQKLSQVHNF
FT                   SLDLNSRYPDSQ"
FT   gene            <70793..>73255
FT                   /locus_tag="KLTH0D00748g"
FT                   /old_locus_tag="KLTH-ORF12719"
FT   CDS_pept        70793..73255
FT                   /locus_tag="KLTH0D00748g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12719"
FT                   /product="KLTH0D00748p"
FT                   /note="weakly similar to uniprot|Q08886 Saccharomyces
FT                   cerevisiae YOR371C GPB1 Proposed beta subunit of the
FT                   heterotrimeric G protein that interacts with the receptor
FT                   Grp1p has signaling role in response to nutrients involved
FT                   in regulation of pseudohyphal growth through cAMP levels
FT                   homolog of Gpb2p"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX6"
FT                   /protein_id="CAR22318.1"
FT                   /translation="MQSGVSSFSGSSDNSQLSLNLQNNAPVAGNYGVPVWTKDHYKSQY
FT                   KAPPYLSNYVPGLRDASAQVSAERRKLDNEKALIAYYSSKIHVSRHDSIISGCSNPSVG
FT                   SDNSRRSARMKHALKSTHKTFGDHGSPLRCAHDESKYSPEVFSKGYLNYCSKLPLPVLE
FT                   STKLLKRHNMWIPMTRWDIRDKNSESEGPSLSHHDGNKEEDSRLFTDVKIHPADYPSNQ
FT                   NTFVGSMTIPPLFGEMKLPPFAYQCTVDLDDNIYTLGGLTSSYLYSDEAPDLSSFHVDG
FT                   VPNLPPPLLDNVVNNPCMVNNHDLYVISSSSSRVQKPTTTGQVPPPLLCMTGSVLTKRH
FT                   IFYYGGFEIKTETTVDEQTGKFFLKKRAYLHNTAYILDVVTFKFTKVELVAQPTKFNAY
FT                   PATVPRFGHAQVSVQLSPTTTLKCAACSASSSSESKTDESKPENIGASSPISQPLDLRS
FT                   QSETSLTAEKVINTKLSNSLNSGVFTVIVMGGYRQINEDEYETLNDLWKLEVTVTARGK
FT                   RNYFKFADTALATPFARVLNEHEGGTWPGARAFQACEVYDTELLKTYSSKPKLLENLRA
FT                   NFCIEPETLSPGVMSPGEKAPSLTRRSELYENHHIHAYGDSTCSGAWNHKSNANTQFTG
FT                   KTLLVHGGSDKEHVYGDMWWFDLDNEEWTLVPTYVKRTDSKCHSNEVQLPLVGHTLVRI
FT                   ASNAVLTGGLSQEDVDKLWSRNKTQSDPNPALPPSLTGALHLLDLSSLVLKPFLLGTDP
FT                   NEIQRARNIGWPEVLRFICAPGMHKNGFVYLVGGMMFNISKVEELYLRGTMTVFILPII
FT                   TTPKVVTI"
FT   gene            <74519..>76360
FT                   /locus_tag="KLTH0D00770g"
FT                   /old_locus_tag="KLTH-ORF12716"
FT   CDS_pept        74519..76360
FT                   /locus_tag="KLTH0D00770g"
FT                   /gene_family="HOG000248782" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12716"
FT                   /product="KLTH0D00770p"
FT                   /note="similar to uniprot|P32864 Saccharomyces cerevisiae
FT                   YOR370C MRS6 Rab escort protein forms a complex with the
FT                   Ras-like small GTPase Ypt1p that is required for the
FT                   prenylation of Ypt1p by protein geranylgeranyltransferase
FT                   type II (Bet2p-Bet4p)"
FT                   /db_xref="GOA:C5DFX7"
FT                   /db_xref="InterPro:IPR000632"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX7"
FT                   /protein_id="CAR22319.1"
FT                   /translation="MMGAERRTSMAERRPSTLNQSSFSMERRASSVVVPHLAGIEDPLP
FT                   DTTPDKVDVVVVGTGLVESILAAALAWQGSNVLHIDSNSYYGDTSATLTIDQLKQWVQD
FT                   VNQGSLKCYENAKLHISSVVGRGSYKSRDFGIDLSPKILFAKSDLLSILLKSRVHQYLE
FT                   FQSLSSFHTYENDSFERLTNTKQEIFTNPSLPLMTKRSLMKFIKFVLDWENQQEVWASY
FT                   RDKPITSFLVNKFKLERAQVYELIFSIGLCYNIDVKTPEALQRIRRYLTSFDVYGPFPV
FT                   LYSKYGGPGELSQGFCRSAAVAGATYKLNETLVSYDPESKTAIFGDGSRVTVTEKVVAA
FT                   PTQCPKNSRNVPEQMFEVQRLTCVVDKPCLEWFGEGEYAAVVVFPPGSLKSGNRQAVQA
FT                   LIMGAGSDVCPAGSSVWYLTSTESGPRGEMDLDAAFGALEESIIRESSADIENDSGILE
FT                   VDTSGHFTLNSVKLGQSFKEHISGESIQVLVKLYYKQLTSTPPFEVVDPSIFDVNDPAD
FT                   GVHKKLIPGASDNGVLYTALPSAEISYDEAVTAARVLFQRIVGSDDDFFDLDFEDEDDT
FT                   DQMNESAVVDDEDDRMDIGLNAEMSVEPVEFAGEMEI"
FT   gene            <76844..>77281
FT                   /locus_tag="KLTH0D00792g"
FT                   /old_locus_tag="KLTH-ORF12713"
FT   CDS_pept        76844..77281
FT                   /locus_tag="KLTH0D00792g"
FT                   /gene_family="HOG000210688" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12713"
FT                   /product="KLTH0D00792p"
FT                   /note="highly similar to uniprot|P48589 Saccharomyces
FT                   cerevisiae YOR369C"
FT                   /db_xref="GOA:C5DFX8"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX8"
FT                   /protein_id="CAR22320.1"
FT                   /translation="MSDVEEVQEVQEIQEVAVEQPTESITIEDALKVVLRTSLVHDGLA
FT                   RGLRESAKALTRGEAQLVVLVDSVTEDNIIKLVEGLANDPENKVPLIKVADAKQLGEWA
FT                   GLGKIDREGNARKVVGASVVVVKNWGADTEERQMILEHFSQ"
FT   gene            complement(<77439..>78620)
FT                   /locus_tag="KLTH0D00814g"
FT                   /old_locus_tag="KLTH-ORF12711"
FT   CDS_pept        complement(77439..78620)
FT                   /locus_tag="KLTH0D00814g"
FT                   /gene_family="HOG000000804" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12711"
FT                   /product="KLTH0D00814p"
FT                   /note="similar to uniprot|P48581 Saccharomyces cerevisiae
FT                   YOR368W RAD17 Checkpoint protein involved in the activation
FT                   of the DNA damage and meiotic pachytene checkpoints with
FT                   Mec3p and Ddc1p forms a clamp that is loaded onto partial
FT                   duplex DNA homolog of human and S. pombe Rad1 and U. maydis
FT                   Rec1 proteins"
FT                   /db_xref="GOA:C5DFX9"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFX9"
FT                   /protein_id="CAR22321.1"
FT                   /translation="MLDQNVLFSASTVHLEHITTALNCLTPFGLRDDVLIIIDSDGLSF
FT                   ARENNRVISIQLFLSKELFISYQYNAPESDSDAHTKISVKINHILDSISVASRDKDDVV
FT                   ECTLSYVGEGSPFVLIFEDSAITEKVEYSTYLTKEWDMTGLELDRSLVDLECMMKGDIF
FT                   YSALQDLKEIGCKECYIYARAGSSGKNIFAIISKSHLGFSKILLPSERSILEKLETFDS
FT                   DTHEKVHEKPVIGFFDFGSFDKMRASAKIASKVLIRKDAHGLMSVNILSETDDILRGDS
FT                   KTKSSASPANPHSSAYLSREYPGIVIDISILEKARVDYDDMEEVKLLMQNNDELKAPPA
FT                   YQPVSTGASRDPNPAAQESTSLLFNERKRHAEELDNGEDGEFIPATNDIPLFF"
FT   gene            complement(<79191..>79817)
FT                   /locus_tag="KLTH0D00836g"
FT                   /old_locus_tag="KLTH-ORF12709"
FT   CDS_pept        complement(79191..79817)
FT                   /locus_tag="KLTH0D00836g"
FT                   /gene_family="HOG000232113" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12709"
FT                   /product="KLTH0D00836p"
FT                   /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
FT                   YOR367W"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY0"
FT                   /protein_id="CAR22322.1"
FT                   /translation="MNSKHTGPSSYTAKADVTSLDQDLQELRRSKFSRESIDEISQWIF
FT                   GAVLKEPIPSDLLPALKDSTALCRLANALHEADAPNSGPLIKFKESRMPFVQMEQISQF
FT                   LSFARQYGVPEDELFQTVDLYEEKDPATVYQALKSLSRYANKKHPHQFPVIGPQIATKR
FT                   PRPPKAAKPKHLQSSGWSTLEYGYIKGANQSSEGVVFGQKRDITH"
FT   gene            <80807..>83134
FT                   /locus_tag="KLTH0D00858g"
FT                   /old_locus_tag="KLTH-ORF12707"
FT   CDS_pept        80807..83134
FT                   /locus_tag="KLTH0D00858g"
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12707"
FT                   /product="KLTH0D00858p"
FT                   /note="similar to uniprot|P39719 Saccharomyces cerevisiae
FT                   YAL053W Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY1"
FT                   /protein_id="CAR22323.1"
FT                   /translation="MRPALTGPMRVLFLVFVFLQFWVSPASASNTSRHLETTSLLTCMQ
FT                   NSQLTASFFEVKFYPSLNKVYFNIDATTTISTNITAEVQVIVYGLNLMERSINFCNLDQ
FT                   PALCPLQAGRIDVNSSFTVDSDITSNIPNVAYTVPDLDAQVRVVVYSTSDTDHGTPLAC
FT                   VVAPLGNGKTVQTKYAAWPIAAISGLGVLTSGFVSVIGHSTTAAHIASNSISLFIYFQN
FT                   LAITSMMGVSRVPPIAAAWSQNFQWSMGIINVKFMQDIFNWYIKATGGEPTVVVANKDV
FT                   LSIAVQKKRVKRALVEGAKHLYKRLTISTTDSMDLDSFLSEQGLYTGNERNSTNYASKT
FT                   LVLHGIQRVAYKAGIELSNLFLTGVVFTFFFVFIVVIALMFFKALVELLTRTRVMAESS
FT                   KFFEYRKSWGNIIKGTLFRLSIIAFPQLSILCIWEFTQRDSAATMVDAIVILITIGAVL
FT                   LYGVIKVVLRGRESARLYKTPAYMLYGDSNFLNRYGFLYVQFKADLYWWLMPLLGYSFL
FT                   RSLFVAVLQNNGKAQAMVTFIIEMVYFVAICWKRPYLDKRTNAFNIVIHLVNFFNALFF
FT                   LFFSGLFRQPQIVSSVMAVVLFVMNAVFALFLLIFTIVTCSLALIYRNPDARYQPMKDD
FT                   RVSFIPKIQTNGNASKSETELFELGKAVMTTNEASNISSDKSYRNQSSKKLLFDDEVDD
FT                   SSIFDDHSGAREKRANSGEAVQPSSAVLGPSTFGTYQKIPTAPSSRGAQNLRAPENTFG
FT                   NTSYQGYTGASSNPYSKNNPYL"
FT   gene            complement(<84021..>86015)
FT                   /locus_tag="KLTH0D00880g"
FT                   /old_locus_tag="KLTH-ORF12706"
FT   CDS_pept        complement(84021..86015)
FT                   /locus_tag="KLTH0D00880g"
FT                   /gene_family="HOG000215553" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12706"
FT                   /product="KLTH0D00880p"
FT                   /note="highly similar to uniprot|P39722 Saccharomyces
FT                   cerevisiae YAL048C GEM1 Evolutionarily-conserved tail-
FT                   anchored outer mitochondrial membrane GTPase which
FT                   regulates mitochondrial morphology cells lacking Gem1p
FT                   contain collapsed globular or grape-like mitochondria not
FT                   required for pheromone-induced cell death"
FT                   /db_xref="GOA:C5DFY2"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013566"
FT                   /db_xref="InterPro:IPR013567"
FT                   /db_xref="InterPro:IPR013684"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="InterPro:IPR020860"
FT                   /db_xref="InterPro:IPR021181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY2"
FT                   /protein_id="CAR22324.1"
FT                   /translation="MGKEQIKIVVCGDDGVGKTSLVACLVKDQFIQNLQNCLPPVTIPR
FT                   DFSSSPFCPKSSILVDTTSYDLPALHRELKSADVIWLVYSDHETYDRVALYWMMMFRSL
FT                   GVNLPVVLCKNKCDDFSVESEPKSSVLSPSDDSLSDSTKVEDEEFIPILREFKEIETCI
FT                   KTSAKDKFNVNQAFYLCQRAITHPIAPLFDSRVGELKPLTVLALKRIFLLSDKDQDGFL
FT                   NDHELIVLQKRAFGKAIDKSELEFIKETLLNLSMPPQEYGSYTLYIPDKGITKDGFLVL
FT                   NKLYSEKGRHETTWGILRAFHYTDSLSISDKVLYPKMDITDTASVELSPLGYRFLVELF
FT                   LTFDKDNDGGLNEQEIDFLFKTTPGIPRLWAETNFPFSTVVNSQGFVTLQGWLAQWSMT
FT                   TFLDHKTTTEYLVYLGIEKDARLALQITKSRKKRRRNGKFYRALVTDRKVFNCFVIGKP
FT                   FSGKSSLLESFVGRSFLESYSPTIRPRIAVNSLELKGSKQYYLILQEFGEQEPAILENV
FT                   EKMKECDVLCLTYDSSDPESFSFLFELINQHKHLQELPMVFVALKADLDKQQQRCYIQP
FT                   DDFTDQLYIDHPLHVSSVWSSSLNELFIKLTEASLEPSINTPGIAPDIVKEDINYWRYA
FT                   LVATSAVGFTSLFTFTFFKLFRSLRNEHS"
FT   gene            <86268..>87172
FT                   /locus_tag="KLTH0D00902g"
FT                   /old_locus_tag="Klth0D.mRNA.gf.353.p"
FT   CDS_pept        join(86268..86270,86342..87172)
FT                   /locus_tag="KLTH0D00902g"
FT                   /gene_family="HOG000091086" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.gf.353.p"
FT                   /product="KLTH0D00902p"
FT                   /note="highly similar to uniprot|P21242 Saccharomyces
FT                   cerevisiae YOR362C PRE10 20S proteasome alpha-type subunit"
FT                   /db_xref="GOA:C5DFY3"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY3"
FT                   /protein_id="CAR22325.1"
FT                   /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDG
FT                   IVLAVEKLVTSKLLVPGKNKKIQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYA
FT                   TPIPLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDDDGAHLYMLEPSGTYWGYKGA
FT                   ATGKGRQSAKAELEKVISNKPELDAREAVKEAARIIYLAHEDNKEKDFELEMSWCSISE
FT                   TNGLHKAVPKDLLDEAIAFAKAENGDDSDSDDSSDESENEKDNEKKDAEGDVQLE"
FT   gene            complement(<87310..>89439)
FT                   /locus_tag="KLTH0D00924g"
FT                   /old_locus_tag="KLTH-ORF12702"
FT   CDS_pept        complement(87310..89439)
FT                   /locus_tag="KLTH0D00924g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12702"
FT                   /product="KLTH0D00924p"
FT                   /note="weakly similar to uniprot|P39723 Saccharomyces
FT                   cerevisiae YAL047C SPC72 Component of the cytoplasmic Tub4p
FT                   (gamma-tubulin) complex binds spindle pole bodies and links
FT                   them to microtubules has roles in astral microtubule
FT                   formation and stabilization"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY4"
FT                   /protein_id="CAR22326.1"
FT                   /translation="MVPLRGNSVQDSSGCLSANNTRSSDEGSTGTMSEADELDIPQFNN
FT                   SMTPWRKRDVAKESIYHQGSSSVSPTVGASAENGDGFSEGPLNLASPVNSRPHTRSSLF
FT                   SDGYTSSVPTMSASSSNEVEQLQRQLTACKLRLRALAEVIKELNYDRESHHFDEFPNLP
FT                   CSAKLVDTLPSCDKCAKLSKDLAELRQNLEAKDKELLSAKNDYSTVLDDVNSYLEHSDV
FT                   IASNIDDILQVLSEKLDISDEEKEVLCKARGISNNFIDVKINALGSTVRKFLDTLSTAQ
FT                   IPEQFDKSLITVADNSQGNISQMDTRLESAIESMHEEYHNFLRSLQDRMDQSGETEKLL
FT                   GDKLMKQQLLLEKLTELFHGRSISGVTAGVLSMDIHASDRAKSPDTQGSSSQTFPAPNV
FT                   EIEEYKNRLEIQKNRVKELEEEIVAIEQRREKLDRGSAETGGVTEVEGRYKEKELEWMN
FT                   KIEDLMSQVSKSRTESQRLENVIAELQNELSAAQEESEKTIMDLEKTLKRAVRNSGLYM
FT                   GENREMQQHIKEIESELNSTIRHNSQLEESINEVTKDRSELENELLKLRSHLILHLNKI
FT                   FDVFDKILQRHSIDQAKKKLKNLDVLSSKNHHKAVHAKLESLYVFIESAINSIVEEHAK
FT                   LLLKEKKRSSHINVKDTEEGYGSQLHIELLERRWVAERERRKLDADAAEYRISQLEDEN
FT                   RALRLKIRERFGHSQ"
FT   gene            <89863..>92082
FT                   /locus_tag="KLTH0D00946g"
FT                   /old_locus_tag="KLTH-ORF12697"
FT   CDS_pept        89863..92082
FT                   /locus_tag="KLTH0D00946g"
FT                   /gene_family="HOG000265546" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12697"
FT                   /product="KLTH0D00946p"
FT                   /note="similar to uniprot|P06103 Saccharomyces cerevisiae
FT                   YOR361C PRT1 Subunit of the core complex of translation
FT                   initiation factor 3(eIF3) essential for translation part of
FT                   a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates binding of
FT                   mRNA and tRNA(i)Met to ribosomes"
FT                   /db_xref="GOA:C5DFY5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY5"
FT                   /protein_id="CAR22327.1"
FT                   /translation="MATSALEDIRIEDIPVDDVDFSDLEKKYEVESPVNFDNFVVVDGA
FT                   PVAPESKVPVLTKVLTKLFSQAGSVVDINLPLDEEKKTTKGYLFVEFDSPASARKAIKL
FT                   LNGKKLDVKHRLFVNSLTDVEKFGTEDFDTEFHEPKLPEFQKTDYLQSWLQDEQGRDQF
FT                   VLQKGELTGVFWNRNTQQPENAVEPRTNWSNTTVKFSPKGTYLFSFHNQGVASWGGRNF
FT                   ERLRRFFHPQAKALAISPTEKYLVTLSPEPIVVPEDAPEDFPFGPESNGHQLCVWDIAT
FT                   GLSVKTFALPPNQRLHWPMIKWSFDDKYCARLGPNALAVYDAENNFELLGGRIMKIEGI
FT                   QDFSFAPAGAKLAVNRNGELSSVLAFWTPESNNQSCKATVMEIPTRRVLRTVNLVQVSD
FT                   VTLHWQNQAEYLCVKVDRHTKSKKTFFSNLEICKLTEKDVPVEKVEMKDLAVRFAWEPK
FT                   GHRFVTISTTETADDNPSIPKNVVTFFAPEQKEKTNVAVKAEPKKWKAFASVPGKFSNT
FT                   ISWSPAGRFVVVATLVTPDTRKADFDFYDFDFTGDKNDNDSDDVAANLKAVAHPEFYSA
FT                   TDMQWDPSGRFVAVWSSAVKHKLENGYKVFNVAGECVREEMIEAFKNFVWRPRPESLLT
FT                   NGEKKKVRKNLREWSAQFEELDAMQADSAMRELILSRRSMLEGWTQYRQDRAALMEEEY
FT                   NYKVFDQVEHSTADEDYEVVEEIKEEILEEKEEEVTSFEEPTSSE"
FT   gene            complement(<92187..>92450)
FT                   /locus_tag="KLTH0D00968g"
FT                   /old_locus_tag="KLTH-ORF12693"
FT   CDS_pept        complement(92187..92450)
FT                   /locus_tag="KLTH0D00968g"
FT                   /gene_family="HOG000255169" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12693"
FT                   /product="KLTH0D00968p"
FT                   /note="highly similar to uniprot|P39724 Saccharomyces
FT                   cerevisiae YAL046C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY6"
FT                   /protein_id="CAR22328.1"
FT                   /translation="MLARVARRLLSFTPEEKLVYEKLTKQLKPQQIEVRDISGGCGSMF
FT                   AIDITSEKFKGLSMVKQHKLVNKVLQDDIKRWHGLQLRTRSE"
FT   gene            <92563..>92928
FT                   /locus_tag="KLTH0D00990g"
FT                   /old_locus_tag="KLTH-ORF12692"
FT   CDS_pept        92563..92928
FT                   /locus_tag="KLTH0D00990g"
FT                   /gene_family="HOG000255169" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12692"
FT                   /product="KLTH0D00990p"
FT                   /note="similar to uniprot|Q3E793 Saccharomyces cerevisiae
FT                   YAL044W-A Similar to pombe uvi31 putative DNA repair
FT                   protein"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY7"
FT                   /protein_id="CAR22329.1"
FT                   /translation="MLLLKTLARSMSTAANRSTSGPIAQSITNKVRQQFPDLQHFALFN
FT                   DSYKHAGHHGMAEAENRIESHFRIEVVSGAFEGLTLPKRHRLMYTLLDEELQKGVHALQ
FT                   LQTRTPAEQERKNQRAE"
FT   gene            complement(<93016..>93540)
FT                   /locus_tag="KLTH0D01012g"
FT                   /old_locus_tag="KLTH-ORF12691"
FT   CDS_pept        complement(93016..93540)
FT                   /locus_tag="KLTH0D01012g"
FT                   /gene_family="HOG000239392" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12691"
FT                   /product="KLTH0D01012p"
FT                   /note="similar to uniprot|P39726 Saccharomyces cerevisiae
FT                   YAL044C GCV3 H subunit of the mitochondrial glycine
FT                   decarboxylase complex required for the catabolism of
FT                   glycine to 5 10-methylene-THF expression is regulated by
FT                   levels of levels of 5 10-methylene-THF in the cytoplasm"
FT                   /db_xref="GOA:C5DFY8"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY8"
FT                   /protein_id="CAR22330.1"
FT                   /translation="MIRTCAQSTLRASSRLSAISPRLFLRAQSSNALTKTQPPFTFSKS
FT                   GPSSVKYTSQHEWIAAHQDGTAFVGITKYAADALGDATYIELPEADSELEAGDSLGSVE
FT                   SVKSASEVYQPLAGTVLEGNESLNDTPQLINEDPMGEGWIAKVRLNDLADMNGEELMSL
FT                   EQYEESLKEDH"
FT   gene            <94778..>96259
FT                   /locus_tag="KLTH0D01034g"
FT                   /old_locus_tag="KLTH-ORF12688"
FT   CDS_pept        94778..96259
FT                   /locus_tag="KLTH0D01034g"
FT                   /gene_family="HOG000066009" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12688"
FT                   /product="KLTH0D01034p"
FT                   /note="similar to uniprot|P06776 Saccharomyces cerevisiae
FT                   YOR360C PDE2 High-affinity cyclic AMP phosphodiesterase
FT                   component of the cAMP-dependent protein kinase signaling
FT                   system protects the cell from extracellular cAMP contains
FT                   readthrough motif surrounding termination codon"
FT                   /db_xref="GOA:C5DFY9"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFY9"
FT                   /protein_id="CAR22331.1"
FT                   /translation="MSSMATLFTVNSPELAPQLASRFKGHVVALTAVADLLARLYSDRL
FT                   SGADNYERDLYLVVYCEPKRSAQDASPPASSTLDTLSAAELAHLLEKQFPCFNLSVVTP
FT                   ERAVPAIAELDNYRAKYTQRLTRVTTWMYAKRHDPCSVNMYSMISHLTQVRHSNTEKPR
FT                   RSYARLISSSLDLRKLIQLPQGKSDDHYWKLLTTWDFCALSLSTCELIWCSYLILKKLA
FT                   IDADYVISDNDLFLLLLTLETSYHQGNKFHNFRHAVDVMQATWQLCCKLQLHFPKDASV
FT                   LLVCVAAIGHDLGHPGTNNALMCEENSPVAQLYQKASVLENFHTELFLDLLQDHWPQLL
FT                   EDRRNVISDTILATDMALHSQYIDQMDEAPSQQPTFLSLIIKAADISNVTRPLEISAKW
FT                   AVLITCEFNECAALVRELKEGSAEYDAYNTEYDQPLPESVDSILEKFPSIPKGQLIFIN
FT                   AFAEGLFAGLGDYFEELKFLHHNVQANKKFWEGKL"
FT   gene            complement(<97316..>98434)
FT                   /locus_tag="KLTH0D01056g"
FT                   /old_locus_tag="KLTH-ORF12687"
FT   CDS_pept        complement(97316..98434)
FT                   /locus_tag="KLTH0D01056g"
FT                   /gene_family="HOG000000803" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12687"
FT                   /product="KLTH0D01056p"
FT                   /note="some similarities with uniprot|Q08831 Saccharomyces
FT                   cerevisiae YOR359W VTS1"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ0"
FT                   /protein_id="CAR22332.1"
FT                   /translation="MFKEESMSFPPRVHSPVGMPRRAHPGAVLLSPQASAMNNSHSTGP
FT                   GNSGVSQLPLSPQLSSQHLSLNDLLDQQQNMLVDSQRAAAGPAVVSPMLQPSSSMFLDT
FT                   FTRPASSGAQVPAPQHNSMVNFAHDLNQLCSWMAMLSTSQQNSVMDNLLSSLNEEVLQH
FT                   TKLKLDSLISSGYISPSVRSPQVIAPMPDRGPTPQPLTLDSLLNNNMDHHMSRQWSPIP
FT                   QNPSNSQPIYDYINDLTHRPRSADPQLRRKMGSSGKPVQKKSPTQPKPNPHNGLSSPTG
FT                   SNGSSASSSMNPKTLTDPKLLNNIPAWLKSLRLHKYSDALSGKPWAELVYLEDDALESM
FT                   GVSALGARRKLLKAFAVVRDYKERGLIDANAY"
FT   gene            complement(<99148..>101307)
FT                   /locus_tag="KLTH0D01078g"
FT                   /old_locus_tag="KLTH-ORF12685"
FT   CDS_pept        complement(99148..101307)
FT                   /locus_tag="KLTH0D01078g"
FT                   /gene_family="HOG000115754" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12685"
FT                   /product="KLTH0D01078p"
FT                   /note="similar to uniprot|Q01329 Saccharomyces cerevisiae
FT                   YAL043C PTA1 Subunit of holo-CPF a multiprotein complex and
FT                   functional homolog of mammalian CPSF required for the
FT                   cleavage and polyadenylation of mRNA and snoRNA 3' ends
FT                   involved in pre-tRNA processing binds to the phosphorylated
FT                   CTD of RNAPII"
FT                   /db_xref="InterPro:IPR021850"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ1"
FT                   /protein_id="CAR22333.1"
FT                   /translation="MSSEVLQLAQARELAMDNKPGEMLPKVLDTAMALHRSSRSPSVEL
FT                   GRLCAKLFLDVASHEAVVSSEKPFLASQHLGELWKLCSSSTDHSTLRDGILGLSRCYDW
FT                   LFDLVAKTSNKELWETLCQFRSFVLSKWKTVYPLTPSEDSLQDHSRSLGVKLATVKFIS
FT                   TLVIVHTPGNSGISIASVPENHPVITGKSQLESGAKKLLGFLLSYLSEEPMMVASLFIG
FT                   VLNCLAFVMKRRPQATYHILGGLLRFNVDMKYQQNAESVLQYRLAKRFVERCYKVFVQF
FT                   GLKSQLIKNSGNMAQYHAKLSKISQTLHIIGEETKAKGIMNFDPKQVERKMPSRERAKY
FT                   VTALKASNQNSSSRNNSTQPRMSPDMQLLTELQKYTMSKNSSAGFFNTSPIAFDSTYAS
FT                   VYSLMNSKHSEIDVSKLSPAVMAKLCTECLYQTDTNKMISGLSIVASRYTDLMNKASQA
FT                   TDNKKRPLEADTVQQPSKKREVVKQPEDEELSEDEDKQEFTLGAPAPMSEEEKKQHFIR
FT                   IVGHIMAVKDSEEEPGASNEVPVNMLHKVRLLDWNNKTSWLTLLTRLASRGVSHNEEMS
FT                   NTARQAIYDYFIEDFGNRVAVVIEWLSEEWYYESLNNEKGETPVYDQWSLKILDALIPF
FT                   LEVSHRRLFIRLVSELPRLSQEHVDKIRSLCLDPLRGSLGFQSLKFMVMFRPPVKPHIA
FT                   KLLTSMKEQDESVREQCEAVLAKFY"
FT   gene            complement(<102765..>103181)
FT                   /locus_tag="KLTH0D01100g"
FT                   /old_locus_tag="KLTH-ORF12682"
FT   CDS_pept        complement(102765..103181)
FT                   /locus_tag="KLTH0D01100g"
FT                   /gene_family="HOG000142072" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12682"
FT                   /product="KLTH0D01100p"
FT                   /note="similar to uniprot|Q02516 Saccharomyces cerevisiae
FT                   YOR358W HAP5 Subunit of the heme-activated glucose-
FT                   repressed Hap2/3/4/5 CCAAT-binding complex a
FT                   transcriptional activator and global regulator of
FT                   respiratory gene expression required for assembly and DNA
FT                   binding activity of the complex"
FT                   /db_xref="GOA:C5DFZ2"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ2"
FT                   /protein_id="CAR22334.1"
FT                   /translation="MDPHPEEEEIDVFRNVGQGLVGPYREITIQYWQELINEIEMTNEP
FT                   GSPHQDDFKSHSLPLARIKKVMKTDEDVRMISAEAPILFAKACEIFITELTMRAWCIAE
FT                   EHKRRTLQKSDIAQALLKSDMFDFLIDIVPRNIE"
FT   gene            <103352..>103834
FT                   /locus_tag="KLTH0D01122g"
FT                   /old_locus_tag="KLTH-ORF12681"
FT   CDS_pept        103352..103834
FT                   /locus_tag="KLTH0D01122g"
FT                   /gene_family="HOG000234882" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12681"
FT                   /product="KLTH0D01122p"
FT                   /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
FT                   YOR357C"
FT                   /db_xref="GOA:C5DFZ3"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ3"
FT                   /protein_id="CAR22335.1"
FT                   /translation="MRQFQSFSSSIESSLPQPHKQQSSSEIYAEPENFLEIEVTNPKTH
FT                   FPHPDHRGMFTDYELICRTNVPAFTKRMSRVRRRYSDFELFRKCLLKELSLSSHPKIAV
FT                   PHLPGKILLGNRFNDEVIQERMQSLNKWMIAVAGHPLLQSGSKVLVRFVEDEKFTG"
FT   gene            <104099..>105307
FT                   /locus_tag="KLTH0D01144g"
FT   CDS_pept        104099..105307
FT                   /locus_tag="KLTH0D01144g"
FT                   /gene_family="HOG000210954" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0D01144p"
FT                   /note="similar to uniprot|P39727 Saccharomyces cerevisiae
FT                   YAL042W ERV46 Protein localized to COPII-coated vesicles
FT                   forms a complex with Erv41p involved in the membrane fusion
FT                   stage of transport"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ4"
FT                   /protein_id="CAR22336.1"
FT                   /translation="MKKSKLLSIDAFAKTEEDVRIRTRTGGLITLSCVVVTFLLLLSEW
FT                   FHLKEVVTRPQLVVDRDRHLKLDLNMDITFPHIPCYLLNMDIMDSAGEMQLEVLNKGWS
FT                   KTRLDPSGQVLDTKQFKPGKDVVDYAPEDENYCGPCYGARDQSKNDEVNVDERVCCQTC
FT                   DDVREAYAEKQWAFFDGKNIEQCEREGYVEQVNEHIEEGCRIKGMAKLNRIGGNLHFAP
FT                   GKGFHNIRGHFHDASLYQNSPSLNFNHIIHHLSFGKEVEDITGQGASTAPLDGTNVSPE
FT                   FDTHKHQFSYFAKIVPTRYEYLSGETVETTQFTTTYHSRPLKGGRDSDHPTTLHSQGGF
FT                   PSVYFYFEMSPLKVINKQQYAQSWSGFWLNCITSIGGVLAVGTVLDKITYKAQRSMWGK
FT                   KST"
FT   gene            <105674..>107905
FT                   /locus_tag="KLTH0D01166g"
FT                   /old_locus_tag="KLTH-ORF12678"
FT   CDS_pept        105674..107905
FT                   /locus_tag="KLTH0D01166g"
FT                   /gene_family="HOG000248760" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12678"
FT                   /product="KLTH0D01166p"
FT                   /note="some similarities with uniprot|P11433 Saccharomyces
FT                   cerevisiae YAL041W CDC24 Guanine nucleotide exchange factor
FT                   (GEF or GDP-release factor) for Cdc42p required for
FT                   polarity establishment and maintenance and mutants have
FT                   morphological defects in bud formation and shmooing"
FT                   /db_xref="GOA:C5DFZ5"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR010481"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ5"
FT                   /protein_id="CAR22337.1"
FT                   /translation="MAIQSQSTVSLPTSVTQSTQSLLNRKVSTEDSLYHICLTIQKRLE
FT                   LLPQIRPYLNLAHASSELLSERQALLLSQKQQLSQQHHRSVGSAMSGNSGAAGVKNGLD
FT                   RRISSLSASSFNEDPEASSISVEETVVTFSMGILPISMDCDPVTQLSQLFQQGSPLCII
FT                   FNAVKPQYKLPVVSSDDLKICKKSIYDFILACKKYFTFSDEELFTISDVFSNDTEHFIK
FT                   VLDVVKTLMDSAPQVLPQIPVEHIKWSNTDRGKVVREFIETERKYVYDLEILNQYRNQL
FT                   LQRGIINSEELYMLFPNLSDIIDFQRRFLISMEINGQVDPSKQRIGALFMHSKHFFKLY
FT                   EPWSIGQNAAIDFISSSFDKMAGSDFVIGNKLELQSFLLKPVQRLCKYPLLLKELLQQA
FT                   KDSANYKELELAWEISKSIARSINENQRRTENHEVVKKLYDRVVNWKGYRIAKFGELLY
FT                   FDKVAISTGNGNESEHEFEVYLFEKIIILFSELVQKKGNSISLKKKASSASTITLQHMS
FT                   GSGNNLNSHGSSGDSKLDLRGRIMIVNLNQVSPIDNRSLSIIWESPKEQGNFVLKFKNE
FT                   ETRDNWCSSLQSLLRQIRSESLKSSNSDRSSFSSNTYYPHYSMNSINSSQNRRISDVLP
FT                   KQHTHQSFENEYRSISENYRTSIPESTLLVRISYQNDFYTVLVEVDSGIDNMLQIVKRK
FT                   LTHVGNISKIKYQDEDGDYVMLESEDDWNVVKDMLRESSERILNVWAHA"
FT   gene            complement(<108037..>109977)
FT                   /locus_tag="KLTH0D01188g"
FT   CDS_pept        complement(108037..109977)
FT                   /locus_tag="KLTH0D01188g"
FT                   /gene_family="HOG000259450" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0D01188p"
FT                   /note="similar to uniprot|Q08822 Saccharomyces cerevisiae
FT                   YOR356W Hypothetical ORF"
FT                   /db_xref="GOA:C5DFZ6"
FT                   /db_xref="InterPro:IPR007859"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ6"
FT                   /protein_id="CAR22338.1"
FT                   /translation="MLKSRLLRLGQRFPTNRRAIASALPCFKTCCNVKPQVSYRRSFST
FT                   TTVKRQSVEVPFGKLTDEEQAALSEERAVDKVDVCIVGGGPAGLATAIRFKQLDNLQGT
FT                   GELRVVVLEKSPDMGSHMVSGVIMEPRALRELFPESEFYDESGNGIPLPPSLVTPVASG
FT                   QLKYLIGDFDLPVPEPPQMKNEGNYIGSLSQVVRYLAEKAEEVGVEIYPGISVSEVVYN
FT                   DEGTAVVGVATKDMGISKEGKPKPSFERGMEFHARQTVFAEGCHGSLTKQIIKKFDLRK
FT                   GRANQTYGLGIKEVWEIRPENFQKGFASHTMGYPLSNEVYGGGFIYHFGEGLAAVGLVV
FT                   GLDYRNPYISPYQEFQKMKHHPYYKKFLEGGKCIEYGARALNEGGLQSVPKLNFPGGVL
FT                   VGASAGFMNVPKIKGTHTAMKSGMLAAEAMFDSISKIPSIAELEERGIEKVVESPINLN
FT                   SYEKAFKNSWVYDELYEVRNIRPSFNHALFGRLGGMAYSGIDSLLLRGQVAWTFNHHES
FT                   DAFLTDPAEKYEPIDYPKPDNKISFDILTSVSRTGTFHNEDEQCHLRLPDQDLQKHAEK
FT                   AYPKWKGIESRFCPAGVYEYVPDETSPLGVKFQINGQNCIHCKTCDIKVPTQDINWVVP
FT                   EGGDGPKYTLT"
FT   gene            complement(<110551..>111846)
FT                   /locus_tag="KLTH0D01210g"
FT                   /old_locus_tag="KLTH-ORF12674"
FT   CDS_pept        complement(110551..111846)
FT                   /locus_tag="KLTH0D01210g"
FT                   /gene_family="HOG000000802" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12674"
FT                   /product="KLTH0D01210p"
FT                   /note="similar to uniprot|P41913 Saccharomyces cerevisiae
FT                   YOR355W GDS1 Protein of unknown function required for
FT                   growth on glycerol as a carbon source"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ7"
FT                   /protein_id="CAR22339.1"
FT                   /translation="MALTNSRPLQMPALENEALHNSASPVFQPSSLRSSARSSCSESTS
FT                   EMDHALSTSDTSEGASDTRLTRKDVLALKRSATASPLTPTGAVSELSKLVPVTGQRPKP
FT                   TKKDLFMDDDILLAIFVILYEKDPNQEGVTVKQLCDYLVDKHPDMAGASTKLSNLISAK
FT                   LNAYVKKVEKGEKTLKYALSRQWSEGSPRRMVYVYRGILAPDYKSHTQSMSSQRQDAKQ
FT                   TGKSTTSSSKKAHGLSNNATDANMDYSLTESKVSNQAKGTFSINNNSFTINSFGSDFNI
FT                   PYAASPVTMRMMPNLAPNAFQDDQLSKAARDRRPKTSLSGPPSKKPNLQASPVVPPYIT
FT                   AAAAAPRLSKGVPKRNAASGELLNAAASSIQKLTAFPKQGEASCITDIALVPLAPTTTC
FT                   PSWLQTIQSGFLLEDIESPEAVSLEDLDGLLG"
FT   gene            complement(<112790..>114400)
FT                   /locus_tag="KLTH0D01232g"
FT                   /old_locus_tag="KLTH-ORF12670"
FT   CDS_pept        complement(112790..114400)
FT                   /locus_tag="KLTH0D01232g"
FT                   /gene_family="HOG000248762" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12670"
FT                   /product="KLTH0D01232p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ8"
FT                   /protein_id="CAR22340.1"
FT                   /translation="MSKRPLNTNVIDGSKRPSSLNSEICNSYPGYCPGFGSVTVDEINV
FT                   PSSKEEIDLFYQNYVLRRRPCKFKGVSSKEVLSEPLSPLNLVKTLPEQTILQVERKVQG
FT                   GFGSGEKRLKMTLGELVERLRSGDEQLYLTTQYAEDDPDRDDASDVGENTEEYAEDDDD
FT                   NEDDTKETDGGFGSAGDISDAGSFDFSNAHDDFEDLNGAESMDGESHDSKDVIAQLSTG
FT                   PLTQFEADARVKELYQPPMDNLIEQLPETPSFLNSLIPQQINLWVGSSGNIGSSDKFLE
FT                   GFDPSAPKLGLGRAIPGGGSSSGLHHDHADNIYVPISGRKRFTLFSPRDAAKMYTVGTI
FT                   RKVYDSGVIDYARCETAPFWRTLRDDGAIEAEVAKNELEFNSSLTADQRQNLERVIEAD
FT                   SVCSSSIDSKLDPPSFSSIIPTVVHLDKVKDEGLRAEIKKVALEKWPMFFEANRLTVDL
FT                   RPGEMLYLPTGWFHEVTSFGNEQTASADDRIHVAVNYWFIPPNGSSQDQLYAHEDQYWQ
FT                   KDYERTKAALEHARFCSKD"
FT   gene            complement(<115317..>116630)
FT                   /locus_tag="KLTH0D01254g"
FT                   /old_locus_tag="KLTH-ORF12667"
FT   CDS_pept        complement(115317..116630)
FT                   /locus_tag="KLTH0D01254g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12667"
FT                   /product="KLTH0D01254p"
FT                   /note="weakly similar to uniprot|P13365 Saccharomyces
FT                   cerevisiae YAL040C CLN3 role in cell cycle START involved
FT                   in G(sub)1 size control G(sub)1 cyclin"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/TrEMBL:C5DFZ9"
FT                   /protein_id="CAR22341.1"
FT                   /translation="MPESTLAEMAAVRLSVWNSRAAHPRVVQMELLAHQLACQDYSVDI
FT                   LRHLIDIEQASRPCLASFQAQPEINVHMRTLIFDFAMCCHTRLGLSTSTLYLCFSVIDR
FT                   YCSRIVVKSSTYQLVALCGLWLASKYIDRKPRVPSLRALQNLCCNQYSRSQFQDMELHI
FT                   LKALNWSPCNAPPHDVFVDILLKNKISSLSYKGLHLNDLKYGSCMLCELACFEHVLAFD
FT                   YNASAVALAAVTITTHALRLSVDGQFVHYSSMLKDANLQRVCDLILRKLRSRNFPSSFK
FT                   LKYLGQNKLESNPILRSLLEYELMIAPPIPVQAVKKPAYASFSPSKPGSCANVSPAPSL
FT                   GFQDSFAGTSFRSPRVVAPPTPCSPSNLSSNSVPKVKTPHLNLSPGTIGSGKQYEVSQA
FT                   RATAVRPTMFRRNESKRNSDIMEPDFFDMAANSNKRAR"
FT   mobile_element  complement(118691..120631)
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLTH0D01276s"
FT                   /old_locus_tag="dnatranposon.8"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            <122364..>124418
FT                   /locus_tag="KLTH0D01298g"
FT                   /old_locus_tag="KLTH-ORF12648"
FT   CDS_pept        122364..124418
FT                   /locus_tag="KLTH0D01298g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12648"
FT                   /product="KLTH0D01298p"
FT                   /note="weakly similar to uniprot|Q08818 Saccharomyces
FT                   cerevisiae YOR354C MSC6 Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to
FT                   mitochondria msc6 mutants are defective in directing
FT                   meiotic recombination events to homologous chromatids"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG00"
FT                   /protein_id="CAR22342.1"
FT                   /translation="MIPRSIKSNSALSIRARLRARWNSSAAAPAPAVHPVSQLSREVSK
FT                   ELTDRRSSLAAFDLFKTKVNDLSQTLSNSQYTLQRSFGLNSALTQLLQASKAELAGRAG
FT                   SGGPAADSGRQLPPDPFEILTVMCEYGLARDAHFQVVLEHLVAANRPQEVLGLWVKYLE
FT                   TLAENPKAVTYGSHHANNVALASVGYLQLPGNSPKLAELAQILNLAEKEDQIPILRIRY
FT                   LVDTLKLGSAVRSSVIENFGALLLEFSHACQAEFRRQLLSMEQVADLQKLFTALTSAAE
FT                   KSSQGLDASNVALFMDAFIGCKKPQQAIKCFNVAKEKNCVGEPVKNSLLIAVANLPVYG
FT                   KDMRDQKAKRIEAVWNSYISEAPEKISVSSYTALLAALGESRNFNKLQQLWSSEIPKEL
FT                   KSDQDLLETHLLFQCYKRDFSFEKMRDQIPEKLRSIKLANEILFKMAQEKVPENVITEF
FT                   YRQQFVDASAPLKPDSKSLALKMYINFLYTKDPEFQFMKSISKSKNDVNTTNLIFKRFV
FT                   EFCPDIEITKKLFDEIKYPLDSRKYGYMITAESRAGDITACEEIFKKFVQETKNPSTIT
FT                   RAILDPIVDAACEQCVAEKSAASLEKAHIYATFAKKAQKMLSFQSASKIIHTLALLVRS
FT                   LDGKLSPQQDEAVKKLLEDVHSVKNFSPSTRDLETLTRHKVSLPDGMQQ"
FT   gene            complement(<124574..>125463)
FT                   /locus_tag="KLTH0D01320g"
FT                   /old_locus_tag="Klth0D.mRNA.2976.m"
FT   CDS_pept        complement(join(124574..125362,125428..125463))
FT                   /locus_tag="KLTH0D01320g"
FT                   /gene_family="HOG000170352" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.2976.m"
FT                   /product="KLTH0D01320p"
FT                   /note="similar to uniprot|P06182 Saccharomyces cerevisiae
FT                   YAL039C CYC3 Cytochrome c heme lyase (holocytochrome c
FT                   synthase) attaches heme to apo-Cyc1p in the mitochondrial
FT                   intermembrane space human ortholog may have a role in
FT                   microphthalmia with linear skin defects (MLS)"
FT                   /db_xref="GOA:C5DG01"
FT                   /db_xref="InterPro:IPR000511"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG01"
FT                   /protein_id="CAR22343.1"
FT                   /translation="MGWFWADSGKNSTSGNKITDKPSECPLGHSTSKVTSGADGCPVLH
FT                   GSNAQNEINPFNNMPKNLSHEKHIGQKLELPKDRTTSSIPKGNPGEEEFWEYPSPQQMY
FT                   NAMIRKGKIDPNTGEEIPEDAVESMVFVHNFLNEGCWQEILDWEKKYSEQTEMEPKLLQ
FT                   FMGKPSQLSPRARCFSILGTLFPSKFSAELPFDRHDWVVLRPDPTSSDTKNPGFRQVRY
FT                   VIDFYGGPDDEDGLPTFNLDVRPALDNFTNAKDRFTRWTEPIIQEYFGSDKK"
FT   gene            <126137..>128377
FT                   /locus_tag="KLTH0D01342g"
FT                   /old_locus_tag="KLTH-ORF12638"
FT   CDS_pept        126137..128377
FT                   /locus_tag="KLTH0D01342g"
FT                   /gene_family="HOG000141967" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12638"
FT                   /product="KLTH0D01342p"
FT                   /note="similar to uniprot|Q08817 Saccharomyces cerevisiae
FT                   YOR353C SOG2 Protein required for cell viability"
FT                   /db_xref="GOA:C5DG02"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR019487"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG02"
FT                   /protein_id="CAR22344.1"
FT                   /translation="MNCHEHTWSPYSSHQRNQAKGYVRTALSFGLMDGRGDILSNLRQN
FT                   VDRRNNLAFLASKQVSQRDPTIKLIDLGITSLTQETIDLLLSVERLSLQKNLLTSLPEG
FT                   FNKLAELRYLDLHDNKLQEIPATLMQCQRLEILDLSSNYITHLPHEYSRVWCENIKVLS
FT                   LKNNSVSSIRELYPAIMSLRSLKILEIEGNQFPAEELEQIKSEVPPSSLPDSVSPDEYW
FT                   CVALRKHFSDNKISKAAKRRGFINVSEEQHRQEELYSNNKYNDYFKRLSVLPEETTSQR
FT                   VTQDELVVACRKLLFSFTECQQSIRKITSLCEDKAVAVNSVSLLYSVRSHIDNLVELLE
FT                   QSESPTSAKNDVMVKLCLTIISIFKQIFALLRKNFKSFFQGNDICFARIFYMNILCSYT
FT                   EMYNAWSQITPQDSIAPVKKRIARTHSLSVSQGFKHITPRSRSNTLQRSATGNSAHPTT
FT                   SPIPQSSNLRSAPGSVMTTPPPSQSNLAGEVRAANDGSPSFKPDLTQQSPHAGRRAADV
FT                   PPQAGTPAVPVVDNKMGPEDQGSADIDAQLYHTLNTVISMVTVVYSQLTSAITKSAIAS
FT                   TKTTEMSSITSSIAAKIKDLTDTCFQSMELSKLLKGRLSDVSLGKSEVFSTTAEKAKTW
FT                   ESINAFLKSIISILANTKIIMKDLPILNEVRPNLASLAKITKDVTVILDLSSYRSISQA
FT                   AQQQSQETATVKQQSHPQASGMLEESHNPILVTPLSTPSLVTVHASNPFDQF"
FT   gene            complement(<128407..>129288)
FT                   /locus_tag="KLTH0D01364g"
FT                   /old_locus_tag="KLTH-ORF12635"
FT   CDS_pept        complement(128407..129288)
FT                   /locus_tag="KLTH0D01364g"
FT                   /gene_family="HOG000141966" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12635"
FT                   /product="KLTH0D01364p"
FT                   /note="similar to uniprot|Q08816 Saccharomyces cerevisiae
FT                   YOR352W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG03"
FT                   /protein_id="CAR22345.1"
FT                   /translation="MIKTPDTPEHTGANEELNVDEIHEIDENDVEDLDLGYGNEDEQQN
FT                   DRSSLKREASTDDDIVFDQKDEFVPQVNISSPFSSTANITRLRDSHSSAQGRLSMSQQS
FT                   KFVSYCDDRLMEIQRKFVQSRGLAEENGYRELSPLLQDLKSLLDFIWYSIEGIPNTELL
FT                   LKQNLDDMLARQFANTRSTNFGQTYYLIRVADDFLDYLTKFDLTHLKVEEQQKTVAKVF
FT                   KFLMILDKVFAKCLEGLIPGNLKMNGTEMVRISGIAERTRMVLPQYLEQQKIHGYHYEV
FT                   SKVYEETLERCA"
FT   gene            <129448..>130974
FT                   /locus_tag="KLTH0D01386g"
FT                   /old_locus_tag="Klth0D.mRNA.58.p"
FT   CDS_pept        join(129448..130053,130132..130974)
FT                   /locus_tag="KLTH0D01386g"
FT                   /gene_family="HOG000066008" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.58.p"
FT                   /product="KLTH0D01386p"
FT                   /note="similar to uniprot|P24719 Saccharomyces cerevisiae
FT                   YOR351C MEK1 Meiosis-specific serine/threonine protein
FT                   kinase functions in meiotic checkpoint phosphorylates Red1p
FT                   interacts with Hop1p required for meiotic recombination and
FT                   normal spore viability"
FT                   /db_xref="GOA:C5DG04"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020647"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG04"
FT                   /protein_id="CAR22346.1"
FT                   /translation="MAVNTFESLRGQVLGVLEPLPVYRNQDVNENFAAVPIFKNKLVKI
FT                   GRNSRECDIIFPHPSISSIHCMFWAIRFDDDSVPMHYVKDCSLNGISINGLLLKRGQTC
FT                   LLEDEDVIAIPNACEYRFQAKIKMLTSDLIEQLGFQVNVENWRLTSKVVGSGTFGHVLV
FT                   ANEKAEPTRHQPRSYAVKIIKMKPNRLDKEAKILLRLDHPNVIKVHMTFSDDRNHLYIF
FT                   QDLITGGDLFSYLAKTDCLSPIPETEALVIIFQILHALKYLHSQGVVHRDLKLDNILLC
FT                   TPEPCTRIVLADFGIAKDLSTKHSRMHTVVGTPEYCAPEVGFKADRAAYKEFSRAATME
FT                   QHGYDAKCDLWSLGVIAHIMLTGISPFYGDGSEASIICNAKIGNLDMSTKQWTKVSEHA
FT                   KSFVRSLLETNVTKRLDSSRSFQHPWIAKHKGHLEKIYQKKIIPDSEPRQSFEETNWKR
FT                   KLPKSVKLSPTSVMNKKARKLELS"
FT   gene            <131435..>133357
FT                   /locus_tag="KLTH0D01408g"
FT                   /old_locus_tag="KLTH-ORF12631"
FT   CDS_pept        131435..133357
FT                   /locus_tag="KLTH0D01408g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12631"
FT                   /product="KLTH0D01408p"
FT                   /note="weakly similar to uniprot|P24720 Saccharomyces
FT                   cerevisiae YOR350C"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG05"
FT                   /protein_id="CAR22347.1"
FT                   /translation="MLKKKGAPLSLQNFAAKILGGDKLVKQLENGSLKTASTKALSRSD
FT                   VWLREALVNTATTRRSYTLPHSGAIYPSRSIDVSLNVILSTLRRLRFANDAGGYFILLN
FT                   RIKSSRVRWVSSSGKPIAGNVPVELYREVSHMLRAKSSGFQREELVCLAKFTLKLLRDY
FT                   NEIVAFRRPLKPDKIFLRNCADIVTRLGSMTFLNAFNNLIEHEDIKVYAMISFYLQTKQ
FT                   IAHLVQFLESSNLGRDSLGLELASSLLLHCIREFVTLGLEDIACSTLELLLKKCALDLE
FT                   KPLNDVKLIAEKFGAFKVQLAINKANDPELRSAFVPWKTFQKDLSFKDYINLFDESEID
FT                   FYNETASMEFLSSKLPHHRMALEGWYHLFEETRPHPTASASLKAFHFNTILSTVASTGS
FT                   LGLVTLFWRHSIVKLGLTEDFLNSHNLISSRNCGGFHVILRSVGKSSSAKLAGYQLFNF
FT                   LKHDFKKLTSNHGVATFNLTNKDYFYLMQSATRGPNVSSVYFYLFHHLLDAGDTCFSFG
FT                   KDGSPSWQPGEPILSLIKSKFSKDWHLTGVGKIVERVGTWYKNEKDRGVYSSHIQKDVL
FT                   VDIFGPHFIQELSPKTLLQLESDSNNAMDAKSSSVYSLIADCENTERIKETLGHLTQSI
FT                   KGKLD"
FT   gene            complement(<133354..>136428)
FT                   /locus_tag="KLTH0D01430g"
FT                   /old_locus_tag="KLTH-ORF12630"
FT   CDS_pept        complement(133354..136428)
FT                   /locus_tag="KLTH0D01430g"
FT                   /gene_family="HOG000144406" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12630"
FT                   /product="KLTH0D01430p"
FT                   /note="weakly similar to uniprot|P40987 Saccharomyces
FT                   cerevisiae YOR349W CIN1 Tubulin folding factor D involved
FT                   in beta-tubulin (Tub2p) folding isolated as mutant with
FT                   increased chromosome loss and sensitivity to benomyl"
FT                   /db_xref="GOA:C5DG06"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG06"
FT                   /protein_id="CAR22348.1"
FT                   /translation="MEPQNAESILESIEEGVCGLGPLPELLKAIDQFQQDPSILEDRLS
FT                   EFITKLVDGFFTCRSEDQHRCSQVFYTFSKVCGIKKVMNHLSTDIFLLPKILEKLKDSG
FT                   DWQDSYLLLAWLKMVLMSPFKLENDSQIYKMTGKFKSLQALHPLVSAVHAELFAKNIGL
FT                   FRSSFSNETSDLYTVNFTLKAVLRQGQVHERQAVLDSAALNNLTSFCIDNADSANEIKL
FT                   KLTFKTLPKLCKLHAAHRNWEAIEEIASWLLDSFNVPFTELRFQLAHNFAKIMELLMAL
FT                   DPESASSLIESIVHDARHTLSSNPTNTIDEDTLHTQLLVIAESSRIKLLNPELVKLVTE
FT                   SIVPITIKFQQTKVNKISGHQIRDATNFVCWSLARNCDINSESENLFLNSLICSLLDRD
FT                   LLIRKSSAAALQEILGRYGNTLLERENVMRVIELPNKNLETSYLQSVPQLFKIFKEEDS
FT                   RYSNALLDWLLDYNVLQSNDLHIVKLTCGLIRILLEKQDANYLPDCFWNRVSESAALVF
FT                   KGNDALRKCCFSYLATEAQLLKNDTVRKCCSEWLPSLLAVLSPRSPNPSERFKTLCVLK
FT                   MLRSFSIENTGSFQIDVHTLDILFQIVRHRSISDRDYNEVKMCFVSLVSILSCKKGETK
FT                   VTTIVDSFKQKFETLIRQNNPLCCAGLAYIDPDQFIKVFRELCPHMDCEARREVVSGIS
FT                   DRLLSIEAPRVLSILTATVDLLDDYTVTDRGDVGSLVRNSVVELIERHRDVFMQIDPAL
FT                   KSTVCSKLLRIAAEPNEKLRQKSFQVLTRGHDLNQGDSHDSAILNFFQKYYQDKDTEFW
FT                   VGFMFSAGAMYSTDQLIRTSIDSFLKFYEALSKERKLNLLNHLMRILPSFSEIEAWQAS
FT                   KEHRNALGCQKKDLVKQALASITFWRRIFESGMDVDPAFNATGAYAKFYNLHLIKKFAP
FT                   LKLAVVRLMPFIAISFKRRAPHEDRMFANIVLKRLKTLACGAKSKSQKLTQIQAMSLEG
FT                   MVIIYLAFGDDKKVIELEEVSREGPKSLLTFQESI"
FT   gene            complement(<136785..>138086)
FT                   /locus_tag="KLTH0D01452g"
FT                   /old_locus_tag="KLTH-ORF12628"
FT   CDS_pept        complement(136785..138086)
FT                   /locus_tag="KLTH0D01452g"
FT                   /gene_family="HOG000165354" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12628"
FT                   /product="KLTH0D01452p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DG07"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG07"
FT                   /protein_id="CAR22349.1"
FT                   /translation="MSFGKSFRSHFPFLDPSVTPVNHGSFGLTPGCVIEQQKRVSEAHE
FT                   SYSDRFHFSDAEHLYARQIQALARYLRLDPRNLALVTNATCGVNTVLRSIKWDFSRDKV
FT                   LVHSTSYTSCANTVKFLADYYGLQYDVVKLDYPIEDSDLLTRFHEKLATGNYRLCMFDL
FT                   ISSMPGVMLPCEQLIQLCKQHDVLSLVDGAHGAGLVDLQFLDTLQPDFFTTNLHKWLSA
FT                   PKSCGLLYVNPKHHSTIQTLPISWNYSNQNCQYIPNPTTAEDRLQNENLMHNKFWFVGT
FT                   MNYAQYFSIEEALKFREETCGGEDRIREYQWQLQREAVPLIVAEFGPGARLLQNSTNTL
FT                   AVAGMFNVNIPLPEKYSALKQKLASDPYYFMDFKQKCFALMFSRKAFLPFIYHNGELWV
FT                   RFSVQVYNELEDYKIGARSIKSAVMEVLDAEHGA"
FT   gene            <139116..>140990
FT                   /locus_tag="KLTH0D01474g"
FT                   /old_locus_tag="KLTH-ORF12623"
FT   CDS_pept        139116..140990
FT                   /locus_tag="KLTH0D01474g"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12623"
FT                   /product="KLTH0D01474p"
FT                   /note="similar to uniprot|P15380 Saccharomyces cerevisiae
FT                   YOR348C PUT4 proline-specific permease (also capable of
FT                   transporting alanine and glycine) putative proline-
FT                   specific permease"
FT                   /db_xref="GOA:C5DG08"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG08"
FT                   /protein_id="CAR22350.1"
FT                   /translation="MKNLKCLASYRPPASYCKDTPVRLEPLRIVSAAAPTTFFHHLASY
FT                   RHLNLAMSTPRDLKDAGETSIVDKQTGQVFELDTESLSALNTSGSPGSGAAAAGAEANG
FT                   LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGE
FT                   MVCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWT
FT                   TAVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPT
FT                   HDRLGFRYWQHPGAFAYHITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR
FT                   RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNA
FT                   HIKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVA
FT                   LSAAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYERV
FT                   PFKSPLQPYGTYFFIVVVSLICLTNGYASFVNWNASDFVAAYITLPIFVVLWVGHKIYT
FT                   RTWSTWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKFEQWLL"
FT   gene            <142438..>143943
FT                   /locus_tag="KLTH0D01496g"
FT                   /old_locus_tag="KLTH-ORF12621"
FT   CDS_pept        142438..143943
FT                   /locus_tag="KLTH0D01496g"
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12621"
FT                   /product="KLTH0D01496p"
FT                   /note="highly similar to uniprot|P00549 Saccharomyces
FT                   cerevisiae YAL038W CDC19 Pyruvate kinase functions as a
FT                   homotetramer in glycolysis to convert phosphoenolpyruvate
FT                   to pyruvate the input for aerobic (TCA cycle) or anaerobic
FT                   (glucose fermentation) respiration"
FT                   /db_xref="GOA:C5DG09"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG09"
FT                   /protein_id="CAR22351.1"
FT                   /translation="MESRLGWLSNLQTDTGSNLRRTSIIGTIGPKTNSPETLVALRKAG
FT                   LNIVRMNFSHGSYEYHQSVIDNARKSEELYPGRPLAIALDTKGPEIRTGTTTNEVDYPI
FT                   PPNHEMIFTIDDKYAKSSDDKIMYIDYKNITKVIEKGRVIYVDDGVLSFEVLEVVDDKT
FT                   LKVKSLNAGKICSHKGVNLPGTDVDLPALSEKDKADLRFGVKNGVHMVFASFIRTANDV
FT                   KTIREVLGEDGKDIKIIVKIENQQGVNNFDEILEVTDGVMVARGDLGIEIPAPQVLAVQ
FT                   KKLIAKCNLAGKPVVCATQMLESMTYNPRPTRAEVSDVGNAVLDGADCVMLSGETAKGN
FT                   YPINAVTMMAETALMAEQAIPYIPTYDDLRNCTPKPTSTTETIAAAAVASVFEQRAKAI
FT                   IVLSTTGSTPRLVSKYKPNVPIILVTRNPRTARISHLSRGVFPFVYEKGTESDWTKDVE
FT                   SRLQFGIEQAKEFGMLKEGDTIVTIQGFAAGVGHSNTLRVLTV"
FT   gene            complement(<144017..>147001)
FT                   /locus_tag="KLTH0D01518g"
FT                   /old_locus_tag="KLTH-ORF12617"
FT   CDS_pept        complement(144017..147001)
FT                   /locus_tag="KLTH0D01518g"
FT                   /gene_family="HOG000141717" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12617"
FT                   /product="KLTH0D01518p"
FT                   /note="similar to uniprot|P12689 Saccharomyces cerevisiae
FT                   YOR346W REV1 Deoxycytidyl transferase forms a complex with
FT                   the subunits of DNA polymerase zeta Rev3p and Rev7p
FT                   involved in repair of abasic sites in damaged DNA"
FT                   /db_xref="GOA:C5DG10"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR012112"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG10"
FT                   /protein_id="CAR22352.1"
FT                   /translation="MDYEELAQLLSDASSLDASPQEPPPPPPPDSPLRLYDSSRGAIAR
FT                   ERSQRPFSQQQRLLSTLDDDSLVGLVNTFDRPTQRARLRRPAAPADDAADAEDDPCIVT
FT                   SSPEPPSSVVPSTPPASSRLSESDSSSDRSRSSSPTAARVGPLKFGDYAQYFSDKTAHQ
FT                   HSRDEYMRKLYQDALNGGREYPPIFKDCTIYINGRTFPDRLQLHQKIIIHGGSFKHFLS
FT                   GKKSVTHIVASNLTAKKRIEFQNYKVVAPAWITESIAASKRLPWQDYALITGEYGQQKL
FT                   QIARPPAAALPAPEQQPADGFDANSLDCKQPGFLQSFFAKSRLHQLSAWKADLRALFCE
FT                   KYVEGAHLQPPPKGARLAIFHVDFDCFFATVSALSDARYDLSRDPLAVAHGNNSSEIAS
FT                   CNYVARSFGVKNGMWVRSARRLCPNLICLPYNFEQYEVNSKLLYQILAGSGFFQMILPI
FT                   SIDEAICVKYLDGLPDGDASAHQQCEAITRQIRRDVFDATNGCTVSIGCSNSLVLARLA
FT                   LKKAKPNGQCVMASLEQDSIDAFIEELPLRDLPGVGATIVDKVQQHILFEQTAEPTIGD
FT                   LKRNSSLQLLASKLGTKTGHKLHLFLSGKDDEENSRVLRDPLDYFARKSISVDINYAIR
FT                   FDTIHEIDEFIDRICEHLTTKLGELDMVTPQVTLKVTRRCEHAPIEPAKYLGSGECDTF
FT                   SRSSRFGVPTCEAGLISTEVKSSFRMLGCPPKDLRGIAVQLNKLEKVSDRVCQLRLPFR
FT                   EQDASSAGSRFPALNVNAFNSLPGALKEDVRTELLKRKINLPPSPPSKRSASNSPVKDY
FT                   WGRHGKRTETLKQEMPSTLDEDFMNHLPTQIQREIKWDHAIVKKASSSVRNRLSRKGTG
FT                   VLNLSKNRPSKPEAVKFQSLERPLGISRLIKSWIDDTIDNGPHIDDLNLFDKYLTKLAA
FT                   KGKTHHILKIARTMSSHLEYHSSFTKSNPQGRQEWEEYLLIRMIPTLTASAAKSDSGVQ
FT                   VTFDL"
FT   gene            <148109..>149155
FT                   /locus_tag="KLTH0D01540g"
FT                   /old_locus_tag="KLTH-ORF12603"
FT   CDS_pept        148109..149155
FT                   /locus_tag="KLTH0D01540g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12603"
FT                   /product="KLTH0D01540p"
FT                   /note="some similarities with uniprot|P33122 Saccharomyces
FT                   cerevisiae YOR344C TYE7 may be involved in glycolytic gene
FT                   expression TYE7 a 33 kDa serine-rich protein is a potential
FT                   member of the basic region/helix- loop-
FT                   helix/leucine-zipper protein family"
FT                   /db_xref="GOA:C5DG11"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG11"
FT                   /protein_id="CAR22353.1"
FT                   /translation="MDGPGSSTMTMAAAPSAQGAGAGASSFDDWLFPEASRMGAFGEYG
FT                   NDAEADAEAGGWAADAGAEADAEVDLDADADPEADADAGVGAAVGADPGAGVLAAGSLS
FT                   SSSSSSSAGSPLDQFSSLFDSNAMLARGSDSDTLFTASNSASGSPTFVKREDAQMCGPA
FT                   GLGASAGGLSAEGEAPGSLPLALDVPELSAFDGLDAAAAAADADVGGSAAANAAAAAAA
FT                   AAAAGARKKRAPRKRLTAHQKQAHNKIEKRYRININTKIAKLQQIIPWVASEETAFEVG
FT                   ETSRGNSRGGESVATATPKLNKSMILEKAVDYILYLQNNERLYEMEVQRLKKEVERART
FT                   ERDTAARS"
FT   gene            <151489..>152424
FT                   /locus_tag="KLTH0D01562g"
FT                   /old_locus_tag="KLTH-ORF12592"
FT   CDS_pept        151489..152424
FT                   /locus_tag="KLTH0D01562g"
FT                   /gene_family="HOG000141718" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12592"
FT                   /product="KLTH0D01562p"
FT                   /note="weakly similar to uniprot|Q12182 Saccharomyces
FT                   cerevisiae YOR342C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG12"
FT                   /protein_id="CAR22354.1"
FT                   /translation="MSFHHQFTLASAKNQLIPQQLTNNVFFGPLNALSQREFIQENRIR
FT                   FFVAVGIATKRVAQYCRDMPARDCLVVNFDSEFSPQVSLSATELELVSQYSQQHSTSLS
FT                   QLAAGLAGDAATGCTADSRLTPQPELDQQLHNSPAQYTCNIVTSQGAQKFASFNDLLTL
FT                   FKLSGSGNVLVFSSNGNDEDLVALLSSHVVITNSSASLLEAFQYVKSLRPSINQCQPDS
FT                   VFWCQGLMEYLEGSRSYNNPFYDNGMSPASPLSTTGVTSNAFVTKRRNSWSSDCEEECP
FT                   NSATGTISVSGTPKTRRIAAIRADNMALPH"
FT   gene            complement(<152846..>153952)
FT                   /locus_tag="KLTH0D01584g"
FT                   /old_locus_tag="KLTH-ORF12588"
FT   CDS_pept        complement(152846..153952)
FT                   /locus_tag="KLTH0D01584g"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12588"
FT                   /product="KLTH0D01584p"
FT                   /note="highly similar to uniprot|P39729 Saccharomyces
FT                   cerevisiae YAL036C RBG1 GTPase that interacts with
FT                   ribosomes member of the DRG family of GTP-binding proteins"
FT                   /db_xref="GOA:C5DG13"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG13"
FT                   /protein_id="CAR22355.1"
FT                   /translation="MSTTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRREIVTS
FT                   ATQGSGGGGVGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPG
FT                   VIRYKGARIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIVLDVNKPLHHKQVIEK
FT                   ELEGVGIRLNKQPPDILIKKKEKGGVSITNTVPLTHLGADEIRAVMSEYKMNSAEIAFR
FT                   CDATVDDLIDVLEASTRRYMPAIYVLNKVDSLSLEELELLYRIPNAVPISSGREWNLDE
FT                   LLQIMWDRLNLVRVYTKPKGTMPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVY
FT                   GSSVKHQPQYVGLNHILEDEDVVTILKK"
FT   gene            <154310..>157306
FT                   /locus_tag="KLTH0D01606g"
FT                   /old_locus_tag="KLTH-ORF12586"
FT   CDS_pept        154310..157306
FT                   /locus_tag="KLTH0D01606g"
FT                   /gene_family="HOG000105770" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12586"
FT                   /product="KLTH0D01606p"
FT                   /note="similar to uniprot|P39730 Saccharomyces cerevisiae
FT                   YAL035W FUN12 GTPase required for general translation
FT                   initiation by promoting Met-tRNAiMet binding to ribosomes
FT                   and ribosomal subunit joining homolog of bacterial IF2"
FT                   /db_xref="GOA:C5DG14"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG14"
FT                   /protein_id="CAR22356.1"
FT                   /translation="MGKKSKKSAQNYWDEEFEEDTPQPEEIGGTPAESTPEVEAATDGP
FT                   ESSVEPSDQAEVAEDAEAIEADFMSALRQTKKKADKKEEEDVKKPVIKSKKEKEKEKKE
FT                   KEKQKKKEQAAKKKAQQQAQKEKNKELNKQQAEAAAEAKAKKESGAKSSEGQTATGGAK
FT                   KNAKKIPAGLAALKRQLELKKQLEEQERLEREEEERLEKEEEDRLKKEQELAEEARQQK
FT                   REKERAKREKLKAEGKLLTRKQKEEKKLLEKRRAALLAAGNIQVAGLNKSQDGSDSKPK
FT                   KVVYGKKKKKTQQEKDAELAVEEAKKAAEAADAEEDAEEALVDDWENLALDDDEGAASD
FT                   EEDQEQEETAEDEDADATKEKPAQPSSSKVEAAPASTPASAAVSKRPSPTPSSSTQKDL
FT                   RSPICCILGHVDTGKTKLLDKIRQTNVQGGEAGGITQQIGATYFPIEAVKQKTQAMAQY
FT                   EKQTFDVPGLLVIDTPGHESFTNLRSRGSSLCNIAILVIDIMHGLEQQTMESIRLLRDR
FT                   KAPFVVALNKIDRLYDWEPTPNDSFRNSFQKQSRGVKQEFATRLEGIKVALAEQGLNSE
FT                   LYFENKNLAKYVSIVPTSAVTGEGVPDLLWLLLELTQKRMSKQLMYLSHVAATVLEVKV
FT                   VEGFGTTIDVILSNGYLREGDRIVLCGLNGPIVTTIRALLTPQPLRELRLKSEYVHHKE
FT                   VKAALGVKVAANDLEKAVSGSRLLVVGPEDDEEEMMDDVMEDLTGLLDSVDTSGRGVVV
FT                   QASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRDVMKATAMLDKAKEFAVMLCFDVKID
FT                   KEAEHYAEEQGVKIFNADVIYHLFDAFTAYQEKLLEQRRKDFLQDAIFPCVLNTLQIIN
FT                   KRGPMIIGVDVMEGSLRVGTPICTVKLDPTTKEKTVLLLGKVVSLEINHQAVNEVKKGQ
FT                   TAAGVAMRLEDPSGQQPIWGRHVDEKDTLYSLISRRSIDTLKDPAFRDQVSKSDWLLLR
FT                   KMKTVFSIE"
FT   gene            complement(<157597..>162561)
FT                   /locus_tag="KLTH0D01628g"
FT                   /old_locus_tag="KLTH-ORF12580"
FT   CDS_pept        complement(157597..162561)
FT                   /locus_tag="KLTH0D01628g"
FT                   /gene_family="HOG000205401" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12580"
FT                   /product="KLTH0D01628p"
FT                   /note="highly similar to uniprot|P10964 Saccharomyces
FT                   cerevisiae YOR341W RPA190 RNA polymerase I subunit largest
FT                   subunit of RNA polymerase I"
FT                   /db_xref="GOA:C5DG15"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR015699"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG15"
FT                   /protein_id="CAR22357.1"
FT                   /translation="MDISKPVGSEITSVDFGVMTAQDIRNFSAMQITNPTVLDNLGHPI
FT                   SGGLYDLALGAFLRNLCATCGLDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLY
FT                   CHGFRLKASEVHRYACKLKLLQYGLIDECYKLDELRVGTLQTAVDEAEEDDGDDDKPSK
FT                   LVDVALLRELKVKRREFVDISIATAISEGRTSYNGTFTATVNDERKALIHDFYKRLLSR
FT                   PKCDNCGMFSPKFRKDGFTKIFETSLTEKQQTNNRVKGLIRADMIKKQQQRRKLADDQN
FT                   SAGEPMEVDEDFDNSRDASARPKTGSTYILSTEVRNILRSVFKKEQEVLQYVFHSRPNL
FT                   SKKLVRADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQLLSKILTTSLLIRDLNEEMS
FT                   KLQKDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQGNTGGKVPIPGVKQALEKK
FT                   EGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQA
FT                   VINGPDKWPGATQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVYRHI
FT                   KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQN
FT                   ENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYGC
FT                   IRPEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKIKNE
FT                   YWGKGSTENDVVFKNGELLCGILDKSQYGASKYGIVHSLHEVYGPDVSAKVLSVLGRLF
FT                   TNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSANDSELL
FT                   KRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPNNSMQAMALSGAKG
FT                   SNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQE
FT                   YYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYGGD
FT                   AVDVTQESHMTQFKFCADNYDALLKKYNPAALIEHLDVESALKYSKKALKHRKKTEKVP
FT                   HYSQKVKYDPVVSKFNPSKYLGSVSENFQDKLESFIDSNNDLFKSRDTVSEKKFRALMQ
FT                   LKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTAS
FT                   AAIKTPQMTLPILADVTDPQADTFCKSVTKVMLSEVVDRVEVTESTGFSEGSTGSRSYF
FT                   INMKFFGSDEYGEEYDVSKEELQNVVAEKFLKSLEVAIVKEIKKQKKMASPEIGVAVPR
FT                   SQAAIASGEGGKIDDEDNDEQESRKRTKQAVSYDDPDDDEVETMREAEKSSDEEVDSEM
FT                   DSDSSDSDDAEDVEEEKPLSNKTKSGLTKVQRDRQSAVVSSHRFVTKYNFDDEDGEWCQ
FT                   FTIELAADTEKLLMVNIVEDICRKSVIREVKNIDRCVHPEPENGKRILVTEGVNFQEMW
FT                   DQDAFIDVNGITSNDVASVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMM
FT                   TRQGTYLAFNRQGMETSTSSLMKMSYETTCQFLTKAVLDNECENLDSPSARIVLGKLNN
FT                   VGTGAFDVLAKVPASH"
FT   gene            <162973..>163164
FT                   /locus_tag="KLTH0D01650g"
FT                   /old_locus_tag="Klth0D.mRNA.il.287.p"
FT   CDS_pept        162973..163164
FT                   /locus_tag="KLTH0D01650g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.il.287.p"
FT                   /product="KLTH0D01650p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG16"
FT                   /protein_id="CAR22358.1"
FT                   /translation="MPEKNAAAHDQGNLAGSIAGSVAGADLGNKLHLGAIGGIASSVLG
FT                   SGQGSKLENKLKEKMDKK"
FT   mobile_element  163739..164828
FT                   /mobile_element_type="retrotransposon"
FT                   /locus_tag="KLTH0D01672s"
FT                   /old_locus_tag="Klth0D.retrotransposon.1"
FT   gene            <166143..>168788
FT                   /locus_tag="KLTH0D01694g"
FT                   /old_locus_tag="KLTH-ORF12558"
FT   CDS_pept        166143..168788
FT                   /locus_tag="KLTH0D01694g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12558"
FT                   /product="KLTH0D01694p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DG17"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG17"
FT                   /protein_id="CAR22359.1"
FT                   /translation="MLPHTAREEQVECDVYLYVLCDRSWAGAYVRVRRRGRATARPRSA
FT                   RRAAPTQLMAGSNHGLGRPQACSRCRNHKIKCVHNGEAPCTYCIHRNVAQECRLTFPEN
FT                   KKAKKSEAGPRVSKGEAGAREASAPLVPMDAIFTAGVRPQIEPHLCVPPVDANTLPAWA
FT                   RGSIFEVVPLIPARVVREAVLRVVRSFPELNLFHLPTVLDSAEKLHPLLAGAAVAFAGF
FT                   FDPWRGGSGDGGGDSGSGSDAGDASASQWLGAGSYQVANKVCERLTLDAIFAKCHFLME
FT                   PSLDVACALLILAVVKWGHSEYYAAWMLHGCATRMIQSMDSEESFLLKAKIYPLLRKMQ
FT                   LRAFWCAYVLDKIICAGQRKTFMLPDTPDMLLPVGDYEFSLATLDAAPEMDLGVKSEQK
FT                   ATLCDFLAQCQRNPAILKKSPYALLVFLWSIWGAVSRRVTRPDRDSPAFECPWDPDSEV
FT                   YKLNSRLDGIWALVPREWKWSREAYLAEKPAVIKDNLMVTINCVYHASTALINREFMPF
FT                   LPHDIDKPAGPTDLKEPPPYHENYWTESARRCFGSIRTLSRILKTLLEEELGRSPGGKF
FT                   RNAVLVTPYHSFLAFTCGLLANYGANFYWMDPDSEKYNNDPTNPDRLENCYNVAISLLK
FT                   AKENDFGAAKNWLAVILKMGEINRFVAQNRNSTKVSEWTKKCSKDLGPSLSMPKVDIKK
FT                   LEKMLPLLPPPHTNGQQNTESLYPSPAADSYYNQVGLFSQREVVPSSSFYRAPPPSASQ
FT                   PASQYRSPALMTHSAPMSFPLAPAASQSPKLSFPALLPASACEPLSSNPAPQPLASFGA
FT                   SSSVRSVPAASYSVVPGSSVLSPQVAPSAPYAGQQPLPAHDERHVETDTDKLSLFFNDS
FT                   ELDLLMQFNS"
FT   gene            <169128..>170021
FT                   /locus_tag="KLTH0D01716g"
FT                   /old_locus_tag="KLTH-ORF12551"
FT   CDS_pept        169128..170021
FT                   /locus_tag="KLTH0D01716g"
FT                   /gene_family="HOG000248322" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12551"
FT                   /product="KLTH0D01716p"
FT                   /note="similar to uniprot|P46669 Saccharomyces cerevisiae
FT                   YOR340C RPA43 RNA polymerase I subunit A43"
FT                   /db_xref="GOA:C5DG18"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG18"
FT                   /protein_id="CAR22360.1"
FT                   /translation="MSSVKRSSEQKRDAEFIKRHKKVCKNPVDESNGVSKCIVQVPVSM
FT                   YVSIAPTYMKEPNRGIKKQHLNPMIMKYSSNVGGVVLGYENLKIEDASVSDESDSENAT
FT                   KLVKITPDTPFGFTWCSVDLYVWQPQIGDVIEGWIFIQSPSHIGLLIHDAFNASIKKTS
FT                   IPQDWTFIHNEDADNNSDSGVGNSAQSRSLGHWVDENGQRLDGKLKFSVRNVYTTGRVV
FT                   SLEGSLLDDKVGQARSPAESLPVVSNKKIIFDDEVSTENRESHRDLELSKRVKEDNGEE
FT                   IVYEKNSSSSESSDSE"
FT   gene            <170277..>171152
FT                   /locus_tag="KLTH0D01738g"
FT                   /old_locus_tag="KLTH-ORF12549"
FT   CDS_pept        170277..171152
FT                   /locus_tag="KLTH0D01738g"
FT                   /gene_family="HOG000001102" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12549"
FT                   /product="KLTH0D01738p"
FT                   /note="similar to uniprot|P39731 Saccharomyces cerevisiae
FT                   YAL034W-A MTW1 Essential component of the MIND kinetochore
FT                   complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
FT                   kinetochore subunits contacting DNA to those contacting
FT                   microtubules critical to kinetochore assembly"
FT                   /db_xref="GOA:C5DG19"
FT                   /db_xref="InterPro:IPR008685"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG19"
FT                   /protein_id="CAR22361.1"
FT                   /translation="MSAPTMRTTLLLTEHLGYPPISLIDDIINAVNELMYKCTQAMEKY
FT                   LLERSFMEGKDYTDEIKIGIAKLETLWENSVDRSFDKLELYVLRNVLHIPQELIENGSF
FT                   RLRHHDSLVLEDNDSKEALSTELKTKMRQLQESIETHKELRRQKVALQKVLARVRRFKL
FT                   LVSSFLQGQDLDNKEVAAVLSSLSPVNESVRFLASQVHSLYLESDDQCSSERVKSIVSR
FT                   QKELHADLSSRTGYLAQSTKKALEQLLGNQPSEVSHEVPDGAGTTGSSPSTDHAIEVSS
FT                   PDWNAMTEVT"
FT   gene            <171356..>171841
FT                   /locus_tag="KLTH0D01760g"
FT                   /old_locus_tag="KLTH-ORF12547"
FT   CDS_pept        171356..171841
FT                   /locus_tag="KLTH0D01760g"
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12547"
FT                   /product="KLTH0D01760p"
FT                   /note="highly similar to uniprot|P52492 Saccharomyces
FT                   cerevisiae YOR339C"
FT                   /db_xref="GOA:C5DG20"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015582"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG20"
FT                   /protein_id="CAR22362.1"
FT                   /translation="MEGSSKSSIPDGHSVVSRLQSELMQLMLSPSPGLSAFPEDEEDLT
FT                   KWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFVSPMWHPNVDMSGNICLDILK
FT                   DQWSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWDKDMREYKKKLIARYEEIDD"
FT   gene            complement(<172172..>173227)
FT                   /locus_tag="KLTH0D01782g"
FT                   /old_locus_tag="KLTH-ORF12546"
FT   CDS_pept        complement(172172..173227)
FT                   /locus_tag="KLTH0D01782g"
FT                   /gene_family="HOG000248211" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12546"
FT                   /product="KLTH0D01782p"
FT                   /note="similar to uniprot|Q06855 Saccharomyces cerevisiae
FT                   YOR338W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG21"
FT                   /protein_id="CAR22363.1"
FT                   /translation="MEFNSPQPEHAQLSTVVHPKGTSRLLAALHQQVVGAMAPRSGGPG
FT                   LGGCSIDSALDEHLIPSPPLSPKMSSVDEGSAAPAAPVAPQVPAESTTALWVKPDWESS
FT                   RSPESYRSATSGFLSQYRCFDFMRTKRYTHPNNKTLRKTRNYTCSPNYTSGGSDFEKVY
FT                   RTRRSVKNAENPRTARGHAPAFQEDFTRHGMPSRPATPTNRNTHRKVNSVTSPLGSSAV
FT                   LGAPQYVPNMSWEKLPDYSPPLSTLPANNKCLKVEWKGSSMDLSADPLRHLLHPAELQL
FT                   AQILRLPCDLYLDSKRRLFVEKVHRLKQDLPFRRTDAQKACRIDVNKASRLFAAYERIG
FT                   WLEDENFERFF"
FT   gene            complement(<173650..>175608)
FT                   /locus_tag="KLTH0D01804g"
FT                   /old_locus_tag="KLTH-ORF12541"
FT   CDS_pept        complement(173650..175608)
FT                   /locus_tag="KLTH0D01804g"
FT                   /gene_family="HOG000074724" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12541"
FT                   /product="KLTH0D01804p"
FT                   /note="similar to uniprot|P47988 Saccharomyces cerevisiae
FT                   YOR337W TEA1 Mutants are defective in Ty1 Enhancer-
FT                   mediated Activation Ty1 enhancer activator and to YLR098C
FT                   uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4 Zinc-
FT                   finger protein with Zn[2]-Cys[6] fungal-type binuclear
FT                   cluster domain; DNA-binding transcriptional activator or
FT                   CHA1"
FT                   /db_xref="GOA:C5DG22"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG22"
FT                   /protein_id="CAR22364.1"
FT                   /translation="MGPERLDVLTSTNAGSSEDFSSGSPLLSQKRLACSNCRRRRKKCD
FT                   MGYPCASCVKMKLDCNVNMDDMRKKRYAAGYVKSLEAHVAYLETRLKNLDAAKISGTSS
FT                   LGTSEPTLLISTDGKERRLSDGAAPFSSSVGQSFRGGDNSSSFNASENDILRRKRFVKG
FT                   SIYPEGPASYKPQRREPAISKPQNRIADLKTTVIVRRHQDSSETLNTDKNILGSLSAFY
FT                   KWLYPGPFVFVHRESFLYGFFNHSEDNYENSQYCSEELVYAVASVGSRLVPGLRSLSEG
FT                   YYQKAKGKLLSIVFDEHSTAKITTVQALLCLAFCELGKGNNQLAWYFSGLAIRVGYDMG
FT                   FQLDPKVWVTDDASSSELSQSELEIRSRIYWGCYIADHFICLLLGRTSTLSVSNSTVPE
FT                   SDELPEVDGTGEFRFNSKHVLQVSLPLKNLVILSRIVQVFTAKIFIESGSTAQRIGYLT
FT                   RFNIKVYNWRQSLPQFLKWSKNSIKDTDWSTDPTISYFWYHYYIVLLTFNKPFMEDCEE
FT                   SKILVLEVLGELHTLLSNFRVRFGSVDTASIYQLYSCLLAVTCLKKLTKMSLDGQPASV
FT                   LASLDRDLRFYTDLFHEFHLTYGLPQRLQDEPDLHVVDQLNTLAYTHDFSLSDEIDDLI
FT                   KQVFGFDTWTINPSHTV"
FT   gene            complement(<175846..>179820)
FT                   /locus_tag="KLTH0D01826g"
FT                   /old_locus_tag="KLTH-ORF12540"
FT   CDS_pept        complement(175846..179820)
FT                   /locus_tag="KLTH0D01826g"
FT                   /gene_family="HOG000000800" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12540"
FT                   /product="KLTH0D01826p"
FT                   /note="similar to uniprot|P22023 Saccharomyces cerevisiae
FT                   YOR336W KRE5 Protein required for beta-1 6 glucan
FT                   biosynthesis mutations result in aberrant morphology and
FT                   severe growth defects"
FT                   /db_xref="GOA:C5DG23"
FT                   /db_xref="InterPro:IPR009448"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG23"
FT                   /protein_id="CAR22365.1"
FT                   /translation="MLLWTLLVWSYAIFASCTTVRLSNASSGVKLRLWNAVVGLVNDEQ
FT                   LVQDLYFLIAGVSDELDELKTDSTPLDQIVEALARHNPELASLLSLRYALEPGFSNDTS
FT                   NQNYFLLNNKRFENADDIFYLKTDDLNAQKSACINDVLDNEDVVMGSNRDAPVILFYGC
FT                   DRVEDWEEFNRNLYMEAQAGKVRFVWRSTCPNDLPFEFEPSAVALTVKGSQWNTEFGHA
FT                   LDVPESLVLGTEPSFRAQQVSDEQLQDLDMKVGTLVYDFYEKSQNATETIRYFRQIVNN
FT                   FPVLARSLAEQGDITIDNRWEAALKKLAKEGIDNTMLGLFVNGQFHKLSNLNKWSVLQS
FT                   VILELQRVNFLMDLLQKYQNITPGESLVLAKKLLNTFSKRSLTTQQLLQPVKYDLHRIP
FT                   GFSESIIYFNDIELDSDYAEKLKDDIAMFFEESEFGELPAYRENWNEIVFVIDFSDLRS
FT                   KDTWEALQGLLRALQVVKKGYPQRIGLLPFSTSAQDHGVLGKIYELKQNKPLETLVSYL
FT                   EDLSPIERPQQSVFQKLPPVLEIINDRLKINETSIVINGEIYPFKSNLWNYLVSKVLKK
FT                   DVSFIKSELLRINTKNFKAREILHAKSFIERNKKYAPDYFEDATYSNTNVTALLSLAHR
FT                   IVETSTGGGLNTIHTVTIVEDFNTPLGLQRLIHLLQIKLHGVRVRAVHSGLLGKNWDKL
FT                   KFTISNADTSKLQNYLRSLKSNGECNYIEPAIVGQWLLDLPRKILQRTSYLAVNGRFIH
FT                   FEQGELPTIYEYEMIVQREATRVLDAVASLQEVFPDSLKEPLDPNYVEMVSAVLAKMFY
FT                   DGERLYNNGIDFTAEASISRINLGELLPSESFGAFQTSEEPRKVEVTLILDPLEERTQN
FT                   LLALASYLGSLDFLKLQVVLMPTTDLKVFPNHRLWIEGEKDLSIIDTRKFYVDVEVPPY
FT                   LHVGERKDNVFELEYIKVEVNAFENKEEPSKGLVEGIGNVCLNLLNANHEVIDTATTTD
FT                   TFGYTQFRLRRLEQGLTIESCSSNYRVSSFTSNSKADYIASDHFDVTSLAPTRLYVRLE
FT                   KTQGMLPEVSEDNRIINILSIIENAEDEVSFEKQASSVMRSRGSFDTKFWIILGEEPSA
FT                   SFLSFVEFMTAESAGEVTFEYLTVDWPRWLRPQRFRPRQLAAAKVMMLDTLFPKGVTKV
FT                   VYMSPGARVPNITELWEYDFDSVFCAPRAYQRDGTPYWKQGYWRNFLSKNNLKFHATEP
FT                   LFIVNLGKYRQEHAGSKFRIHYQRLSPGINFLVQLDQDLLNDMQTLFPISSLNKRLLKV
FT                   APHLQTLDDNLYQSLQEKFNAKKSGQKLEDLSETIVHDEL"
FT   gene            <180421..>183288
FT                   /locus_tag="KLTH0D01848g"
FT                   /old_locus_tag="KLTH-ORF12536"
FT   CDS_pept        180421..183288
FT                   /locus_tag="KLTH0D01848g"
FT                   /gene_family="HOG000156964" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12536"
FT                   /product="KLTH0D01848p"
FT                   /note="highly similar to uniprot|P40825 Saccharomyces
FT                   cerevisiae YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase
FT                   required for protein synthesis point mutation (cdc64-1
FT                   allele) causes cell cycle arrest at G1 lethality of null
FT                   mutation is functionally complemented by human homolog"
FT                   /db_xref="GOA:C5DG24"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG24"
FT                   /protein_id="CAR22366.1"
FT                   /translation="MTIGDRQKWTASNVRSTFMEFFKQREHTFVASSPVIPYDDPTLLF
FT                   ANAGMNQYKPIFLGTVDPSSDYYSLKRAMNSQKCIRAGGKHNDLEDVGRDSYHHTFFEM
FT                   LGNWSFGDYFKKDAIQYSWELLTKVYGIPSERLYVTYFEGDQKQGLEPDLEAFELWKSV
FT                   GVSEDHILPGNAKDNFWEMGDQGPCGPCSEIHYDRIGGRNAASLVNMDDPNVLEVWNIV
FT                   FIQYNREQNGTLKSLPSKHIDTGMGFERLVSVLQDVKSNYDTDVFQPLFARIQEITGAR
FT                   PYEGKFGAEDADGIDTAYRVLADHVRTLTFALADGGVPNNEGRGYVLRRILRRGARYAR
FT                   KYMNYPIGNFFSSLAPTLIDQSKAMFPEINRDPSYLFEILDEEEASFAKTLDRGEKLFE
FT                   KYAQAAAQTKDKTLDGLQVWRLYDTYGFPVDLTELMAEEKGLKIDGPGFEKAKQESYEA
FT                   SKKGGKKSASDLIKLEVHELSTLNSENVPKTDDSPKYESANIEAIVLRIFDGENFVDEI
FT                   SEVGKQYGVILDSTCFYAEQGGQEYDMGTLVIDDVAEFSVENVQLYNGYVFHTGQLGEG
FT                   KLSVGDKVIASFDELRRFPIKNNHTGTHILNFALKEVLGNDVDQKGSLVAPEKLRFDFS
FT                   HKKAVALDELKEVERICNEQIKANLPVYYKNVPLDLARKISSVRAVFGETYPDPVRVVS
FT                   VGKPVDDMLVDPTSEEWQKYSVEFCGGTHVSKTGDIKEFVIIEESGIAKGTRRIVAVSG
FT                   SEAYEVQRIANKFDSDLIAAEKMPFSPLKEKKLKELGVALGQLSISVVTKQELKDKFAK
FT                   IEKVVKDEIKTRAKKEIKQTVDEVKNYFAENQEASFLVKYINIPTNAKAITEAVNHMKT
FT                   SAKDKSIYLFTGDDRVAHGCYISDVALEKGIDGRALLNTVSSNIGGKAGGKGNVFQGVG
FT                   DKPEGIETAVKEVENLFREKLNITK"
FT   gene            <184749..>185243
FT                   /locus_tag="KLTH0D01870g"
FT                   /old_locus_tag="KLTH-ORF12528"
FT   CDS_pept        184749..185243
FT                   /locus_tag="KLTH0D01870g"
FT                   /gene_family="HOG000216538" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12528"
FT                   /product="KLTH0D01870p"
FT                   /note="similar to uniprot|P28005 Saccharomyces cerevisiae
FT                   YAL033W POP5 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends"
FT                   /db_xref="GOA:C5DG25"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG25"
FT                   /protein_id="CAR22367.1"
FT                   /translation="MVRLKSRYVLFEVLYPEGRTLTSENNVNNLFKREVLLRHHQVTPA
FT                   RVTVKTILQELRRVIQFNFGDYGSGKANSLLQIKYFSNRTSTGIIRCSREDYEIVVIAL
FT                   TLMNKIDELEGVLLNPIKVSGTIKRIEQYAVKRSARLLNVIQGQSEIDKFDYISYDENE
FT                   D"
FT   gene            complement(<185319..>186674)
FT                   /locus_tag="KLTH0D01892g"
FT                   /old_locus_tag="KLTH-ORF12527"
FT   CDS_pept        complement(185319..186674)
FT                   /locus_tag="KLTH0D01892g"
FT                   /gene_family="HOG000074697" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12527"
FT                   /product="KLTH0D01892p"
FT                   /note="similar to uniprot|P28004 Saccharomyces cerevisiae
FT                   YAL032C PRP45 Ortholog of human transcriptional coactivator
FT                   SKIP can activate transcription of a reporter gene
FT                   interacts with splicing factors Prp22p and Prp46p"
FT                   /db_xref="GOA:C5DG26"
FT                   /db_xref="InterPro:IPR004015"
FT                   /db_xref="InterPro:IPR017862"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG26"
FT                   /protein_id="CAR22368.1"
FT                   /translation="MSNSRPLSVLLPPPKHAINASAQHKSGLKELVGLLSEAGNPRETL
FT                   YSVESFQENSVTLESFLPLRHKYPDLKIPQISQSDIQNTYERTKAVFDKILSQKLQPQG
FT                   TGAVGTANKGSAKTIEYKLPDQNSEVRKLKIVDQQVDPLQPKLFKTKKVVAPSTDEPFA
FT                   PVLHKSDDITPQSTKEERDKWNIPSAISSWKNPNGYTINLDRRIASDGRYSKESLGPHE
FT                   ISEGHMKLSEALDAAERKAREEVSLRADAKRMLAEQDVREKEEKLRMIALKAREDRKKN
FT                   TEPYSGPRALDSATRQRQEDQRERLNKIRRELQRSKMSTAERLRALATGEGREVSEKVI
FT                   LGAAAASDTADIQYDSRLFTKAAKARGQSGGDQVYDNPLFVQEGINTMYRPNFSAAVDI
FT                   QARDAADTLESKVQFELASGKRGREGPVEFSAAENTEKSEEGESSVKRHRGG"
FT   gene            complement(<186816..>189233)
FT                   /locus_tag="KLTH0D01914g"
FT                   /old_locus_tag="KLTH-ORF12526"
FT   CDS_pept        complement(186816..189233)
FT                   /locus_tag="KLTH0D01914g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12526"
FT                   /product="KLTH0D01914p"
FT                   /note="some similarities with uniprot|P39732 Saccharomyces
FT                   cerevisiae YAL031C FUN21 Cytoplasmic protein of unknown
FT                   function potential Cdc28p substrate"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG27"
FT                   /protein_id="CAR22369.1"
FT                   /translation="MYVKAAANASIVAVKGGATLDQYDAKLIQCRVAISRLTEILRILR
FT                   ILEGTLKRTNGTKTIIPLMNYILALYGGLTLNASEILSRRLRLLSEFRLCKITDVNPPL
FT                   NSSPISLDCEFPEVSSDFQEYTAHVYDRQLQNKLLQAAINITQNALQVYDRKYKQCNME
FT                   RSANRPTSISGRPTTFEEGSFEELIQPLDVPMILDLAVLIKDFEVDTSESSFRKLSLQV
FT                   LTKFKDHFNEKALPPIKTYHTSLFRFSKASSLSQSKIIMNLPYWQYTMHRIYALLLRIL
FT                   YILTITKAFLRQAYIPNRAFFESPRTQLHSPNVFEFRELIKNLDTICMGPNDLSDLVER
FT                   LQCYSQQGFSLAVQPSSVLEAYNSEVSVATRKLRFYFQIVESLLSVWKHIQASSLNNEA
FT                   FGSLDELGLSKAVEERLAVDRLDFIERKNKEAQLKEKQKEAAAAASTESSVKTIFRRSS
FT                   IQRSKMSPSPSGSTSPSSLSPASMSRSPSQNLKRGTLPKKPLNGSSISSPLASRRGSVS
FT                   GSTSNAGNRKPSNEGSSNGSPRIDETLQTGGRKRSSSLQSSVLASHNQADNMHRSNSLQ
FT                   AAATLNQRMVRNTFAKLSANIEGNGALNSDSKTDRLATPANSSRQMMRSSSPSPLRQKG
FT                   KSSGASPAGPRSGIELPDVESLVLDEGKLALVSKQSPSGSTSAPTKSLVESSSSEISPN
FT                   SEVEYQTITLETVKKVRFTGVPPMSEKEDPRPKRKGWYKKPQVLYYPPPPPQVAVQQYR
FT                   LRQEGQAFRKSLRDGDGENGGVSKRTAFMSQSDVHLSPTHKFSSKIRDKLSR"
FT   gene            complement(<189479..>190762)
FT                   /locus_tag="KLTH0D01936g"
FT                   /old_locus_tag="KLTH-ORF12523"
FT   CDS_pept        complement(189479..190762)
FT                   /locus_tag="KLTH0D01936g"
FT                   /gene_family="HOG000248323" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12523"
FT                   /product="KLTH0D01936p"
FT                   /note="similar to uniprot|Q01926 Saccharomyces cerevisiae
FT                   YOR334W MRS2 Mitochondrial inner membrane Mg(2 ) channel
FT                   required for maintenance of intramitochondrial Mg(2 )
FT                   concentrations at the correct level to support splicing of
FT                   group II introns"
FT                   /db_xref="GOA:C5DG28"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG28"
FT                   /protein_id="CAR22370.1"
FT                   /translation="MIWSRLRPFRLLAKPFLRSRRLYHRLLPEQNSGILSLKPITPNDA
FT                   FVSCTLFNKNGAVTAVSQKFPKWAFLKDHNLYPRDLRKIDTTSVDVIPSIVVKPTCILI
FT                   NLLHIKALIQHDCVFVFDTSNSEAAMKLGVLMYDLESKLSTNPNAHMAQLYEHRALESI
FT                   LMNVMTSLETEYKQHYSICGIILKDLEDEISRDKLRDLLIKSKNLTSYYKKSLLIRDVL
FT                   DELLDSDEDLAAMYLGEHKNENDDFADLEMLLETYYKQCDEYVQQSETLLQDIRSTEEI
FT                   VNIILDANRNALMLFELKVTIYTLGFTIATLVPAFYGMNLKNFIEDSPLGFGCVVGFSV
FT                   IAALCVTWSNFKALSSVKRLTMMNNHTGVNTARHAANARHELNQEAPILWKKWASSLRT
FT                   VWLGSNHPVRNGKHRDLIWKWLVDDNKK"
FT   gene            complement(<191031..>191723)
FT                   /locus_tag="KLTH0D01958g"
FT                   /old_locus_tag="KLTH-ORF12521"
FT   CDS_pept        complement(191031..191723)
FT                   /locus_tag="KLTH0D01958g"
FT                   /gene_family="HOG000202506" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12521"
FT                   /product="KLTH0D01958p"
FT                   /note="similar to uniprot|P22203 Saccharomyces cerevisiae
FT                   YOR332W VMA4 vacuolar ATPase V1 domain subunit E (27 kDa)"
FT                   /db_xref="GOA:C5DG29"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG29"
FT                   /protein_id="CAR22371.1"
FT                   /translation="MSTAITSLTPSQVNDELNKMQAFIKKEAEEKSKEIMLKADQEYEI
FT                   EKTALVRNETSNIDAAMEEKTKKATLKQQITKSTIANKMRLKVLSTREQMLDDIFESAK
FT                   AELKKLSSDKKKYESVLKSAILESLLRLLEPSVVVKVREQDKQLVNSFKEAVLKEYKAK
FT                   SGREASLTVSSEYLSKDSAGGVIASDESGKIVVDNTLEERLEILNQEALPALRLELFGI
FT                   SESRKFFD"
FT   gene            <192827..>196498
FT                   /locus_tag="KLTH0D01980g"
FT                   /old_locus_tag="KLTH-ORF12518"
FT   CDS_pept        192827..196498
FT                   /locus_tag="KLTH0D01980g"
FT                   /gene_family="HOG000176668" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12518"
FT                   /product="KLTH0D01980p"
FT                   /note="similar to uniprot|P15801 Saccharomyces cerevisiae
FT                   YOR330C MIP1 Catalytic subunit of the mitochondrial DNA
FT                   polymerase"
FT                   /db_xref="GOA:C5DG30"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002297"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR016265"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG30"
FT                   /protein_id="CAR22372.1"
FT                   /translation="MSLNRAFRGVKLWRKVRAYSTLEAPRINPVGIQHLSKHLHEQVFG
FT                   SINAQPQQPGLSYEEKEMLTRLSRTFLKNHGLLGKKTAISAPISFDLPQLQGRSLDEHF
FT                   QKLGHFASQPYRDLAGSKFTNIPPRPKTWLRKSGWVRYASGKAPEAVDYPAEATIVFDV
FT                   ETLYKISPYPTLAVALSEEAWYCWTSPFLSGESDNPSHLIPLNTLDTTRLVIGHNVGYD
FT                   RARVLEEYNCQESKAFFLDTMSLHVASSGMCSRQRPQWMQKRKAQDSQSCDGAQYSNVP
FT                   DEEDPWTTVSTLNSLKDVALLHCGIKLDKAQRDYFATLDRNDIINDFTQMVDYCATDVE
FT                   ATSKVFDVVFPLFLSKCPHPVSFGALRLLSTSLLTTRGDSWKDYIEKSENLYQHSKQSI
FT                   EKKILAIVEEVVKLKDKKTLIEQDPWLSQLDWTIKPLRITKKGLPAKGQKLPGYPEWYR
FT                   QLFPTKNSKQAQITIRNRLIPLFFKLSWEGEPVIWTSSHGWCFAVPVSRSEELEAKNYL
FT                   KINPGDVVSPEFTLFKVPHPNGQQFNCTTLVSKQYVQFFEKGILTSHSELAHEALKINS
FT                   SCAYWISARERVMSQFVVSTRDFPDQFKDLQHKTFSDEEISIILPSVIPMGTVTRRSVE
FT                   NTWLTASNAKKNRIGSELKAQVQAPPGYVFVGADVDSEELWIASLVSDSVFNIHGGTPI
FT                   GWMCLEGSKSEGTDMHTKTAQILGCSRNEAKIFNYGRIYGAGVKFATQLLKNFNPGLTD
FT                   YEAKETAEKLYSSTKGLVKRSKTFKKFWYSGSESILFNKLEHIAEQAAPRTPVLGAGIT
FT                   SSLMKGNLGSNTFLPSRINWAIQSSGVDYLHLLCCSMNYLIKKFSLRARLALSIHDEIR
FT                   FLTAEKDKYKTAMALQISNLWTRAVFCEQMGIKDLPQNCAFFSAVDIDHVMRKEVDMDC
FT                   VTPSNKIPIPHGESKDIVSLLKIPESSLKDGREDIDVSGFPFQKREPVFSTYDKAHSRD
FT                   YLYYFLRMQIQSSKWKVEELEQEFTRRSAENDHQSKYRSDEYMFLDYINDTKNKNRPTA
FT                   ELGGGPLENAVHGSMNLTLRTQPIAESQGKFTDELASGLNVENDLEAQHFLAANNTEDT
FT                   ENTDKVQRCTSAVAKRKRLRKSVFGGAEAYKLFSSCVDKSRAYAGRKQEELLSSDLAIK
FT                   TIVNEVVATGGSRSTKKVAKIRKAASIKSPALKKDISKTAASTSKVLKKMNKTLRAG"
FT   gene            complement(<196550..>197293)
FT                   /locus_tag="KLTH0D02002g"
FT                   /old_locus_tag="KLTH-ORF12515"
FT   CDS_pept        complement(196550..197293)
FT                   /locus_tag="KLTH0D02002g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12515"
FT                   /product="KLTH0D02002p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG31"
FT                   /protein_id="CAR22373.1"
FT                   /translation="MKRPRKRAFHHSEEEASDSGDDQDFSQYIKRKSAAVQKVQHERKF
FT                   DLDDASLQASAHVTPKPSSTSLIESFKASKKQREMDKLFSQSVKARIERESETCVMKDK
FT                   EVYITKEYEDVKKDLDKAFELAHEEEDSELRDKDGPHTPLLQATPQINSGECVIRGVYA
FT                   SDQSCIKMPRNGDEKPKAYKNDIYVTRPSRFKPQEQGYRQLQQGVEPTLNKRALVQQFL
FT                   LPKKSKQMIEIEIKRYQNRTHKKAA"
FT   gene            <197416..>199332
FT                   /locus_tag="KLTH0D02024g"
FT                   /old_locus_tag="KLTH-ORF12513"
FT   CDS_pept        197416..199332
FT                   /locus_tag="KLTH0D02024g"
FT                   /gene_family="HOG000141787" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12513"
FT                   /product="KLTH0D02024p"
FT                   /note="some similarities with uniprot|P34758 Saccharomyces
FT                   cerevisiae YOR329C SCD5 Multicopy suppressor of clathrin
FT                   deficiency and of ts ipl1 mutants"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG32"
FT                   /protein_id="CAR22374.1"
FT                   /translation="MSFDWLNVPGLSGSGNENIEAAEPPPSVSFNFGNSASEPPTERES
FT                   HVTMPQRADRADAFHSQSSYDSASSSAKSQARPDNYMETKEDLQVPLSLSRTQLTREEV
FT                   RTYLRWYGYIASRKHTKLIALDDVFHFMTNFPLGQDVKERIAHIFKTCKNALNIGQFFA
FT                   ILRLIARALTDGVLPTRKMIMKAAPVPKPKPILAAGNEEVYEEIDDSQDGPELKVDFDS
FT                   FASLLLTGQKKKRMRRRITNDHKRSKRVRFTDKLVTFQDHVQSPENEQGTEDEEKSGDN
FT                   EPLDLSLPMDQLLKKMAARKKNNSALVSEPPSQKVPESQEEKEVLEDMKESLNHFHQIH
FT                   NVDSVSLGGVPAQVPSAGTPSANATAQIEPLKPTATGSANYLFRSSQQQPQSVNQEPLQ
FT                   PLKPTATGSANYLFRSSQQQATSQKPEHNSFNFMHAVSPDPSNNAMHRNNTTFQSPTPE
FT                   IPQIRAPLAANFAGQPLHSSSQAPSNLNVPFSNQSFLPPPSSGFGISPQPTSQNNFSPN
FT                   LSANNYFQNLLSSSPSPNASTLQLPQSASVGPYANAYSSNSKVAQDSNYLKPNLTGPSN
FT                   PQYQINPNQYQRREYQSFTPSPVPTLPSYPQAPQNTYKSHDYLGDLRALQEHVDQLQNA
FT                   YNR"
FT   gene            <199583..>199990
FT                   /locus_tag="KLTH0D02046g"
FT                   /old_locus_tag="KLTH.mRNA.200AT.p"
FT   CDS_pept        join(199583..199663,199742..199990)
FT                   /locus_tag="KLTH0D02046g"
FT                   /gene_family="HOG000042711" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.200AT.p"
FT                   /product="KLTH0D02046p"
FT                   /note="similar to uniprot|P33328 Saccharomyces cerevisiae
FT                   YOR327C SNC2 mediate the targeting and transport of
FT                   secretory proteins vesicle-associated membrane protein
FT                   (synaptobrevin) homolog"
FT                   /db_xref="GOA:C5DG33"
FT                   /db_xref="InterPro:IPR001388"
FT                   /db_xref="InterPro:IPR016444"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG33"
FT                   /protein_id="CAR22375.1"
FT                   /translation="MSSSVPYDPYIPAEESQSQTKTAALKAEIDDTVGIMRDNINKVAE
FT                   RGERLTSIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLVLAVIILLVVIIVPI
FT                   VVHFS"
FT   gene            complement(<200288..>204958)
FT                   /locus_tag="KLTH0D02068g"
FT                   /old_locus_tag="KLTH-ORF12510"
FT   CDS_pept        complement(200288..204958)
FT                   /locus_tag="KLTH0D02068g"
FT                   /gene_family="HOG000171839" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12510"
FT                   /product="KLTH0D02068p"
FT                   /note="similar to uniprot|P19524 Saccharomyces cerevisiae
FT                   YOR326W MYO2 One of two type V myosins involved in
FT                   polarized distribution of mitochondria required for
FT                   mitochondrion and vacuole inheritance and nuclear spindle
FT                   orientation moves multiple cargo"
FT                   /db_xref="GOA:C5DG34"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR018444"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG34"
FT                   /protein_id="CAR22376.1"
FT                   /translation="MSFEVGTRCWYPDKNEGWVGSEVTKLSQPADGKYLLELTLENGES
FT                   VEIETNTIAEGQDDRLPLLRNPPILEAIEDLTSLSYLNEPAVLHAIKARYGQLNIYTYS
FT                   GIVLIATNPFDRVEQLYSQDMIQAYAGRRKGELEPHLFAIAEEAYRLMKNDKQNQTIVV
FT                   SGESGAGKTVSAKYIMRYFASVEQANNDNTSSDHQLEMSETEQRILATNPIMEAFGNAK
FT                   TTRNDNSSRFGKYLEILFDQNTSIIGARIRTYLLERSRLVFQPQTERNYHIFYQLLEGL
FT                   SESEKAELHLTKVEDYHYLNQGGDYRIKGVDDAAEYRTTIDALKMVGFAQDTQHQLFKI
FT                   LAALLHIGSIEVKKTRNDSSLSSDEPNLQIACDLLGIDAYGFSKWITKKQITTRSEKIV
FT                   SNLSFNQAIVARDSVAKFIFSALFDWLVENINTVLCNPEVSNQVSSFIGVLDIYGFEHF
FT                   EKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYMNEQIEWSFIEFNDNQPCIDLIENKL
FT                   GILSLLDEESRLPAGSDESWTQKLYQTLDKPPTNSVFSKPRFGQTKFVVSHYALDVAYD
FT                   VDGFIEKNRDTVSDGHLEVLKASKNETLLAILDTIDNNAAALAKKQEANKKPGPARMVK
FT                   KPTLGSMFKQSLIDLMTTIDSTNVHYIRCIKPNEDKEAWKFDNLMVLSQLRACGVLETI
FT                   RISCAGFPSRWTYNEFVLRYHILIPSENWTKIFTSEATEDDIRDLCKQILDVTVKDSTK
FT                   YQLGNTKIFFKAGMLAYLEKLRGTKMHNACVMIQKKIKGVYYRNKYLAIQSAIHKSQAA
FT                   VAGALCRQRVDYEIKTLAATSLQSLLRAHTQRKHLKNTFCSIIRVQSLVRRRITQKELL
FT                   ERREFDAAIAIQKKIRGFVPRKHFNTTRGSSVRIQSLVRRKLAQKQLKQLKADAKSVNH
FT                   LQEVSYKLENKVIQLTQSLADKVKENREMTSRIEELQKSLSESANIKTLLESQKEEHSR
FT                   DLQEQKNSHDAELANKRAELEQAKEEIAAAKQEIDSLMTKQEELRNDVRLKIENLNKAQ
FT                   QEYADAQTQNSDLKNEVKSLKDEISRLQATIRSGVSANTALAHTPTKNRRFSTHSSLAD
FT                   GMSPRQLNVISMNNGMEDDVRSTASALSQINDELYKILEDTKSLNTEIVEGLLKGFKIP
FT                   ETGVAAELTRKEVLYPARIMIIVLSDMWRLGLTKQSESFLAEAMSTIQKLVTGLKGEDM
FT                   ICHGAFWLTNVRELYSFVVFAQESILNDDSYNSGLNEDEYKEYVTLVTELKDDFESLSY
FT                   NIYNIWLKKLQKDLEKKAVSAVVMSQSLPGFIANESSQFLPKLFTQSNYYKMDDILTFF
FT                   NNIYWSMKTYHVEQEVFREVIITLLKYVDSICFNDLIMRRNFLSWKRGLQLNYNVTRLE
FT                   EWCKSHHIPEGTDCLQHMLQASKLLQLKKANLDDIDIIWEICSSLKPAQIQKLITQYAV
FT                   ADYEVPIPQEILTFVANRVKSESSLSSNGKSQTHSSDIFLHVENGPFEDPFSLIETRRF
FT                   GKIEAYIPAWMNLPLTRRVVELVTQHVTVQEVERAS"
FT   gene            <206308..>207483
FT                   /locus_tag="KLTH0D02090g"
FT                   /old_locus_tag="KLTH-ORF12509"
FT   CDS_pept        206308..207483
FT                   /locus_tag="KLTH0D02090g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12509"
FT                   /product="KLTH0D02090p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG35"
FT                   /protein_id="CAR22377.1"
FT                   /translation="MPSANEGLGLSPYHRYSQHGSAKISSVSNSDIPRHSFHLRCSAER
FT                   NAVTEHDFTSASAGKFSDCLFHSCQGGSAGLNGAASSSSPSLSSIHNTDKAPYSSSNSL
FT                   LNPGSARSGNTARNSSYEPPYLSAPRLRNDRKRLVHQFLNFEEEGQSKHDAQVSLASQH
FT                   SLIYENSRGESLSQIVLKDLKEIPTCQDSNLDLVRSQSKAKSTALSCQPIMSEISKFDS
FT                   SLKDLILSISSKDNEMSRSFNDLDVLQHNIQETRAIIQSIQSQVKENDLSRLKGSFEAG
FT                   SDTSFIKRFSAAISAYSDSLTSFEERIAKCKAELAAQKATVHKLETTIKLNEMLEDSNT
FT                   NKCTIDRIREYRGIITDAVGLLFLALVIITLKRYLAGRNSSSTYKLHVPEH"
FT   gene            <207735..>208643
FT                   /locus_tag="KLTH0D02112g"
FT                   /old_locus_tag="Klth0D.mRNA.at.307.p"
FT   CDS_pept        join(207735..207816,207874..208643)
FT                   /locus_tag="KLTH0D02112g"
FT                   /gene_family="HOG000066135" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.at.307.p"
FT                   /product="KLTH0D02112p"
FT                   /note="similar to uniprot|P39735 Saccharomyces cerevisiae
FT                   YAL027W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR021624"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG36"
FT                   /protein_id="CAR22378.1"
FT                   /translation="MVQVQSGVVLPIRIFINRQQVAKTIQDSSTSFETPLLPNNSIIRL
FT                   KSPLIRVYLSNTDARDLCNDIKKEILLIIYELTSKDVHDTVTGKLKIGNCVDIKEAFGK
FT                   TRAFSFLYDSDPDRCNLTTLERIGKHQYKLHYDKNWELDIFITDLRKLARIRSVLLARM
FT                   SWQGSVFPGAAIPVGDLSGTRILRRCREEIMSKKSPTDEPSILLESDDEGALLDTAAVD
FT                   SSTSTTTRPLKEADLDEDKKPAFKFIHSPMVNLGNCIDIHVLKRPKRARTNRSQAHLDV
FT                   ET"
FT   gene            <208745..>210118
FT                   /locus_tag="KLTH0D02134g"
FT                   /old_locus_tag="KLTH-ORF12506"
FT   CDS_pept        208745..210118
FT                   /locus_tag="KLTH0D02134g"
FT                   /gene_family="HOG000246356" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12506"
FT                   /product="KLTH0D02134p"
FT                   /note="highly similar to uniprot|P54885 Saccharomyces
FT                   cerevisiae YOR323C PRO2 Gamma-glutamyl phosphate reductase
FT                   catalyzes the second step in proline biosynthesis"
FT                   /db_xref="GOA:C5DG37"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG37"
FT                   /protein_id="CAR22379.1"
FT                   /translation="MSSTAEIIAKNARLGGNTLKTISNENRSRLLYKIHDGLKANAKSI
FT                   KEANQLDLQKAKEDSLADSLYKRLDLFKGDKFDTMLIGIKDVAELEDPVGKVRLARQLD
FT                   ENLDLYQVTAPVGALLVIFESRPEVIANITSLAIKSGNAAILKGGKESVHTFREISRII
FT                   NTVISENEESTGIPASVIQLIETRQDVSDLLQQDLYIDLVVPRGSNELVRKIKSSTKIP
FT                   VLGHADGICSIYLDSEADLAISKRITIDAKTSYPAGCNAVETILVNPEMPKWWEVLENL
FT                   SKVGGVTLHVSADVKASYLDFLKQSGAQDDDAQGKIVDADESKDFDREFLSLDCAVKFV
FT                   HSTEDAIAHINQHSSKHTDAIITENKAKAELFMKGVDSSGVYWNASTRFADGFRYGFGT
FT                   EVGISTSKIHARGPVGLDGLVSYQYQLRGNGQVASDYIGSGGKKAFIHKNLDISNLRL"
FT   gene            complement(<210244..>214179)
FT                   /locus_tag="KLTH0D02156g"
FT                   /old_locus_tag="KLTH-ORF12505"
FT   CDS_pept        complement(210244..214179)
FT                   /locus_tag="KLTH0D02156g"
FT                   /gene_family="HOG000202528" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12505"
FT                   /product="KLTH0D02156p"
FT                   /note="highly similar to uniprot|P39524 Saccharomyces
FT                   cerevisiae YAL026C DRS2 Integral membrane Ca(2 )-ATPase
FT                   potential aminophospholipid translocase required to form a
FT                   specific class of secretory vesicles that accumulate upon
FT                   actin cytoskeleton disruption mutation affects maturation
FT                   of the 18S rRNA"
FT                   /db_xref="GOA:C5DG38"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006539"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG38"
FT                   /protein_id="CAR22380.1"
FT                   /translation="MNHQNRKSNEDTLFDIDFLDDEFTSAPRTDSSAGNPFQQAQVVDS
FT                   DYDLLEDIRRGTIPEETIDLDRHSANLPHEDNIENDIIQNPFLGEEGLNDHSQGIHRAP
FT                   KKRSGLRNVFRKFNFGLIGNKNRNNYQGFEMHSYDDLGAEDRYARSRNKFDIKVLFRRF
FT                   ILRRNELSDEDKSSPRQIFINDREANRARSYGDNHISTTKYNLATFLPKFLFQEFSKYA
FT                   NLFFLFTSAIQQVPNVTPTNRYTTIGTLLIVLIVSAVKEIVEDLKRAKSDNELNDSRAE
FT                   IFSDQLQDFSLNKWVNISVGDIIKVKSEEPVPADMIVISSSEPEGLCYIETANLDGETN
FT                   LKIKQAKVETSKIIDTAELARMRGKVLSEHPNSSLYTYEGTMTLNGKNIALTPEQMVLR
FT                   GATLRNTAWVYGLVVFTGHETKLMRNATATPIKRTAVERVINMQIVALFGVLIVLALIS
FT                   SIGNVIKVTSDAKHLGYLYLQGTNKAGLFFKDILTYWILFSNLVPISLFVTVEMIKYYQ
FT                   AYMIASDLDLYDEATDSPTVVRTSSLVEELGQIEYIFSDKTGTLTRNVMEFKSCSIAGK
FT                   CYIETIPEDKTPTMEDGIEVGYRKFEEMQEKLGEHSDPESGVINDFLTLLATCHTVIPE
FT                   FQEDGSIKYQAASPDEGALVEGAASLGYKFIVRKPNTVAIVLEGSGQEQEYQLLNICEF
FT                   NSTRKRMSGIFRMPDGQIKLFCKGADTVILERLSESGNPYVEATLRHLEDYAAEGLRTL
FT                   CLATRTIPESEYSEWKAIYDEASTTLDNRTQKLDDAAELIERDLHLIGATAIEDKLQDG
FT                   VPETIHTLQDAGIKIWVLTGDRQETAVNIGMSCRLLSEDMNLLIVNEETREATKKNLVE
FT                   KLKAISEHQVSQQDMNSLALVIDGKSLGFALDSEIEDYLLSVGKLCKAVICCRVSPLQK
FT                   ALVVKMVKRKTGSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADFAIAQFKYL
FT                   KKLLLVHGSWSYQRISQAILYSFYKNIALYMTQFWYVFANAYSGQSIMESWTMTFYNVF
FT                   FTVLPPFVLGVFDQFVSSRLLDRYPQLYKLGQKGQFFSVTIFWGWVINGFYHSAVTFIG
FT                   SILFYRNGDVLNMHGETADHWTWGVSIYTCSVIIVIGKAALITNQWTKFTAFAIPGSFV
FT                   FWLVFFPIYASIFPHANVSTEYYGIVSHVYGSATFWLMCIVLPVFALLRDFAWKYYKRT
FT                   YTPESYHVVQEMQKYNIGDYRPRVEQFQKAIRRVRQVQRMKKQRGFAFSQSEDSGQDKV
FT                   IRMYDTTLKRGVHGELQDASANPFRDS"
FT   gene            complement(<214421..>215329)
FT                   /locus_tag="KLTH0D02178g"
FT                   /old_locus_tag="KLTH-ORF12503"
FT   CDS_pept        complement(214421..215329)
FT                   /locus_tag="KLTH0D02178g"
FT                   /gene_family="HOG000201538" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12503"
FT                   /product="KLTH0D02178p"
FT                   /note="some similarities with uniprot|P10962 Saccharomyces
FT                   cerevisiae YAL025C MAK16 Essential nuclear protein required
FT                   for normal concentration of free 60S ribosomal subunits
FT                   required for maintenance of M1 satellite double- stranded
FT                   RNA of the L-A virus"
FT                   /db_xref="GOA:C5DG39"
FT                   /db_xref="InterPro:IPR002672"
FT                   /db_xref="InterPro:IPR006958"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG39"
FT                   /protein_id="CAR22381.1"
FT                   /translation="MSDEIIWQVINQHFCAYKLKTDKGQNFCRNEYNVTGLCNRQSCPL
FT                   ANAKYATVKNVDGRLYLYMKTAERAHTPAKMWERIRLSKNYAKALKQVDDHLLYWNKFL
FT                   IHKCKQRLTRLTQVAVTERRMELREEERHYVGIAPKVKRRDENRERKALAAAKIEKAIE
FT                   KELLDRLKSGAYGDKPLNVDEKIWRKVLGHVEDEQEDDEEEYDDEEEDESDAEIEYVED
FT                   DGDEELVDVEDIERWLDDPEASDSDSFEEDEMSDSSEDEPESGFTSGKGKKGTSAARKK
FT                   RPRVEIEYEEETQPAHRELAH"
FT   gene            complement(<215729..>219868)
FT                   /locus_tag="KLTH0D02200g"
FT                   /old_locus_tag="KLTH-ORF12500"
FT   CDS_pept        complement(215729..219868)
FT                   /locus_tag="KLTH0D02200g"
FT                   /gene_family="HOG000066134" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12500"
FT                   /product="KLTH0D02200p"
FT                   /note="similar to uniprot|P07866 Saccharomyces cerevisiae
FT                   YAL024C LTE1 Putative GDP/GTP exchange factor required for
FT                   mitotic exit at low temperatures acts as a guanine
FT                   nucleotide exchange factor (GEF) for Tem1p which is a key
FT                   regulator of mitotic exit physically associates with Ras2p-
FT                   GTP"
FT                   /db_xref="GOA:C5DG40"
FT                   /db_xref="InterPro:IPR000651"
FT                   /db_xref="InterPro:IPR001895"
FT                   /db_xref="InterPro:IPR008937"
FT                   /db_xref="InterPro:IPR019804"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG40"
FT                   /protein_id="CAR22382.1"
FT                   /translation="MVPEDLQDEIEQGGRIFGTDDYYPMPSEEKLSFSKRGSSTLIIKT
FT                   DISALIVKLTSPMDPIDYPFLSDFFLSYRKFLAPQELLKLLVSRLQWAFNESLSADSNK
FT                   QQIGQIASVRTFVLIRHWILNYFAQDFLTDDALRSQFVNSVNSLSWGASDVAPKSICGI
FT                   VINIKKSWGFCLRLMWEGLSFEDQPTSANEWLEFKIKDVATHLSTKNGKRLSFYALQSS
FT                   QNPEFRNRSVLSLYVGKENFQLPEHNARVNTKQGAKIKQRTASMFLFPQDNLSSAVLKV
FT                   SNDKVGNSDEVSQNAPNSSGVSEVIKDLQYPPSPSIDKVIPPTPAKKVEFILRSSYFPS
FT                   EILSEEEANTSSTSQKLKKEPHLHSYNKGMMGLLSKWKKNHTLRSANQKINQESPSAEF
FT                   ENLIKLVFSITSLENKQYSSEELKSVVSSKFDILSARTIDEVEYFLAVENDLLSKIRKQ
FT                   DHFTTVEGGADEQTQERDAETVSAMDNLNLYKTVSSIASSVISLSKTLQFQHAVSPSAA
FT                   ARERRRVRSTDGLLGNKSVLNFTDALLTSDVNTRILENDAPRKLVFHGHSTTRERHTNS
FT                   ELKFRYSNMADAVIRLNHSTPSVMQTSALTKSTNGTRSRGSPTKGVRISSSITEIDDTF
FT                   SKHNESTPQAEEVSNAGSHISRPLKRKESLDNLREFNFEENFDQKNGSQSKLDHKINHN
FT                   ELQSDADDDNSSFFTTLDDMSMSRNSKHMTPASSAAQKSVTSSGRISIIRSRGPSVSNA
FT                   VTISTTNLVAKDGAFLKLDEELLNNQEEIRNLEERTSALFFDKVEEEGAKNIRSSIATS
FT                   VSTQLLFSSKQSSPNKIEKNDLLDNDEFPQGNKLIRLSSIPSMHSIVSGDSFSSFHTIN
FT                   SFEQNSRADISHKLTVDTPSTGAKPEKNAPNDSLLVPDAEGSSGNKYLFSPDTDSLDFA
FT                   SPEKNMEDLKNKFISPITSETTSFNEDDLSRDNEGEEGEPTEEQQLDNGYQEKPHNEHH
FT                   RRSITPIVSPYKANDSRLNRFAKLTDESLHGDPVNVALMKLEGTFSKTDQNKEQSDSDM
FT                   ERLKERRLTGLGARERNSFLIERRRQVKSEVPFTPCTKDFSYERDQKVTNDQITELLQN
FT                   YKIQDSRLNISNAEQHVPFILMYDSKSIAEQLTLIEREILNEIDWKDLLDLRVKRKVLP
FT                   VTSWLQLLLQNEQLSGIDLAIARFNLTVDWIISEIVLTRDNKLRRNTIQRFIHVAEHCK
FT                   LFQNYNTLMQIVLALSSLVVQSYRDAWRLVEPGDLLSWESLKNVPSLEKNYYNIRMLLN
FT                   DIEPIKGCIPFIVVYLSDLTLNSEKSNWITPHQVLNYSKFQTNVQIVKNFIQRAQWSKF
FT                   YNISVNDELLSKCVYISCLTHEEIDHLKSQQTKSAT"
FT   gene            <220570..>223113
FT                   /locus_tag="KLTH0D02222g"
FT                   /old_locus_tag="KLTH-ORF12494"
FT   CDS_pept        220570..223113
FT                   /locus_tag="KLTH0D02222g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12494"
FT                   /product="KLTH0D02222p"
FT                   /note="weakly similar to uniprot|P52960 Saccharomyces
FT                   cerevisiae YOR363C PIP2 peroxisome induction pathway 2
FT                   (PIP2) transcriptional activator of peroxisome
FT                   proliferation may form heterodimer with Oaf1 to activate
FT                   oleate-inducible gene expression activator of peroxisome
FT                   proliferation"
FT                   /db_xref="GOA:C5DG41"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG41"
FT                   /protein_id="CAR22383.1"
FT                   /translation="MDRNGLTNSTSSDSLELAVRSKKSRLRLSFVCRNCRKRKIKCDKA
FT                   QPKCGRCAKLGLECNYDLSEQISLKKTPGRPVTIHEQLEELEHKFEDMRHSLNLSGMRA
FT                   WNEDLDNRSKPIKINFFVGLQPNCFESIFKRDCKPFSDMGMIQKHKRLNPFLKFVTRSF
FT                   KPLNYAVKKILQSVGDSLDPHSDELESVAEILFLTPQVREVLKQHSMNPEGITQETANA
FT                   IRRCLLEKGSRGDEKSLFEPVDLEFSSSKISQAELIDQIVAVLPPRDQIEHLLAYFMKV
FT                   VYPLVPYVNKSCFFRRVTETIKYSENGKVIGLDIGDYQDAIRKIGCMAIFLVVLRISHT
FT                   ALTLVKNLPYNGEHLDRFISVSQKCLAHLITLSHKTNEDILSCLILMRWSLIYSPTEGE
FT                   VVAGSVTDMLLSLIVNHAIRIGLYRDRIQANGPKKNDKMERYFIHYRAKLWMGCLILLR
FT                   SDLFLKGNFPVVSPEYAAMAPKEENPENYEDEAEAQIHRILHKQLDIYSKMSILDKLTL
FT                   QVEESTDIEEIYSKIRRLEYDLQSYCPLSDVENLNNTTLENTIIQSMNNALYFKVNVMV
FT                   KIYFLAIRASIVAILERQITEALTDTEHLSLRYREVTAECFESAVDLCEILCAYMSVAD
FT                   DDQNSPVMPDHRYILNQIVQIGIFRVSYYFIGVILTLLQVKNGLENFMWQNENKQSLVT
FT                   EIEYKITLIESTSKAIFQSVQKLIHLGSHTLSDRYFTSFKQFLFLEYAMQVIQNEINPN
FT                   TPSRLREVLGDIGLPVAMDYSPSDWEKFASYVKKAIGQAEPTPPFTSSDDIPSAPSTHA
FT                   KSAPNDPALDSMLLFDDQVNIQNMLDGDYTWTDFI"
FT   gene            <223460..>225718
FT                   /locus_tag="KLTH0D02244g"
FT                   /old_locus_tag="KLTH-ORF12492"
FT   CDS_pept        223460..225718
FT                   /locus_tag="KLTH0D02244g"
FT                   /gene_family="HOG000000798" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12492"
FT                   /product="KLTH0D02244p"
FT                   /note="similar to uniprot|Q12502 Saccharomyces cerevisiae
FT                   YOR322C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG42"
FT                   /protein_id="CAR22384.1"
FT                   /translation="MVFSKLGHQSDKKSASNGALDRVFSDSSNDGLVELLIDIESPPCV
FT                   LYGSATESTGALLSGLLKLRVRSRSDHISHSEPLTPTTSHGRKKKSSSGLNALSQTLSN
FT                   LSLSNSAMSPVTSPKPSRTSSMMFTKVSVKSVSLSLVQKVRYTKPFVAHSSSIQSCLNC
FT                   RMKQTELARWDIVKKETEIPVGDHAYPFSHLIPGSVPATVCLGSEAHTEVKYELVGEAT
FT                   YRAVPSHNSRGEKTSTVHLKLPIPVTRSILRGPDKNSLRIFPPTDLTATVVLPNIVYPK
FT                   STFTLELKLDGVSSEGRRWRMRRLNWKIEEKGRVRLQACATHKGKLKQLEKEVKETETG
FT                   KKPSKGKPLKRTHDAAPQVTTTVCTLEDALSMTNAPEDPNAPDETETQEETSNRNQGED
FT                   DGLIHPSDSAMRQARVEEQQRLRQEMLQKELSEGTALFTEELRTIAHGEVKNGWKSDFT
FT                   GSGKIELVTEVNCMGLNSGVSNPVNRASSSKPVHDNGRQHVTVACDVEDPHLGIYVQHL
FT                   LILEIIVAEEALQYANGQPLHTEHSPLTKTSSNATNPDQRLAELSPMLAARSSVPQNIN
FT                   DEAHPNQPEHGAPSPHSASRRNSNSRIVGVPTGAARVLRMQFRLNITERSGLGISWDDE
FT                   VPPTYQDVRLLSPPSYNNATSGSNTPLVHSDMDRNDYSTRTNFNSGRSEFTELSRPPQA
FT                   HAYDSPYQSLSPVQSPQLENVVSIQGNAHHTHLLTPQNTQEVHLPSLSELLDTDRITQ"
FT   gene            complement(<225886..>228108)
FT                   /locus_tag="KLTH0D02266g"
FT                   /old_locus_tag="KLTH-ORF12491"
FT   CDS_pept        complement(225886..228108)
FT                   /locus_tag="KLTH0D02266g"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12491"
FT                   /product="KLTH0D02266p"
FT                   /note="highly similar to uniprot|P31382 Saccharomyces
FT                   cerevisiae YAL023C PMT2 Transfers mannosyl residues from
FT                   dolichyl phosphate-D-mannose to seryl and threonyl residues
FT                   in proteins acts in complex with Pmt1p dolichyl
FT                   phosphate-D-mannose:protein O-D-mannosyltransferase"
FT                   /db_xref="GOA:C5DG43"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG43"
FT                   /protein_id="CAR22385.1"
FT                   /translation="MSSTGFSDRTSDGSLKQRNVSKIDQISDSEAEDAPKDIKVQTSPL
FT                   AHLESIVMPIVFTLLGFFTRMYKIGVNNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGK
FT                   MLVGLSGWIAGYNGSWDFPSGEEYPEYLDYVKMRIFNATFSALCIPVAYFTAKAIGFSL
FT                   PTVWLFTILVIFENSYATLGRFILLDSMLLFFTVTSMLCFVTFHNQRSKPFSRKWWKWL
FT                   LLTGLSLGCAISVKMVGLFIITLVGIYTVIDLWTMLSDKGVSKKTYVNHWLARILCLII
FT                   VPFLVFLACFKVHFDLLSHSGTGDANMPSLFQAGLVGSDVGVGPRDVALGSSHVSIKNQ
FT                   ALGGSLLHSHVQGFPEGSNQQQVTCYGHKDSNNNWIFDRIRPLPFWTEEETEIEYVVPG
FT                   ESYRLVHPNTGKNLHTHPIPAPISKSAWEVSGYGSATVGDPKDHWVLEVVAQYGSENQS
FT                   RVHPLTSSFRIKNAELGCYLAQTGESLPEWGFRQSEVACLKNPFKRDKRTWWNIESHTN
FT                   ERLPDRPADFQYPKLNFIKNFIHLNLAMMATNNALVPDPDKLDTLASSAWQWPTLNVGI
FT                   RLCGWGDETVKYFLMGSPASTWPSTAGVLAFMVLVVVLLLRWQRQYADFSSPRDFNLFM
FT                   MGGFYPLLGWGLHFMPFVIMSRVTYVHHYLPALYFALLILCYLFEAGLKNLQKHKGGRL
FT                   ARTLIYFTYGAIVICGFYYFSPISFGLVGPSSNYAYLNWIKTWTIK"
FT   gene            complement(<229079..>230371)
FT                   /locus_tag="KLTH0D02288g"
FT                   /old_locus_tag="KLTH-ORF12487"
FT   CDS_pept        complement(229079..230371)
FT                   /locus_tag="KLTH0D02288g"
FT                   /gene_family="HOG000190304" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12487"
FT                   /product="KLTH0D02288p"
FT                   /note="similar to uniprot|P31381 Saccharomyces cerevisiae
FT                   YAL022C FUN26 Nucleoside transporter with broad nucleoside
FT                   selectivity localized to intracellular membranes"
FT                   /db_xref="GOA:C5DG44"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG44"
FT                   /protein_id="CAR22386.1"
FT                   /translation="MDNFREGSPSTELHRHIGEELELENATLWVKLQDLNYTTFLLIGI
FT                   ALLWPWNSFLSASLYFQHDVFHDKTVFAKIYISTMMSISTISSVIFNYWLSKRQHSYSR
FT                   RIVRGLIWEIMVFGLLSMFVFVHKSLPDWLNFTFLMSTVLVSSLGTAMTQNGAMALANV
FT                   FGPQFSQGVMVGQAVAGVLPSLVLFLVSYIGDPRDQSVGGIFAYFGSTVLVSVACIVLY
FT                   RVSSIGSADKHDFLNRELDPEATVSVPFSLLFDKLRYLVLSIFTTFVVTLLFPVFAANT
FT                   FVSGLPMRNAQYIPFIFTVWNLGDLYGRAISDYSFFQSPSFTPFKTFLYSIARIGLVPL
FT                   FFCFNLNSSARPSSSFSAIVSDLLYILLQFAFGVTNGNVLSVSFMKVSSQLNSDKQRKA
FT                   AGGFTNIFLSAGLAFGSLLSYLFTYIVLSKS"
FT   gene            complement(<230632..>232851)
FT                   /locus_tag="KLTH0D02310g"
FT                   /old_locus_tag="KLTH-ORF12485"
FT   CDS_pept        complement(230632..232851)
FT                   /locus_tag="KLTH0D02310g"
FT                   /gene_family="HOG000294222" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12485"
FT                   /product="KLTH0D02310p"
FT                   /note="similar to uniprot|P31384 Saccharomyces cerevisiae
FT                   YAL021C CCR4 Component of the CCR4-NOT transcriptional
FT                   complex which is involved in regulation of gene expression
FT                   component of the major cytoplasmic deadenylase which is
FT                   involved in mRNA poly(A) tail shortening"
FT                   /db_xref="GOA:C5DG45"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG45"
FT                   /protein_id="CAR22387.1"
FT                   /translation="MNNPAPMMGYSGLAGQQNAVQPAIPSVIGTPGTMHQQLHMQQPHM
FT                   QNPQQAQNAQVQQPLPPGLVNGGQPIMGLTNSAGAGVANVTSNAGNPLYHPHQGDPALL
FT                   NNPIWKLQLQLAAVSRQSAGRANVYARQSAMRKYLLNKNQGAAGTLNEMSASLVDHTKQ
FT                   LLLDMAGEPAGSLNNTSSSAASTPITPNAELSNGNPTTPSLLLQHKKLSQYNIDEDDEI
FT                   EHRMVAPTDTKHDDQLWHALDLSNLQVFNLTESLFKYEFLTRLYLNGNNLTTLPKSVKA
FT                   LTNLRVLDVSHNKLTELPAELGLCHQLKYLYFFDNMVSSLPWEFGNLFNLQFLGLEGNP
FT                   MDRQIIKILTEKSVTGLIFYLRDNAPEIPLPTERKFIDINIDGEATQECSSLQESDAHQ
FT                   SRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQ
FT                   EVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKE
FT                   AVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQHIKSGEHVWAATTHLHWDPQFN
FT                   DVKTFQVGVLLDYMEKVIKEQNNCNNTQELKKVPVVICGDFNSQTNSAVYELLNTGNVS
FT                   KHRDIEGRDFGYMSQKNYAHNLPLKSSYDSIGELPFTNLTPTFTDVIDYIWYSSQGLRV
FT                   RGLLGEIDPEYASKFIGFPNDKFPSDHIPLITRFEFTKGGGSRKA"
FT   gene            complement(<233733..>234704)
FT                   /locus_tag="KLTH0D02332g"
FT                   /old_locus_tag="KLTH-ORF12479"
FT   CDS_pept        complement(233733..234704)
FT                   /locus_tag="KLTH0D02332g"
FT                   /gene_family="HOG000163478" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12479"
FT                   /product="KLTH0D02332p"
FT                   /note="weakly similar to uniprot|P31386 Saccharomyces
FT                   cerevisiae YAL020C ATS1 Protein with a potential role in
FT                   regulatory interactions between microtubules and the cell
FT                   cycle as suggested by genetic and physical interactions
FT                   with Nap1p and genetic interactions with TUB1"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG46"
FT                   /protein_id="CAR22388.1"
FT                   /translation="MITPQSTFKSLSKPLKVTGGGNFTAILLENGELYVAGECTLVSRE
FT                   KTAGWCQIEGLFRDVACGWSHIIAVTCEQEVVTAGIGVKGELGLGSKNKTNQFERVLAV
FT                   QSPGAQVFACFYNTYVQDGGKLYGWGSNTKCQVLSPKSKAVSCPALVYEGKISNVCVGK
FT                   NSVCFVGDGLIRAQGAIAKYLPQMRSEPVLGEKLELRSMWTSITAFDHRNFRFFGPAGQ
FT                   MQDAITFCKQPPAYAVSCWGTGSEHGVMCCEDRVYCWGWGEHGNCGPTNATTAASLTSG
FT                   INDQSNTKSGVNMVYITSHQEEVVSCFGGCATTWICIKKTGA"
FT   gene            <235169..>238312
FT                   /locus_tag="KLTH0D02354g"
FT                   /old_locus_tag="KLTH-ORF12477"
FT   CDS_pept        235169..238312
FT                   /locus_tag="KLTH0D02354g"
FT                   /gene_family="HOG000195581" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12477"
FT                   /product="KLTH0D02354p"
FT                   /note="some similarities with uniprot|P31380 Saccharomyces
FT                   cerevisiae YAL019W FUN30 Protein whose overexpression
FT                   affects chromosome stability potential Cdc28p substrate
FT                   homolog of Snf2p"
FT                   /db_xref="GOA:C5DG47"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG47"
FT                   /protein_id="CAR22389.1"
FT                   /translation="MSSMTPKKDEEIQVPGSSPVEDTKVASSSPLKTDSSTAALLRDKF
FT                   VYKPLERRELGANLKNGSGDNASDNSGGHSDADVAKLINEYPDFSETLVKAVFKSNSYD
FT                   LNLTRERLRRIHSQKSSRSWAWRPGEKKPTSRLMSLGSYSDSVNTSSNGGHVPRHSSTI
FT                   VASPEKSSKVTLEKQKTSIFDRYSHVMNQRHKPTMESVVVDPSTISQLEPSTRKRRKLL
FT                   RADDPNRDPSMAAISNTKKSSVSLSDEDEDEISGDENVSGEDYQEYTPDVNIDDEILKF
FT                   INDADEKDIADVADTTLDKASMVVKSRPFKSLVEFSQMDFLTEQEIQKQQEKKKSSRRG
FT                   QQKKDGDKLLDKMIQTMKGYNAIDSLIKRCSSYGSLIASQIQKWGVNVEDIQSGELNFI
FT                   DIGDDESESDEGAEIGITQESGSTGITKKSGKTKKSGDESDFDDEEDDYQDSEDEDYGS
FT                   RRTRHSGRGRGRPKHKNVKFFKQKPKLLSPDVTLKDYQQTGINWLNLLYQNNMSCILAD
FT                   EMGLGKTCQVIAFLSYLKQNNEHGPHLVVVPSSTLENWLREFNKFCPDMKIEPYYGSQQ
FT                   ERAELRDILEDNDGQYDVIVTTYNLASGNKHDVSFLKNRGFNAVIYDEGHMLKNSMSER
FT                   FNKLMKIEANFRLLLTGTPLQNNLKELMSLLEFIMPNLFVSKKSDLSAVFRQRARTSDS
FT                   NKDYNPLLAQEAIARAKTMMKPFILRRRKDQVLKHLPHKHSKIEYCEMTDVQRSIYNKE
FT                   IQQVLEHKKMVKEREERGETAPLPSKNGGAQASKNLIMSLRKASLHPLLFRHIYDDKVL
FT                   DKMSRAILKEPEYAENGNKEYIQEDMSYLNDFELHRLCLKFPKSLGKFQLKNDEWMESG
FT                   KIGALGKLLKDIIEHKKEKVLVFSLFTQMLDILEMALTTLNINFLRLDGSTQVNDRQAL
FT                   IDKFYEDESIPVFILSTKAGGFGINLVCANHVIIFDQSFNPHDDKQAADRSHRVGQTKT
FT                   VHITTLVTRNSIEEKILQLAKNKLALDTYISEDDNKATEALENKVSDMLEDIIYDESK"
FT   gene            <238729..>241989
FT                   /locus_tag="KLTH0D02376g"
FT                   /old_locus_tag="KLTH-ORF12474"
FT   CDS_pept        238729..241989
FT                   /locus_tag="KLTH0D02376g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12474"
FT                   /product="KLTH0D02376p"
FT                   /note="some similarities with uniprot|P19659 Saccharomyces
FT                   cerevisiae YOL051W GAL11 Component of the Mediator complex
FT                   interacts with RNA polymerase II and the general
FT                   transcription factors to form the RNA polymerase II
FT                   holoenzyme affects transcription by acting as target of
FT                   activators and repressors"
FT                   /db_xref="GOA:C5DG48"
FT                   /db_xref="InterPro:IPR008626"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG48"
FT                   /protein_id="CAR22390.1"
FT                   /translation="MEADWRTTLSNQERSKYITELAQILAQISQVNGGDRGNFNLEKLK
FT                   KTAEQFEKSLYASSSSKELYLDSMRKRIAAMDTAKKKAIANIQHNAANVAAHQQSQQQA
FT                   AVAAAQSAQQQRASQFPPSNMNSQMFFNQQAQVRQQAAQQFRNGVGSNMPVNSAPTRPQ
FT                   LTPQQQQLINEMKGAEIPRELLQRIPNLPPGVNTWQKVTELAQQKRLGPKDLQIAKQVY
FT                   KMHQQIVFKSKMQQASANNRGIPQQRAMPQGPNMAQMPQPRSVVNQPLQQQQHQQQQQQ
FT                   QQHQQHQQQQQQQQQHQQHQQQQQQQQQHQHQQHQQQQQQQQQQRQTGQVPQPSGQEMP
FT                   NVLNRLNQIFTPAEQKALYENGKKLIEDLQRTNRLPTVLTPQQQAIYIKKYINQMALKK
FT                   LQAARMNQMGTTNPQQQMAPAPAPQGQSVPAMSQFTSNVAPSNANLAGMAQRRAYERAN
FT                   AGGASDVNSVGSSTQAQLSSGSSQQAPPAQQQPQPQPKFSLPRPTEQDLMVLRRISAEI
FT                   QKSHLRLSNITNQISQEQKQAIRNKLQLNRQLFTNVDSFIPTLYMITRNEENVRQLLQI
FT                   RMLAKEITEHATRGVFIVPPEVVDKVIFRYQKYYEFIKDQVLRRHQQIIAARQQQQQQQ
FT                   QAPSTTIDPAFNQQRIQGSFQQIQQQMQMRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQQQQQQQQKIQPSPQLNNWTRLNADGRSTSGADGDNAVAPQTAPEHVRRSSSGM
FT                   DFLNSPEFMNARSSPQQPGLSPAKKQAQMRKKMAMKQVPGQGTPGSTVPTSNNTPVPVS
FT                   GPVPAVASRTGTPQVGTAGISSISPMVNRATGLNQSPSPRSHPNGTLPPPADYPYKEDE
FT                   ENLKKMAIRKTEIIARFKCRQEILGKSSVDLFLCSLGDCLGLPSASVDLISPIPSEIVE
FT                   HVNGGCKGKNNGAPGQRVKGQDLTDVSIVNNSIVFADSNSPEAKAEPYVIGLNDVASVF
FT                   RDVYGSTDLSSFSFETKTFSGEGGAKKRKAGDLDNSPDASPASSAIMSESKKLKIDSPE
FT                   DMYFTAPGEDTKQLLTKSGAMKFSPENKIWDWSFWETS"
FT   gene            <242227..>243681
FT                   /locus_tag="KLTH0D02398g"
FT                   /old_locus_tag="KLTH-ORF12471"
FT   CDS_pept        242227..243681
FT                   /locus_tag="KLTH0D02398g"
FT                   /gene_family="HOG000172641" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12471"
FT                   /product="KLTH0D02398p"
FT                   /note="similar to uniprot|Q08220 Saccharomyces cerevisiae
FT                   YOL049W GSH2 Glutathione synthetase catalyzes the ATP-
FT                   dependent synthesis of glutathione (GSH) from gamma-
FT                   glutamylcysteine and glycine induced by oxidative stress
FT                   and heat shock"
FT                   /db_xref="GOA:C5DG49"
FT                   /db_xref="InterPro:IPR004887"
FT                   /db_xref="InterPro:IPR005615"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR014042"
FT                   /db_xref="InterPro:IPR014049"
FT                   /db_xref="InterPro:IPR014709"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG49"
FT                   /protein_id="CAR22391.1"
FT                   /translation="MVGEYPKFPQFSRSEISEQLVPEIRHWALTNGLVMYPPNPNFVQG
FT                   AVAPTTLYPTPFPRQSFDQAISVQTLYNGLYAKIAQDQDGWLSKEIESLAEFDPEFTGR
FT                   LWNLYVQAKEKGISQKLALGVFRSDYLLDVGNLEVKQVEFNTVSVSFGGLSTRVGQLHK
FT                   FLNDSGRYSGGSGRPFYREEIPVSDSAFLLAKSLADAAHHFQASNDTTIVAFVVQKGER
FT                   NVFDQRILEYNLFEHFGIKSVRLTIHEVNTKTFVDPDTSRIYYKPSGEEISVVYFRAGY
FT                   SPSDFVEEQDWQNRLTLETSYAIKAPNLLTQLAGAKKIQQLLTDESILQCFISDASARR
FT                   KLGSSFVKIHPMDNSEAGLSARKLALKSPERFVLKPQREGGGNNIYKGDIPAFLRSIPE
FT                   QDWSGYILMELIKPKPTTENFVVKADQFAQEPILSELGIFGYVLFDESTIYLNEYAGWL
FT                   LRSKSSSSDEGGVAAGFGCVDSVVLY"
FT   gene            complement(<243691..>244697)
FT                   /locus_tag="KLTH0D02420g"
FT                   /old_locus_tag="Klth0D.mRNA.2881.m"
FT   CDS_pept        complement(join(243691..244410,244482..244697))
FT                   /locus_tag="KLTH0D02420g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.2881.m"
FT                   /product="KLTH0D02420p"
FT                   /note="similar to uniprot|Q870H5 Saccharomyces cerevisiae
FT                   YOL048C Hypothetical ORF"
FT                   /db_xref="GOA:C5DG50"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG50"
FT                   /protein_id="CAR22392.1"
FT                   /translation="MSDAHLVAPLNNNSATAATTAPAEAEVHLVKRLRRETFVQALAVK
FT                   LRRRVSYVRKNFLFGLFVDQTYVYPVLGFLRFVVTPSFWLYSFVLAFCFAFIFVTVAVL
FT                   YYLFLLPILLIWAVSTLGPVGFVIVHIQWLLQSNALAITLTNILIAPIFADSIFDATLT
FT                   KLGHAEFLERAKHLPVTSPKQASWRSLEFWLVVFPSKTVSLMFSLSSKVALSMLSLIPI
FT                   VGPTIVNQLLSPTRGFSYGKRFYVLKNLSGSQLKDKFYEHLGQYTAFGMMAGLLELIPI
FT                   MSIITIPSNVIAGALWASNELKKGEMSINA"
FT   gene            complement(<244834..>245499)
FT                   /locus_tag="KLTH0D02442g"
FT                   /old_locus_tag="KLTH-ORF12468"
FT   CDS_pept        complement(244834..245499)
FT                   /locus_tag="KLTH0D02442g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12468"
FT                   /product="KLTH0D02442p"
FT                   /note="some similarities with uniprot|P31379 Saccharomyces
FT                   cerevisiae YAL018C Hypothetical ORF"
FT                   /db_xref="GOA:C5DG51"
FT                   /db_xref="InterPro:IPR007496"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG51"
FT                   /protein_id="CAR22393.1"
FT                   /translation="MIIFLIYVSKFLLFTLLYYFTLFPFVLGISTVLFGPLGITIAVVH
FT                   SMLHVNLYATSVTRVGCLGHAAAILEKLFTDKGTPKENIRRLHQPAYPVVLEKRNWTQS
FT                   LSIFAAKTMAHFIIFSVLLCISLIPIIGIVLAKLLRSAPIGYDYYLIHLARRKALEKRG
FT                   RDEFYREIGKFTAFGIVSGALELIPILSGITITSNFLGSGICVLEQSQSFENSSLSSI"
FT   gene            complement(<246019..>247056)
FT                   /locus_tag="KLTH0D02464g"
FT                   /old_locus_tag="KLTH.mRNA.269AT.m"
FT   CDS_pept        complement(join(246019..246765,246832..247056))
FT                   /locus_tag="KLTH0D02464g"
FT                   /gene_family="HOG000074698" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.269AT.m"
FT                   /product="KLTH0D02464p"
FT                   /note="similar to uniprot|P31379 Saccharomyces cerevisiae
FT                   YAL018C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG52"
FT                   /protein_id="CAR22394.1"
FT                   /translation="MSFTGSLVLSGIGGLVFKYGGQQSEKEKDVPTGFRDLTLGFIEAK
FT                   GKLIRERSEAVTINFWRELVQTGAYQYPIRGISELFSSGIYFFSSARCFGFYLVLYLTT
FT                   ALLYFLTILPMYLACFAFLGPLGLAVAYVQFLLQSNMLAMMVMRTTQLNNPLFDECLIK
FT                   NGKEAFVKTALQKPTLPVRFYVPFNTYYFWLNYLPWRIAVYTLGFLSIVALLSISFIPI
FT                   AGPIIFNALISPFIARIYFSRFLRLKKLDNKQRNDEFYLNFGTYVSFGFVAGQLEVLPF
FT                   VSGFTYSSNMVGSGLFAIKTLDSESLVPVTLESHLENARTFS"
FT   gene            <247566..>251237
FT                   /locus_tag="KLTH0D02486g"
FT                   /old_locus_tag="KLTH-ORF12464"
FT   CDS_pept        247566..251237
FT                   /locus_tag="KLTH0D02486g"
FT                   /gene_family="HOG000093968" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12464"
FT                   /product="KLTH0D02486p"
FT                   /note="similar to uniprot|P31374 Saccharomyces cerevisiae
FT                   YAL017W PSK1 One of two (see also PSK2) PAS domain
FT                   containing S/T protein kinases coordinately regulates
FT                   protein synthesis and carbohydrate metabolism and storage
FT                   in response to a unknown metabolite that reflects
FT                   nutritional status"
FT                   /db_xref="GOA:C5DG53"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG53"
FT                   /protein_id="CAR22395.1"
FT                   /translation="MPCTSPPLSPTKNEQVEREAVRMAAQNKVKADETDEKQHANNSGG
FT                   MGDYKPTGALGGAANLGPLSTQPLSSSDSDVRELLTFPNESTHAYSYNPLSPNSLAVRL
FT                   RILKRSLEIMIRNPTLLQENRSGRHLRVETPNGTQKEFRFSTDSAISPKKRPQFSRSYS
FT                   HEGVTPLSTSKLRNASSAALSALVTNAKGPSVAELSESSQPWTRPIAPFHSSQTSPRSA
FT                   AGRFASPYQRVASAEGPSRAQRRSLDANADPNSMPQMNEVEPFYKTGNNTSAELIDAKR
FT                   SELESLLLLLNETLENNSSEKASDLHMISLLNFNKLSLDMDHEEKDKDDASQHSSRYEQ
FT                   TLKRSLLESLAQPFFESSNTASTAGFDESGTLQGQDSFILPDSSFADMRTAPVSNRLLH
FT                   TFVSSKNSSPQAIFTCLQQYPWQFKSANDLACLTFGISQNALKALTLLDLIHTDSRNFV
FT                   LHKIMSTEGQELVFTGEIVAIVQPGESSNDLVWSSVWAKRRDGMIFCVFEKVPCDFMDV
FT                   LLDLDDFSVEHISGGAGLKGLKQQTSNRGNQFSSVEKEKGGKKTVKFPNEVHDVADISI
FT                   SLKKLIEDVESGKVRSVDDDLLPMSIRVSNTINNVRYFTLNHLSLNIPCAISSSILENE
FT                   MKLKIHSLPYQAGIFILDSNNFSMISFNKSISKNMFGMHASELVGQSICKVIPSFAELV
FT                   SFIKIKYPALDITLQKNRGLVLTEHFFRKMQAEMSNNTESFFESIGIDAIHRDGSVLKV
FT                   DIQLRVINSSNSLLWITHSRDVVFENYKTNPSQLLMLKESEVALVGSGTSSRSSMKAPS
FT                   GTIHVDDLPNLKDSLKLDGSTVGSFDSASGDSRDNMEEPPDTPTEDKKQQDSDKLEMHK
FT                   LGDQISAKFDVAKNYVQDKASFVKDKNFKLDENLIMSLKSLSPNKGNGSLASTSPPVPN
FT                   SSSEEAGGQGEVFLSTPEPNIGSLKHVKKFSEFEVLQKMGEGAYGKVDLCLHKKDRYIV
FT                   VIKLIFKERILVDTWVRDRKLGTIPSEIQIMATLNTKPHENILMLLDFFEDDEYYYIET
FT                   PIHGTSGSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLHDNGIVHRDIKDENVIVDS
FT                   NGFVKIIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGEPYEGKPQDIWAIGVLLYTIIF
FT                   KENPFYNIDEILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKINDDKWLEL"
FT   gene            <252131..>253195
FT                   /locus_tag="KLTH0D02508g"
FT                   /old_locus_tag="KLTH-ORF12462"
FT   CDS_pept        252131..253195
FT                   /locus_tag="KLTH0D02508g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12462"
FT                   /product="KLTH0D02508p"
FT                   /note="some similarities with uniprot|Q08215 Saccharomyces
FT                   cerevisiae YOL044W PEX15 Phosphorylated tail- anchored type
FT                   II integral peroxisomal membrane protein required for
FT                   peroxisome biogenesis cells lacking Pex15p mislocalize
FT                   peroxisomal matrix proteins to cytosol overexpression
FT                   results in impaired peroxisome assembly"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG54"
FT                   /protein_id="CAR22396.1"
FT                   /translation="MSSPQVSSTKLLEELLENKAFQPDSHKALESETENQLQDCLNAFL
FT                   KGDCKGCLEKMFQAGLLRGEYLENDPKLWKLYLSACSQIKFDVLEVSLSKVGRSNFSKA
FT                   DVSRAQRILAQEPLCEQMAGVLMYLTCCYKCARADNSMEAMKNLEMASGDYIRKCSECS
FT                   EHSGDTREANQVLELVWFYMFSLQGGRSHKRMSRILYEQLCKSAPAVPRVLQAPSKTNP
FT                   AVTLENQLISRIEALAPEKPNIVQPLQQRKLKPTNSHPFSSDRTSEAIPVLAPVPTIIK
FT                   PDKAASINTSKFKALITRLQPFLNSKSIPVLVFVLLLSLKKAQKVAGLPNKLAHILNVI
FT                   LRRLGGIINIILSI"
FT   gene            <253509..>255377
FT                   /locus_tag="KLTH0D02530g"
FT                   /old_locus_tag="KLTH-ORF12461"
FT   CDS_pept        253509..255377
FT                   /locus_tag="KLTH0D02530g"
FT                   /gene_family="HOG000078539" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12461"
FT                   /product="KLTH0D02530p"
FT                   /note="highly similar to uniprot|P31383 Saccharomyces
FT                   cerevisiae YAL016W TPD3 protein phosphatase 2A regulatory
FT                   subunit A"
FT                   /db_xref="GOA:C5DG55"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG55"
FT                   /protein_id="CAR22397.1"
FT                   /translation="MSGNKQAKNKSGDKDDNGQNSEDLYPLALLMDELKHDDIANRVEA
FT                   MKKLDTIALALGPQRTRDELVPFLTEVAQDDEDEVFAVLAEQLGKFVPFIGGAKFATLL
FT                   LPALEILASTEETLVRDKAVESLNNIAQELSEEQLFHDFIPLIEHLATAEWFSSKVSSC
FT                   GLFKSVLARVKDDKFRKELLALYLQLVQDDTPMVRRAAGKNLPVLIDLLTQNPDLSTSE
FT                   DWDYISSMFQKIVSDTQDSVKFLAVDILVSILKFFNTKHDTTHSKDLLRSAIQLITDEA
FT                   WRVRYMAADRFDDLASQFKSNPEYIEELSGPFLALCEDNESDVRKGVAKQLPGFSKLLG
FT                   DPQVVLKKVLPAVQNLSMDESEIVRASLASEITNLAPLIPKQDAIDSLIPILLNMLKDE
FT                   YPDVRLNIIAKLKVVNEVVGIDLLSESLLPAITELAKDVNWRVRMAIIDYIPLLAEQLG
FT                   VQFFDQQLGDLCLSWLWDTVYSIRSAAVVNLKNLTKIFGSEWSSSKIISRLLKSDSQLL
FT                   ENFVYRITLLSALTELVPVVSTEVTTEKILPFINHLAEDSVPNIRFNVAKSYAVVVESL
FT                   AEEKGKYKDLINKSIISSLEKLCQDSDIDVRYFASQSLEKCQNLLA"
FT   gene            complement(<255490..>256641)
FT                   /locus_tag="KLTH0D02552g"
FT                   /old_locus_tag="KLTH-ORF12456"
FT   CDS_pept        complement(255490..256641)
FT                   /locus_tag="KLTH0D02552g"
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12456"
FT                   /product="KLTH0D02552p"
FT                   /note="similar to uniprot|Q08214 Saccharomyces cerevisiae
FT                   YOL043C NTG2 DNA N-glycosylase and apurinic/apyrimidinic
FT                   (AP) lyase"
FT                   /db_xref="GOA:C5DG56"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG56"
FT                   /protein_id="CAR22398.1"
FT                   /translation="MVMRTRRAKRARVEVEYEGGEESKYFKKEKPAAEVVPERPKPGPP
FT                   EDSKVDVEMVKKMGSDTYYDWVNARTKDEITYAPLKDEPHFPRNFVPIYSKIRLMRSKI
FT                   ETPVDHVGCAMIPMTVGHEFGIEQEQITPRTYRFQLLIALMLSSQTKDEVNAKAMFNLV
FT                   EYCKEELGEPEGVTLDAMFKIDQETIAQLIYPVSFYTRKALYIKKTIELLRDNFDGDMP
FT                   PDIAGLVSLPGVGPKMGYLALQKAWGKVDGIGVDVHVDRLCKMWKWVDPSKAKSPEHTR
FT                   KLLEEWLPYEYWYEINPVLVGFGQVICLPRGKRCDLCMASDVCNAADQKLLQKVRNPKE
FT                   ERKSRGNVSEWVKYMEKSTHAKEVVKEEGDVKIALDQDEIKDA"
FT   gene            <257847..>258953
FT                   /locus_tag="KLTH0D02574g"
FT                   /old_locus_tag="KLTH-ORF12453"
FT   CDS_pept        257847..258953
FT                   /locus_tag="KLTH0D02574g"
FT                   /gene_family="HOG000000773" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12453"
FT                   /product="KLTH0D02574p"
FT                   /note="similar to uniprot|Q08213 Saccharomyces cerevisiae
FT                   YOL042W"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG57"
FT                   /protein_id="CAR22399.1"
FT                   /translation="MFTRKLLPVSNSALKPSLPEIRNSVSRSTFTLMTYNMLSPYYMWP
FT                   QVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYEGFWKNHFKTKMNYGS
FT                   SYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIGLFNISELNYLKSTI
FT                   ITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVNTHLYWKYDEVKLCQ
FT                   CLTIMRKLHRVIKSLLMGMEGVTYSKVKILFAGDLNSAPDSPVIKFLKGESVHRADLSL
FT                   INPLRPYLNRYIYQDTSADLFEHTCYSGKLKGIFDYIWYHDKDFRLKRILSGAEVSQEL
FT                   RELQEFGLPNKDHPSDHIPVLAELELLD"
FT   gene            <259063..>259707
FT                   /locus_tag="KLTH0D02596g"
FT                   /old_locus_tag="KLTH-ORF12451"
FT   CDS_pept        259063..259707
FT                   /locus_tag="KLTH0D02596g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12451"
FT                   /product="KLTH0D02596p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG58"
FT                   /protein_id="CAR22400.1"
FT                   /translation="MKRIQIITTHKHSYQKRAATEMLGMGLNLQTNVTHANNDKQTVSL
FT                   QDAPHRLLQQHQETILRDARIRLNSKKSFMDDEFYLPEMTPFGVSRIPSENGRGFASPA
FT                   NMRAVPKSGYPLAQTHKKAKENSLKAMQASEANGRALEQQFYQNQLAAAVQQQQQQQQQ
FT                   QQQQQQQQQQQQQHHQQQIHQHNPYLTNNGFRGYSMQQEACVMDGPRNWQH"
FT   gene            complement(<260346..>261161)
FT                   /locus_tag="KLTH0D02618g"
FT                   /old_locus_tag="KLTH-ORF12449"
FT   CDS_pept        complement(260346..261161)
FT                   /locus_tag="KLTH0D02618g"
FT                   /gene_family="HOG000247849" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12449"
FT                   /product="KLTH0D02618p"
FT                   /note="similar to uniprot|P31377 Saccharomyces cerevisiae
FT                   YAL014C SYN8 Endosomal SNARE related to mammalian syntaxin
FT                   8"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG59"
FT                   /protein_id="CAR22401.1"
FT                   /translation="MEVLKISYGVEKLQGLVDERRRLVSVLKMKPSTNDTINMKRQMNA
FT                   VLDSLQAAANAATSEDFVQLNALIEKYNDAVADIPDDSLDKELYKFASIDKPPETAISK
FT                   LPEPKKVRFKDDVLEYDESTQDAPTAFAPYSDDVSDEERLEHDKTRLFQTGSSESTGLD
FT                   GLAVAPQLSNQELFIQQQQQLLEQDSHLDNLSRSVHSSHVLSLDIHHEVADQNDGVLQD
FT                   LESLVNNSGRNLDRAKKRLRIFENTARENGPCFIIVVLFVILIVLLIIL"
FT   gene            complement(<261313..>262701)
FT                   /locus_tag="KLTH0D02640g"
FT                   /old_locus_tag="KLTH-ORF12447"
FT   CDS_pept        complement(261313..262701)
FT                   /locus_tag="KLTH0D02640g"
FT                   /gene_family="HOG000157415" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12447"
FT                   /product="KLTH0D02640p"
FT                   /note="similar to uniprot|Q08208 Saccharomyces cerevisiae
FT                   YOL041C"
FT                   /db_xref="GOA:C5DG60"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG60"
FT                   /protein_id="CAR22402.1"
FT                   /translation="MGSIDKLFGPAASKVESGLSKLFGSSAGPVDVAKVKSKIRTVLPG
FT                   VEPEAKPETKEASAEASTEQGSQGEGESGSEEGAKPAKRGLEAEEAPAQPKKLSKRQKR
FT                   KALDADNENLESEYYSKLLEKEQGEAEETSAAEPESKDGEAEASVQATAASASRKDLKE
FT                   EELQKAERTVFVGNVPVDVVTSKPLKKQFKKLFAVAKKHSGGDDSDEDKATGPDTFAVE
FT                   SIRFRSISFEEALPRKVAFVQQKLHKSRDSANAYVVYAEKAAVKAACQTLNGTVFYDHH
FT                   LRVDSVAHPAQHDNKRSVFVGNLDFEEAEENLWKHFEKSGEIEYVRVVRDSKTNMGKGF
FT                   AYVQFRDFQDINKALLLNDQKLNGTGRKLRVTRCKNMKKTQPSSQKHPKALTDDQRTKL
FT                   GRAKKVLGKADRSTVGKDVTIEGLRATKGASTPILKKKKQRSKSGRVTKRSTAFKKANA
FT                   SNSR"
FT   gene            <263089..>265008
FT                   /locus_tag="KLTH0D02662g"
FT                   /old_locus_tag="KLTH-ORF12436"
FT   CDS_pept        263089..265008
FT                   /locus_tag="KLTH0D02662g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12436"
FT                   /product="KLTH0D02662p"
FT                   /note="some similarities with uniprot|P31385 Saccharomyces
FT                   cerevisiae YAL013W DEP1 Transcriptional modulator involved
FT                   in the regulation of structural genes involved in
FT                   phospholipid biosynthesis also participates in regulation
FT                   of metabolically unrelated genes as well as maintenance of
FT                   mating efficiency and sporulation"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG61"
FT                   /protein_id="CAR22403.1"
FT                   /translation="MLTKTADENRLTKENLALVDAASATEDRKKSSNEDDKSSVLSKID
FT                   SKHSGDLDLSEYCVSSDAETEKMDEESVSQRNSEHPVLSELAGASAPGDAGAAESGETN
FT                   GAAAGNAAVESTPKAPEQHSPREEAAAPAVEEPTVSAVNEGVAAAAAAAAVDPPNEPEK
FT                   AIMTAAPAEQPVDITGSGSLGEPPAAGGPSTEVAVSEPTITEPAAEPAAEPVAEPAAIE
FT                   EQAAVPEQILQEAVPPVESPVVDPLKPSSPVPPSEEPLGPSSVVGPAEVASKQSGPVEP
FT                   VEDTLGLAQGDAAPTKRAHEDEEDHDAHFKKPRPPAHELKHVENNNYDDNDNDNDNDND
FT                   NDNDNDADEDEDEVEEDYQDKTDGAEVLAAAAAGASAAGGPSKVGTGAKKPVPSIKGDG
FT                   NSPMEQETLRMNALREITDIEHQFAELRQRLFESKLAKLQTETQMCLEGSHPALQSYYQ
FT                   KIDSVRDYKLRRAYQRQKYELECIDKETKATRCFIHQDFYRKVADLKHELLVSTTQKWY
FT                   DINKERREMDVVVSDVGYHVPVKIDGKTLSCITGYAAPAQPRREGDPLAEDLQCEGIRF
FT                   RFKNNPVDKLEVIVDRMRFNNELSDLEGLRQFFQGFPGAPGLSGLKDSEIYEDLQSAGR
FT                   PGRA"
FT   gene            complement(<265105..>265533)
FT                   /locus_tag="KLTH0D02684g"
FT                   /old_locus_tag="KLTH-ORF12431"
FT   CDS_pept        complement(265105..265533)
FT                   /locus_tag="KLTH0D02684g"
FT                   /gene_family="HOG000111561" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12431"
FT                   /product="KLTH0D02684p"
FT                   /note="highly similar to uniprot|Q01855 Saccharomyces
FT                   cerevisiae YOL040C"
FT                   /db_xref="GOA:C5DG62"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG62"
FT                   /protein_id="CAR22404.1"
FT                   /translation="MSTAAAPRKRSFKSYSYKGVDLEKMLEMPTEEFVKLAPARVRRRF
FT                   ARGLSSKPAGLMKKLRAAKLAAPENERPAVVKTHLRNMIVVPEMIGSVVGVYNGKVFNQ
FT                   VEVKPEMVGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
FT   gene            <266107..>266430
FT                   /locus_tag="KLTH0D02706g"
FT                   /old_locus_tag="KLTH-ORF12427"
FT   CDS_pept        266107..266430
FT                   /locus_tag="KLTH0D02706g"
FT                   /gene_family="HOG000229897" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12427"
FT                   /product="KLTH0D02706p"
FT                   /note="similar to uniprot|P02400 Saccharomyces cerevisiae
FT                   YDR382W RPP2B Ribosomal protein P2 beta a component of the
FT                   ribosomal stalk which is involved in the interaction
FT                   between translational elongation factors and the ribosome
FT                   regulates the accumulation of P1 (Rpp1Ap and Rpp1Bp) in the
FT                   cytoplasm"
FT                   /db_xref="GOA:C5DG63"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG63"
FT                   /protein_id="CAR22405.1"
FT                   /translation="MKYLAAYLLLNAAGNSAPSAENVKTVLESVGIEVEEDKVSSLVSS
FT                   LEGKSVEELVAEGNEKLSAVPAASGSGAPAAGAAAGGEAAEEDAPEEAAEESDDDMGFG
FT                   LFD"
FT   gene            <267019..>268197
FT                   /locus_tag="KLTH0D02728g"
FT                   /old_locus_tag="KLTH-ORF12424"
FT   CDS_pept        267019..268197
FT                   /locus_tag="KLTH0D02728g"
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12424"
FT                   /product="KLTH0D02728p"
FT                   /note="highly similar to uniprot|P31373 Saccharomyces
FT                   cerevisiae YAL012W CYS3 Cystathionine gamma-lyase catalyzes
FT                   one of the two reactions involved in the transsulfuration
FT                   pathway that yields cysteine from homocysteine with the
FT                   intermediary formation of cystathionine"
FT                   /db_xref="GOA:C5DG64"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG64"
FT                   /protein_id="CAR22406.1"
FT                   /translation="MTVLPSDKFATLAIHAGAHTDVHGSVIEPISLSTTFKQSAPAQPI
FT                   GAYEYSRSQNPNRANLEAAVAALERAQFGLAFSSGSATTAVVLQSLPTDSHAISIGDVY
FT                   GGTHRYFTQVAHAHGVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVAD
FT                   AAHAANPDILVVVDNTFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPL
FT                   YERLRFLQNAIGAVPSPFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFLEASDRVEHVNY
FT                   PGLSSHPAYAVVQKQHRDALGGGMISFRIKGGAGAAARFTSTTRLFTLAESLGGIESLV
FT                   EVPAVMTHGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEKAGAQ"
FT   gene            <268438..>269559
FT                   /locus_tag="KLTH0D02750g"
FT                   /old_locus_tag="KLTH-ORF12412"
FT   CDS_pept        268438..269559
FT                   /locus_tag="KLTH0D02750g"
FT                   /gene_family="HOG000154325" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12412"
FT                   /product="KLTH0D02750p"
FT                   /note="similar to uniprot|Q6B1H9 Saccharomyces cerevisiae
FT                   YOL031C SIL1 ER-localized protein required for protein
FT                   translocation into the ER interacts with the ATPase domain
FT                   of the Kar2p chaperone suggesting some role in modulating
FT                   its activity homolog of Yarrowia lipolytica SLS1 GrpE-like
FT                   protein in the ER"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG65"
FT                   /protein_id="CAR22407.1"
FT                   /translation="MRWLLLAVPALANQLVTLAPEPQLTTSVAPAVSAASLEPSAQAAS
FT                   IFEPKPFWQPILPSQHIPAGLEVRMNLESGLREARLPQEDQDQSYEFSSQFDHARELAH
FT                   SGDFAATDAALDDLLEFSHDYRYGYKIIGHEFPWLAQLLCDSQTPVSTKKICLSMLAAC
FT                   LRNNPPAVELVHQADPHFVSAVFTEMRALAQLPATSDRAVLAKRYLSVVQALAPESSPQ
FT                   IDQDVLLELCRWGDQHVRMKALDIAALLYRDAQPGGSQALAKRSQDTHDVQKWVDEFSS
FT                   GIQQEHVDELHIRNFFNSLYNIKQQMGRNVKVSSGFLDWLSKEAAARKESLGSGLHERD
FT                   PDQLEFDRRLVESRHLVFGNPMAHRAKHFDDEL"
FT   gene            complement(<269632..>270336)
FT                   /locus_tag="KLTH0D02772g"
FT                   /old_locus_tag="KLTH-ORF12407"
FT   CDS_pept        complement(269632..270336)
FT                   /locus_tag="KLTH0D02772g"
FT                   /gene_family="HOG000175561" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12407"
FT                   /product="KLTH0D02772p"
FT                   /note="similar to uniprot|Q08202 Saccharomyces cerevisiae
FT                   YOL032W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR008493"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG66"
FT                   /protein_id="CAR22408.1"
FT                   /translation="MFAAIASGNPLQLSTEVPNSGGLQHTIVLSSTKPKSYSHISLFIL
FT                   PNVTFPSEFAGTVYFKLSPTEEFKLFGYLSAEKPSAIFKVKLPNANMNSAADPGDGLGE
FT                   IDMEDDTPGGGLPSSNISELIIGISIEPKDQAILKLQESKAKQTALQGSSSLVLARSGT
FT                   NSIATPGQLARVYPLLTQQLAAKIVQHAYNYLTGFLDPQGNVSIKRFDTWWDKFKARLE
FT                   NDAQFLDEVTQD"
FT   gene            complement(<270516..>272156)
FT                   /locus_tag="KLTH0D02794g"
FT                   /old_locus_tag="KLTH-ORF12404"
FT   CDS_pept        complement(270516..272156)
FT                   /locus_tag="KLTH0D02794g"
FT                   /gene_family="HOG000252720" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12404"
FT                   /product="KLTH0D02794p"
FT                   /note="similar to uniprot|P48525 Saccharomyces cerevisiae
FT                   YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase encoded
FT                   by a nuclear gene"
FT                   /db_xref="GOA:C5DG67"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG67"
FT                   /protein_id="CAR22409.1"
FT                   /translation="MIDGMRFILARRWNSVLSRPNRLFTSKKSILSKKPVKDIQPKTPA
FT                   RTRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLS
FT                   WCGIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCTKERLDGLRESA
FT                   QKLQPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQ
FT                   VNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEWLPSTPKHIALYHAFG
FT                   WNPPEFIHIPLLTSVTDKKLSKRRGDADVMALRAKGVLPEALVNFSVLFGWSPPREEAA
FT                   KNHECFSLPDLVRLFNLNSLTKGNAKVDEKKLWFFNKHYLTLRLQNPEVLDKMANELLG
FT                   SMQSLYPSVTVSQIRRALGLVGASLNTPNELATDFPYLFSKPQYERNQYVREFIQKQDL
FT                   YQIRALLQKMEGKMSTENSVLTVIERLSRDNGIRKNVVFEAARFALTGSVPGVKLPLLI
FT                   EFLGAEEANLRISEALDKLDSVLCLKGEE"
FT   gene            complement(<272310..>275594)
FT                   /locus_tag="KLTH0D02816g"
FT                   /old_locus_tag="KLTH-ORF12403"
FT   CDS_pept        complement(272310..275594)
FT                   /locus_tag="KLTH0D02816g"
FT                   /gene_family="HOG000141775" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12403"
FT                   /product="KLTH0D02816p"
FT                   /note="similar to uniprot|Q08204 Saccharomyces cerevisiae
FT                   YOL034W SMC5 Structural maintenance of chromosomes (SMC)
FT                   protein interacts with Rhc18p and Nse1p to form a large
FT                   complex S. pombe homolog forms a heterodimer with S. pombe
FT                   Rad18p that is involved in DNA repair"
FT                   /db_xref="GOA:C5DG68"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG68"
FT                   /protein_id="CAR22410.1"
FT                   /translation="MLSSGEERHKYDPNALPRTHNEEDGAPSSKRLKLGEDDLALFRAG
FT                   SIVTLRLENFVTYALTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSTKI
FT                   EDYIKNGEDRSVIEVTLKRDPEAEDRYVASDGTTKVTRVLHRNRKASEYFLNGQSVTES
FT                   AVKRLVSELNIQLDNLCQFLSQERVEEFARLKSDKLLVETARSVDVNMVADLEDLKALQ
FT                   GEELVEAKELELKSSRVLELKATRDKLTASVRALENFKKKKEELGMHEKLLPYVQVKDH
FT                   KVRIKQYKREYEKMRKQLKDLISDKKPFRHTQQLIETETVERNENKKKLEVQLKVSKRT
FT                   FPSYLEKLEHLKEKVRGKQAQLKYYEDRTGKIKDEIVVVEHNLKEEQAKREALPVPDQG
FT                   AFERIQAERKEITDKGVELEQQRTDLNANLVNADYHMDILKRKLQQENESLVSTDRIGI
FT                   LDGKRFEELRNAVLFMRSRPEMQGKVLEPPIMSISVKDPQFASYLGTCTDFATSLALTV
FT                   VDSDSYRTFGDELLNKFRVNIRELSAAPTTSPLPLSELRKLGFQGYLSDFLSGDNGVLK
FT                   MLCQQHKLHTIPVSRTAMSSRLMDYLMKPDESNNLKFRRVIAGNYVYDFKRSAYGRRQI
FT                   FSSEFKVRPCQFFKGSVLTEERKGEIKESMARINGQIQAKKDEVQFITQKIQELRSELQ
FT                   SNKQEDAELHKITSKLNDQKKTIAHCSHRIKALENKLSMLKTDLQQDVTTKINDCRESI
FT                   KSSLREQVKVMSGITQFVAKLQGLQREISLATIEHLEAFNTERSMNEVIGFFNEKEEQL
FT                   RGAYEEAKNKYASMKETDEYRGWMDKIRHYTDAEKTQLADLAEKYQQSNNFDLSFISNT
FT                   IDRLRSEIGMLNQDESVLEIMRQTEAELGELDCVVPRKEAALLEIRRTIQEKRSQLEPK
FT                   LDAIVEKISQNFCALFKNVGSAGAVRLDKPEQFSDWKIEIMVKFRDNATLKRLDSHTQS
FT                   GGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL
FT                   VTPKLLTQLHYHEKVRIHCVMAGAWIPDPIVDHDKIRFGQTSNYVF"
FT   gene            <275812..>277566
FT                   /locus_tag="KLTH0D02838g"
FT                   /old_locus_tag="KLTH-ORF12400"
FT   CDS_pept        275812..277566
FT                   /locus_tag="KLTH0D02838g"
FT                   /gene_family="HOG000001103" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12400"
FT                   /product="KLTH0D02838p"
FT                   /note="weakly similar to uniprot|P31376 Saccharomyces
FT                   cerevisiae YAL011W SWC3 Protein of unknown function
FT                   component of the Swr1p complex that incorporates Htz1p into
FT                   chromatin required for formation of nuclear- associated
FT                   array of smooth endoplasmic reticulum known as karmellae"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG69"
FT                   /protein_id="CAR22411.1"
FT                   /translation="MSRSSRLRTRTVGAERSRSSKRGKSEEELDTYGLVEENGGRPFQL
FT                   IEGLPCSIELPQYASTLTHPLSVKDSAVLYSSMLSSRRTWISSEMFDMLWSKQYLSPSE
FT                   KERLEQEGIDPESVDASAAREKMHKLCDCAMAGGPHAFSVRLFILKNDEIEKKWNDAIE
FT                   QKRRNKADRKNRELEEKKKKQEERKQQQWIKKQEKEHGTSTAADSSRNSGSTDGAKKPV
FT                   KRRSRKEDTTQQRSRSHTPRQRKSVPQSTEDQKMITNLNLMAQKNPELNSLMIVVAGGR
FT                   ASTDQVEEFKKYIEKARKMPVPPGWKPTANASSSTPQKLKSGGSDSSLDRADSVAAPAR
FT                   AAKSLGASQVKSEETAQLSSETNSAGGTAEPRKKRKYTKRKNVDTPVEPEDKSMQLTTF
FT                   QQKYMHNADIVFEYVENPNKRFSLPKDAILEPLEDGESYLMSWILIHNRKELEKYKEKR
FT                   KKTLDKKAKPEKTAEVSTEDSANKEEEDDYDIFEDPKAPDPLFTPMTVKFSNIHKKFQP
FT                   IMTNSVNPAEKVRKRMSNIIERGTRLSGYNLWFQLDAYDDSGFAESLRCDLKDYESGFR
FT                   SKRHRKQL"
FT   gene            complement(<277582..>278958)
FT                   /locus_tag="KLTH0D02860g"
FT                   /old_locus_tag="KLTH-ORF12396"
FT   CDS_pept        complement(277582..278958)
FT                   /locus_tag="KLTH0D02860g"
FT                   /gene_family="HOG000177242" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12396"
FT                   /product="KLTH0D02860p"
FT                   /note="similar to uniprot|P18409 Saccharomyces cerevisiae
FT                   YAL010C MDM10 Subunit of the mitochondrial sorting and
FT                   assembly machinery (SAM complex) has a role in assembly of
FT                   the TOM complex which mediates protein import through the
FT                   outer membrane required for normal mitochondrial morphology
FT                   and inheritance"
FT                   /db_xref="GOA:C5DG70"
FT                   /db_xref="InterPro:IPR022197"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DG70"
FT                   /protein_id="CAR22412.1"
FT                   /translation="MIDYMEHVLRSFEQCTGWNRDNSYENVTATSENLLSFRVPSGVKF
FT                   QVSNKSTPNTFTTFELSNNKVINGSLAYLYTNCQGLENYVSNSRDILLQEASETYRQIR
FT                   PLYPCHSLRSSSDGAKEFGPSSLWYGRMYYPTSTLEAMVVSRSSAQTQFVAKCISSLAN
FT                   ASVLTLYWQKDSGQNCQEWVASTNEGLLGYRILHNFVGSQSKLNTSLYNDSSLSVGGEL
FT                   WFGVLNTTPACSTTLRYCTHSANTGKPLTLTLSWNPLFGHVSSTYSVKTSSGATFSSKY
FT                   DFNLYSIESNLSFGCDLWRRGHTKQLDQRRTEPLDAPNTNSSVFSKERVQKKQGPKEDS
FT                   PMFYHLMAGSTSSQKLIEDLNVTFASSLQKLTKEKSTIQRFENSLIDANFASVWKLSTS
FT                   LRHKNLRVLWEGKYKGFLISAGAEFTGAPLELPSNLAGESKTPALIRPGKFGIQLQYST
FT                   "
FT   gene            <279103..>280044
FT                   /locus_tag="KLTH0D02882g"
FT                   /old_locus_tag="KLTH-ORF12395"
FT   CDS_pept        279103..280044
FT                   /locus_tag="KLTH0D02882g"
FT                   /gene_family="HOG000111152" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12395"
FT                   /product="KLTH0D02882p"
FT                   /note="similar to uniprot|P18410 Saccharomyces cerevisiae
FT                   YAL009W SPO7 Integral nuclear/ER membrane protein of
FT                   unknown function required for normal nuclear envelope
FT                   morphology and sporulation"
FT                   /db_xref="InterPro:IPR005605"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG71"
FT                   /protein_id="CAR22413.1"
FT                   /translation="MDHSLELSTDKIGKLDEPQIEPGNALGNAFPVVKIEEYQDNSDET
FT                   PIKVRRRGGKAQSKPSSPQPASLNISQGATRRRRSSSRTSSKNLKSTTDISPASMIFRN
FT                   LLILEDDLRRQAREQKILKWQFTLFLSALVGIAAAAFYELYFSQESVKGIYKVMLEFVL
FT                   IFILVTVVLFHLSGEYRRTIVIPRKFFTSTNKGIRQFNVKLVKVKSSIPDLCIDLVRWV
FT                   CRKSAVVNLLLSRKCLPARIAEDSWLLRFWTSVALRSQPRIGAVDVKLILNPRAFSAEI
FT                   REGWEIYRDEFWAREGARRRKKVNETSPRKDE"
FT   gene            <280411..>282445
FT                   /locus_tag="KLTH0D02904g"
FT                   /old_locus_tag="Klth0D.mRNA.ml.2.p"
FT   CDS_pept        join(280411..280434,280502..282445)
FT                   /locus_tag="KLTH0D02904g"
FT                   /gene_family="HOG000067326" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.ml.2.p"
FT                   /product="KLTH0D02904p"
FT                   /note="similar to uniprot|P38903 Saccharomyces cerevisiae
FT                   YOR014W RTS1 B-type regulatory subunit of protein
FT                   phosphatase 2A (PP2A)"
FT                   /db_xref="GOA:C5DG72"
FT                   /db_xref="InterPro:IPR002554"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG72"
FT                   /protein_id="CAR22414.1"
FT                   /translation="MMRGFKQKLIKKTTGSSSSGQKKKDKEEAKKTSSGTSSPGSASGT
FT                   SKSAAEKKSASSSSSSKHTKSKTATNNGSEKKSNPPPSSAQNDSPNAAPTSKNKLEVMG
FT                   NINQPSRSSQPTLIAAAALPPSPTTATVSLAVPGTQSSKEPTTASGIEIPRSSHSFERL
FT                   PNASKLNPEADLDLIKTPQRHSSSRFEPSRYTQITKLPHFDDVSPEEQIPLFIAKVDQC
FT                   NTIFDFGDPSFDIQGKEIKRVTLQELIEFVVTNRFAYTEEMYAHVVNMFKNNLFRPIPP
FT                   PVNPIGDVFDPDEDEPVNELAWPHMQCIYEFFLRFVESPDFNHQIAKQYIDQDFILRLL
FT                   ELFDSEDIRERDCLKTTLHRIYGKFLSLRSFIRRSINNIFLQFVYETERFNGIAELLEI
FT                   LGSIINGFALPLKEEHKVFLVRVLMPLHKVRCLSLYHPQLAYCIVQFLEKEPLLTEEVV
FT                   MGLLRYWPKINSTKEIMFLNEIEDIFEVIEPLEFIKVEVPLFVQVAKCISSSHFQVSEK
FT                   VLSYWNNEYFLNLCIENAEVILPIIFPALYELTSQLDLESQSDENGHPTSDPYVLVEQA
FT                   ISSGSWNRAIHAMAFKALKIFLETNPVLYDNCNSLYLTSVKETQRRKVEREENWHRLES
FT                   YVEKLKISGTAGGDESSPQD"
FT   gene            <282956..>283561
FT                   /locus_tag="KLTH0D02926g"
FT                   /old_locus_tag="KLTH-ORF12387"
FT   CDS_pept        282956..283561
FT                   /locus_tag="KLTH0D02926g"
FT                   /gene_family="HOG000141774" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12387"
FT                   /product="KLTH0D02926p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG73"
FT                   /protein_id="CAR22415.1"
FT                   /translation="MSFARPFLFQKTALGQLRKFLSPFSFGKSRLMSSGARAAKAPLYS
FT                   GFVGYKTVGFAAGTSLAMLLSTISSKNIIRSDTILDVKQRNAGLPEEIGLPGQRGKSAV
FT                   SKKVNYRELCLGSVLGLMIGVVVGKISSVLVFVTACGLLSLQWLSNRGLVDKNATWGLS
FT                   KYIVKTGRESVDLNTLIWDKPSFKVPFILTFVLAALNV"
FT   gene            <283762..>284394
FT                   /locus_tag="KLTH0D02948g"
FT                   /old_locus_tag="KLTH-ORF12386"
FT   CDS_pept        283762..284394
FT                   /locus_tag="KLTH0D02948g"
FT                   /gene_family="HOG000212457" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12386"
FT                   /product="KLTH0D02948p"
FT                   /note="highly similar to uniprot|Q06102 Saccharomyces
FT                   cerevisiae YPR107C YTH1 Essential RNA-binding component of
FT                   cleavage and polyadenylation factor contains five zinc
FT                   fingers required for pre-mRNA 3'-end processing and
FT                   polyadenylation"
FT                   /db_xref="GOA:C5DG74"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG74"
FT                   /protein_id="CAR22416.1"
FT                   /translation="MSRIHPDTSNYPFRFEPFLRQEYSFSLDPDRPVCEFYNPREGPSS
FT                   CPNGNSCPNKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFFSKNGYC
FT                   TQSPECQYLHINPSSKIQECEDYRMGFCPAGAQCKKRHIKKTMCPRYITGFCPLGRLDC
FT                   EMEHPPFVIPNELSKLRIKNDDEINTKKQDEEKERRLNAIINGEIIA"
FT   gene            complement(<284533..>285945)
FT                   /locus_tag="KLTH0D02970g"
FT                   /old_locus_tag="KLTH-ORF12384"
FT   CDS_pept        complement(284533..285945)
FT                   /locus_tag="KLTH0D02970g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12384"
FT                   /product="KLTH0D02970p"
FT                   /note="weakly similar to uniprot|Q06098 Saccharomyces
FT                   cerevisiae YPR106W ISR1 Predicted protein kinase
FT                   overexpression causes sensitivity to staurosporine which is
FT                   a potent inhibitor of protein kinase C"
FT                   /db_xref="GOA:C5DG75"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG75"
FT                   /protein_id="CAR22417.1"
FT                   /translation="MRPRVSRWRSSAVRGEPFQRHFLRWGAISPCFPSSRAPLTSPSAL
FT                   QQHTALLPVSTRMDCGHTETPPSSPAVLALRKRRGLDSAVLSTPPAQAKQDTKLFQQQL
FT                   PSPVTPTASSGFPALSPVRPCDADPVREAVSEICSSINNNTDLVNNLSFHTSGHSAVSI
FT                   QQARALLSPIDPIHDPEWKTSSTPLGRGTYACVYDLCNASRQAAFALKVPQTSRKSSHI
FT                   YKEATILSRLQCTRAPLYAPVIPFYGLTLVNKSHHKKLRSNETVPAIVLERMNCSLKHF
FT                   YTYNTEFDNTHWRVLAESLLSGLQLLKSRSVVHGDIKTENILMDFDSDAMPRYYLADFS
FT                   SARVVFAGDTRPPSLETTLEYCAPEQMSQCANSSFETDLYSVGLTLLAAITKAEPYAEL
FT                   MAAMTHGEPGGGASLPQTQWLMSAISKNSPLEFNVLREELWVQWRNELAFLAQILQDRM
FT                   PLEHCLRSLQDI"
FT   gene            <286526..>287836
FT                   /locus_tag="KLTH0D02992g"
FT                   /old_locus_tag="KLTH-ORF12375"
FT   CDS_pept        286526..287836
FT                   /locus_tag="KLTH0D02992g"
FT                   /gene_family="HOG000214828" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12375"
FT                   /product="KLTH0D02992p"
FT                   /note="highly similar to uniprot|P53252 Saccharomyces
FT                   cerevisiae YGR086C PIL1 Long chain base-responsive
FT                   inhibitor of protein kinases Phk1p and Phk2p acts along
FT                   with Lsp1p to down-regulate heat stress resistance via
FT                   regulation of the Pkc1p and Ypk1p pathways phosphorylated
FT                   by Phk1p and Phk2p"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG76"
FT                   /protein_id="CAR22418.1"
FT                   /translation="MPSSALTACGTRFRADGAQRAAAAQTGAHADASRTDASGLAPRVA
FT                   KFSQSQPLNHFRNRGRGLGVYKGKPWNGPPVSPLKKRALFQSTLSVAATSQQQALQLQP
FT                   PNPMHRTYSLRNSRAPTAAQLQNPPPPPSSTKNRFFGKGGLANSFRKNTAGAFGPELAR
FT                   KLSQLVKIEKNVLRSIEVAANERRDAAKQLSIWGLENDDDVSDITDKLGVLIYEMSELD
FT                   DQFIDRYDQYRLTIKSIRDIEGSVEPSRDRKAKITDKIAYLKYKDPQSTKIEVLEQELV
FT                   RAEAESLVAEAQLSNITRSKLRAAFNYQFDSVIEHSEKLALIAGYGKALLELLDDSPVT
FT                   PGETRPAYDGYDASKQIIIDAETALNDWTLDSAQVKPSLSLRHADYDYEGEEDEDEEEV
FT                   ADHEHHWVDEDEPQHEHTTTEATETTTTNTTAAPTTA"
FT   gene            <288113..>290551
FT                   /locus_tag="KLTH0D03014g"
FT                   /old_locus_tag="KLTH-ORF12371"
FT   CDS_pept        288113..290551
FT                   /locus_tag="KLTH0D03014g"
FT                   /gene_family="HOG000074729" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12371"
FT                   /product="KLTH0D03014p"
FT                   /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
FT                   YPR105C COG4 component of oligomeric Golgi complex"
FT                   /db_xref="InterPro:IPR013167"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG77"
FT                   /protein_id="CAR22419.1"
FT                   /translation="MDALDLDKLSTNLARYHTLLSKITTVSQLTKLQSAIENEQSSTAR
FT                   QLDAFLQPSHTNTNQAVRTLELNRARLTQTLSKLHHALESVAESKQLALQVSTRIRAVD
FT                   RERQLVTRVLQFVSHVTSLRQNIFMVHQAIDRSDYKLAAAGIDTILKLPEESVYSEFAR
FT                   RVVPSAEIPEDPQDLLKQWINQLAQVFHDNFVKAAREQDITQLTAVFQLFPLIRKSDMG
FT                   LDLYSKYVCDMIATQSRKVMTSTTSKSPGFFAQALLHLFKIVSTIINEHSKIIAKYYGK
FT                   QHMVHIMAKVQREADMQAGLVLDSFFESRNFKEILQDIRAFKENVSPEEEGLTSNAPSM
FT                   SEVSGIINESSSILQNWSMYCRFFALKWREFSDQSSEDPLTLPAPICDGIFYSKIHSSG
FT                   FLSDLKKLNEFYLNRSFKKSLELEELPSLNEQISKAPLKHDDISSYGFSSIIEDLTVLI
FT                   RSCLVVNVNTGESTLLGQFLDMLVRFLQNEYLIRFLQHRLRQLQPRLTSNVVLKKYVPQ
FT                   TESTMNSRAASPGAVEQSKLSHLRFNFKGAATSAFSNIQSNLQAVYADEETVLKLHQYL
FT                   IYLNTLSIGCVFLQKLLTKELLQDNPQLLPDNFPFGDKSQSLVKKIEATEQTLLAQSSK
FT                   LLQWGVRLLFDGVLQSKIQKILGPLFTQGTETEYLASTANFEDMSHLKQFSDGWLETMN
FT                   PYINVLYKDCYAQLLTYAVDFLVAQISPRLWSLKLNELGSIKLDRELGALIAIVCGEHY
FT                   LLREKFTKLTQIVLIAGFEDDDFDSETSDLKEEVIKGISWVLNPTERIRAGELRVDRRH
FT                   "
FT   gene            <290948..>293524
FT                   /locus_tag="KLTH0D03036g"
FT                   /old_locus_tag="KLTH-ORF12369"
FT   CDS_pept        290948..293524
FT                   /locus_tag="KLTH0D03036g"
FT                   /gene_family="HOG000000999" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12369"
FT                   /product="KLTH0D03036p"
FT                   /note="similar to uniprot|P39521 Saccharomyces cerevisiae
FT                   YPR104C"
FT                   /db_xref="GOA:C5DG78"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG78"
FT                   /protein_id="CAR22420.1"
FT                   /translation="METSVDALTPSGPAAEDPAEERHNSDEHRSPKDEPENFGEPFAKK
FT                   PSRSNSQVAADEAAAEAKRLIDDPNLKLEIPDSLDHEHFSKLLELDSKNDDDLFSSTDL
FT                   LEHEIAEHPEKLANDIAETVPTDDATQHLHSLENLESLGKLSEEAGGDVHSNPGTESPS
FT                   KIKNENQSPSVLVDPVLADDRAIHPDIYNSDPLSTGAGTREDTPASILEDKHELLDDQK
FT                   QDASTKLGYVSLQPPLPENAVNKIEITQPIEPNSELPMTEFHDGANSETEQSKISAYAR
FT                   LDFQSFTFYVQTLQVIIGRRSENDFSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSI
FT                   MGKNGAFVDDTFVERGITVQLKNKAKVQIGQIPFQFVLPDQEGKEKKAIEPVDAISLKT
FT                   ALNNNNKLAEISRSVTPIPIPSGESTELKDEELKDQPAKKKTPPKKKEKKEPKAPKPPK
FT                   KIYTLEEIPPEYRTKPTGSYSNLITACLRKFSSPKGMSLSGIYAGIRELFPYYKYCPDG
FT                   WQSSVRHNLSLNKSFRKVSKEGKGWLWGLNEEYIAEREKQKKKQAEAAAEKAKAAQLKL
FT                   EQQQQQKAKKAAESGSMIKSVASIPARPKVKQPNISQTLAANRADRKATADANQRTMKY
FT                   LQEQLMILTKDRKGLDKHVMASILTQALAMTINQVTQAAKSKGITGNPLTALIDKNPQH
FT                   LNLILAAAVNAATVKVTNGSVKQLVSMPPPTVTAPQERRAASPSTSNIQPTSGGTSNLV
FT                   ASANPGPAATVKSSESFDPTSLSKFFQPKQPSRVPTPSPARSVLPLKRASSETESSSDD
FT                   ESTSGDESGSADSDASDGSDSDDDSSSSSGGSSKGSSSDEGSSDGE"
FT   gene            complement(<293867..>294730)
FT                   /locus_tag="KLTH0D03058g"
FT                   /old_locus_tag="KLTH-ORF12366"
FT   CDS_pept        complement(293867..294730)
FT                   /locus_tag="KLTH0D03058g"
FT                   /gene_family="HOG000091082" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12366"
FT                   /product="KLTH0D03058p"
FT                   /note="highly similar to uniprot|P30656 Saccharomyces
FT                   cerevisiae YPR103W PRE2 20S proteasome beta-type subunit"
FT                   /db_xref="GOA:C5DG79"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG79"
FT                   /protein_id="CAR22421.1"
FT                   /translation="MQAIAEKYSLKSTLATELEYDNEEGLSRDFVTGNSMFQRLAPQIA
FT                   MPPISSPQEFLRAHTDDSQNPDCKIKIAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQ
FT                   TVKKVIEINPFLLGTLAGGAADCQFWETWLGTQCRLHELKEKERISVAAASKILSNLVY
FT                   QYKGAGLSMGTMVCGYTKKEGPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWD
FT                   LSVEEALYLGKRSILAATHRDAYSGGSVNLYHVTEQGWVYHGNQNIETLFWEVKEKEGS
FT                   FNNVIG"
FT   gene            <295808..>297730
FT                   /locus_tag="KLTH0D03080g"
FT                   /old_locus_tag="KLTH-ORF12362"
FT   CDS_pept        295808..297730
FT                   /locus_tag="KLTH0D03080g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12362"
FT                   /product="KLTH0D03080p"
FT                   /note="similar to uniprot|P32581 Saccharomyces cerevisiae
FT                   YJL106W IME2 Serine/threonine protein kinase involved in
FT                   activation of meiosis associates with Ime1p and mediates
FT                   its stability activates Ndt80p IME2 expression is
FT                   positively regulated by Ime1p"
FT                   /db_xref="GOA:C5DG80"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG80"
FT                   /protein_id="CAR22422.1"
FT                   /translation="MGYLGRKHGLKSSTNVPPDVNNPPFYIPVRPIANRYTLMQELGNG
FT                   SFGSVTLAKLAGSEGADKDARGQHDHKRLAASTRQHYHNTLMDDAVVPSIEQENYHNKQ
FT                   RGVLAIKTMMTRLPTLNDYTRVREVKFILSMPAHKNLVQIWELFIDDINYQLHIVMECM
FT                   EQNLYQLMRARRKRVFSLPSLKSILSQILAGVRHIHAHNFFHRDLKPENILISPSSHYF
FT                   SKEWILEGHYSDNYVVKIADYGLARHITNKSPYTAYVSTRWYRSPEILLRKGLYSRPLD
FT                   IWAFGCVVVEVATFRPLFPGSDEMDQIWKILEVLGTPHTMPESTLSGYHPHGGLWEKAQ
FT                   VLASRLNLKFPYVEGVSIESIMDNPHLQPLCDVVKACLVWDPKKRATVDEIFCMPYFEE
FT                   AKPWAEPKGLNDSNTDNCPLNDENLNKGLGLRHYWSGGLNRGSRHPHGENASLAPIEVD
FT                   SNGAKIRGPKETEISFRQFLKESLLPLPMSKETSRGSDGNRLHNEAGPEDVADLPLSED
FT                   SVANISPVSSLNDAENVGVLEPPEVDDSFAAFFVSKSAEFEYPAGAEVAAGNLEPSYIH
FT                   YGDSTDDRIIPHHRCNVLDDMSVDSSGSNRVPRTFAVPRISEECNVSAQASHNHSFSHT
FT                   NSLTF"
FT   gene            <299166..>301421
FT                   /locus_tag="KLTH0D03102g"
FT                   /old_locus_tag="KLTH-ORF12356"
FT   CDS_pept        299166..301421
FT                   /locus_tag="KLTH0D03102g"
FT                   /gene_family="HOG000141785" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12356"
FT                   /product="KLTH0D03102p"
FT                   /note="similar to uniprot|P36124 Saccharomyces cerevisiae
FT                   YKR029C SET3"
FT                   /db_xref="GOA:C5DG81"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG81"
FT                   /protein_id="CAR22423.1"
FT                   /translation="MGGNDISERSVYEDASALLMLSRGKDSSTNHTPLQDIKQPIGSPG
FT                   LRSSSQVHSEPRSPLTSGDVRSRASSISLIQHNSTASPGPAYATLSAEDEDGLSSRMHE
FT                   KTESPSSRSNSNKGIVAAAALAAAATVPLPLRKQDPEHRESKHNSRKSDHSEQRPKRSW
FT                   PVPNSYVVDPDSGIITCICGYDDDDGFTIQCDHCNRWQHAICHGIRNIETAPDDYLCSN
FT                   CHPRKLDVKRAKRKQQERLNPRNNKKRRKSSQGEESSGKSNSSHASDSANTSVNNLGGN
FT                   EVASSAELKPTQRHLNSLEHHPVVYVPLTANDFKDRYVEMFVERHCDDDWVLPYSHRIF
FT                   QPVPLEVKSCSESSRSFTGLPKLGLFAKQPCTVGSYIEEVVGEVDFTKKYYGDSRNNYR
FT                   VCGTAKPKVFIHPHWPIYIDCRLSGNLTRFIRRGCQPNVELVSVHLNGDAPQVKFVLRA
FT                   LKDIGDGDELQIGWQWDLRHPIWHLIKGDNKSVDSLDDPDKFTLVHSVDTILSCADCAC
FT                   GAHNRDCYLLKVKKFSQSLIKSVKSKMNGRYKLNEVLQNAQNKNKKLQTPILSRLAHEA
FT                   ISNAARANELLVDFHAAKLKYLKEEGIPVSQLISRQPSLSDTENFDHAKPFKLYLVNKH
FT                   FTTLRGGGEQENHRPSITTGTSNSLRYDESHITDLKSLPLPVELQLPRLSSMGEKALSI
FT                   RENSNGDVAPELSTKAPVTPSVALPAVAVAAGPAINSRHTLKKKLSFADYKKKMKPI"
FT   gene            <301688..>302095
FT                   /locus_tag="KLTH0D03124g"
FT                   /old_locus_tag="KLTH-ORF12350"
FT   CDS_pept        301688..302095
FT                   /locus_tag="KLTH0D03124g"
FT                   /gene_family="HOG000180095" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12350"
FT                   /product="KLTH0D03124p"
FT                   /note="similar to uniprot|P42949 Saccharomyces cerevisiae
FT                   YJL104W"
FT                   /db_xref="InterPro:IPR005341"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG82"
FT                   /protein_id="CAR22424.1"
FT                   /translation="MAHRALFQVIFTGAQVFGRAFSEAYKQAAVQATKTGANAARAGAA
FT                   KAEYGGITLDESCKILNIENEADMASPEKIEERFKYLFDVNDKEKGGSFYLQSKIYRAA
FT                   ERLKYELAEKQQVDKAAEGQKGPEKPPSAEQ"
FT   gene            complement(<302961..>304298)
FT                   /locus_tag="KLTH0D03146g"
FT                   /old_locus_tag="KLTH-ORF12348"
FT   CDS_pept        complement(302961..304298)
FT                   /locus_tag="KLTH0D03146g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12348"
FT                   /product="KLTH0D03146p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DG83"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG83"
FT                   /protein_id="CAR22425.1"
FT                   /translation="MSSDIGKTELLAKLERLDQEINDYFDLTLDKARLRYKRVGRGNKV
FT                   KVVDKIQEKRVAVQKWRDSVKTDYETAVTKFKRAWDLLQNNPELDLCAVTDNLGNSRIF
FT                   QVHKLGAVLENVSLTNLEVSALKQHDTEFPRTLASMGASKEDYDGFLEWQVNILGRSAT
FT                   LYEQLPKVYWNSHKYQWSKNSYRICATAKNLGSYATYCKFFSKLGICTNANCKFVHDPR
FT                   NIAACKDFLASDNCKYGSKCRLSHKLGNEYVTPHCKDFAQRSCKFERGAEQWTQSREQD
FT                   SAVCCRYIHSTIVNSSYPVCRQFAHMGFCYRGLHCKFPHYLECPDSNYTSTCFLNHCKF
FT                   PHIERKVLPDERAVALIDIPSSCLLLPPAREKDHRAPNSSWYGLRTKQQSINIKDGPGE
FT                   KFTTEAVPALQLEPGSSTDDVSSSEVSSTGSSDISSDELDADFIKL"
FT   gene            <304459..>306024
FT                   /locus_tag="KLTH0D03168g"
FT                   /old_locus_tag="KLTH-ORF12347"
FT   CDS_pept        304459..306024
FT                   /locus_tag="KLTH0D03168g"
FT                   /gene_family="HOG000141760" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12347"
FT                   /product="KLTH0D03168p"
FT                   /note="similar to uniprot|P36119 Saccharomyces cerevisiae
FT                   YKR023W Hypothetical ORF"
FT                   /db_xref="GOA:C5DG84"
FT                   /db_xref="InterPro:IPR009349"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG84"
FT                   /protein_id="CAR22426.1"
FT                   /translation="MGKSSAISFAVREIPHIIPIDEESARQLCEQILSEYGEDPQAIAE
FT                   KFMDILGPEDASLNFVLQFTEKLSHEESEKASKSALSPKPSTKNDTFASRSGRQGVNKP
FT                   ESAELRKSEEPSGVPAAPKANAPRKAVVRPSTRPNPKESSKKASKTRKVQSLTEIDDIL
FT                   KALELEQTESDPTKYACNCQGTRHPLFEVAPNCLSCGKIICLREGLNLNHCTFCHTEFL
FT                   SAEERAQIIEVLNQEKQDLESSKPVAALEKPKKPKGYKITSGAGTNLFSEQDKLFDRVE
FT                   KERQRELKRAEVLEGIDKEQSKAMHSQNGEDNADPELKVAQERLEKLLHFQDTSAQRTK
FT                   IIDNASDFSMSNDGSVWGSAQDRALLLKKQQRNMRRWEKLERERHGGRDKVVMDLSIGK
FT                   DGKVTMTEARRAPKTAHAFDEENVEDISDEEDLQDLQEITELKSTLMDEKKRIDKDLES
FT                   NVWDPEKDKKQFQKPVYVNNESEISPEKGKPEKDGTRDRGWKNRVQISQGDENSLEQNI
FT                   LAVL"
FT   gene            complement(<306459..>308609)
FT                   /locus_tag="KLTH0D03190g"
FT                   /old_locus_tag="KLTH-ORF12343"
FT   CDS_pept        complement(306459..308609)
FT                   /locus_tag="KLTH0D03190g"
FT                   /gene_family="HOG000268799" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12343"
FT                   /product="KLTH0D03190p"
FT                   /note="similar to uniprot|P36120 Saccharomyces cerevisiae
FT                   YKR024C DBP7 Putative ATP-dependent RNA helicase of the
FT                   DEAD-box family involved in ribosomal biogenesis"
FT                   /db_xref="GOA:C5DG85"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG85"
FT                   /protein_id="CAR22427.1"
FT                   /translation="MSDDDGMMLLNLDTTSSVDQTPGKVKVSGGRWKDRRKAKAMLNGK
FT                   SVNSKDDRLVTSGSVKRPVSTEQGVEERKEQPARKQAKKVQIKATPADQQIVSSLFTSN
FT                   RGIVTSINNNVHDENSGVGPSNAPLLQDSFEALGITSPLLQHLSEVMHITKPTRVQKMS
FT                   IPTLLEADNDVFVHAQTGSGKTLAFLLPILSRILSMGARVDRQSGCFGMIITPTRELAS
FT                   QIHSVMLTLTKCCHYLIPCLLIGGERKKSEKARLRKGCNFIIGTPGRILDHLQNTQVIK
FT                   EQLSSSLRYLVLDEGDKLMELGFEETITQIIKFLYEVPLNHFKYPELPKRIIHVLCSAT
FT                   LKGGVNKLGNLALQDYKLISSGRKQQEVNTVPDQLIQKIVMVPPKLRLVTLAAELNNIT
FT                   VRHLASETGETRRTIVFLSCSDSVEFHYAAFSSDSGHGRALVGDSVKVLSGNSTSLPCL
FT                   ADVSQPSVVCYKLHGSLSQQIRTATLKSFSSDSDATKGKHLIMFCTDVASRGLDLPCVS
FT                   SVIEMDPPFAVEDHLHRIGRTARAGVSGESLLFLLPGEEEGYMDHIKPHHPQGWKLLKY
FT                   DVDILKPAFMESKVQRSDGVSGKPISDEWDNNATTWHLNIERRVLGDPTFKEIAAKGYT
FT                   SHIRAYATHLSQEKKFFSIKCLHLGHLAKSFALRERPKVMGGMNAKNSANGEQKKPKET
FT                   SKSKMLRMAKKALDQSMSEFNY"
FT   gene            <308786..>309532
FT                   /locus_tag="KLTH0D03212g"
FT                   /old_locus_tag="KLTH-ORF12339"
FT   CDS_pept        308786..309532
FT                   /locus_tag="KLTH0D03212g"
FT                   /gene_family="HOG000074717" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12339"
FT                   /product="KLTH0D03212p"
FT                   /note="similar to uniprot|P36121 Saccharomyces cerevisiae
FT                   YKR025W RPC37 RNA polymerase III subunit C37"
FT                   /db_xref="InterPro:IPR006886"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG86"
FT                   /protein_id="CAR22428.1"
FT                   /translation="MSEQIENQLFVTEDSGDVVMEDANLQESEEGDPIVREIPINLTNG
FT                   PFPLHILQYPNKPKKNGNDPVLHPPVSQVRYKSKSSLWELDVPVNTEIFYDKNRAEDEW
FT                   DSVAQQTLKGVGVQTEGQYVGMVVDEEVYLLPVQAVAQMRPFFKYIDTVAQSKRENEAR
FT                   GAQPSNPAARRAQVVTMSVKSSSEANQPRLGGALLAHKVADEEPPQDLEWIEGTFNQFR
FT                   ESVITEDSRTMMLPLGDENDYLSKAM"
FT   gene            complement(<309575..>310492)
FT                   /locus_tag="KLTH0D03234g"
FT                   /old_locus_tag="KLTH-ORF12338"
FT   CDS_pept        complement(309575..310492)
FT                   /locus_tag="KLTH0D03234g"
FT                   /gene_family="HOG000175731" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12338"
FT                   /product="KLTH0D03234p"
FT                   /note="highly similar to uniprot|P14741 Saccharomyces
FT                   cerevisiae YKR026C GCN3 Alpha subunit of the translation
FT                   initiation factor eIF2B the guanine-nucleotide exchange
FT                   factor for eIF2 activity subsequently regulated by
FT                   phosphorylated eIF2 first identified as a positive
FT                   regulator of GCN4 expression"
FT                   /db_xref="GOA:C5DG87"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG87"
FT                   /protein_id="CAR22429.1"
FT                   /translation="MSEEFNITETYLKFLEEDSEMTMPIAAIESLVTMLRVKNPETSAE
FT                   MINTIKSAADTLTSSIPNSMSLRAGCDIFMRFVFRNTHLYGDWESCKKHLIENGQLFVS
FT                   RANRSREKIAQIGLDFISDDDIILVHGFSRAVYSVLSHAASKFIRFRCVVTESRPTKQG
FT                   AQLYKLLQEKNIPVKMVVDSAVGSIIHKVDKVLVGAEGVAESGGVINLVGTYSIGVLAK
FT                   NTNKPFYVVSESHKFVRMFPLSPDDLPATAGPLDFTRHEDCEQSLLEPAIDYTSHEYIT
FT                   ALITDLGVLTPSAVSEELIKMWYD"
FT   gene            <310691..>313087
FT                   /locus_tag="KLTH0D03256g"
FT                   /old_locus_tag="KLTH-ORF12337"
FT   CDS_pept        310691..313087
FT                   /locus_tag="KLTH0D03256g"
FT                   /gene_family="HOG000231587" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12337"
FT                   /product="KLTH0D03256p"
FT                   /note="similar to uniprot|P39677 Saccharomyces cerevisiae
FT                   YJL102W MEF2 mitochondrial elongation factor G- like
FT                   protein"
FT                   /db_xref="GOA:C5DG88"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG88"
FT                   /protein_id="CAR22430.1"
FT                   /translation="MRLPRLKLWSQCRHIASRTDVTKLRNIGIIAHIDAGKTTTTERML
FT                   YFSGKTKRIGNVDEGDTVTDFLPQERSRGITIQSAAITFNWQNSFGINLIDTPGHADFT
FT                   FEVIRSLKVLDGCVTILDAVAGVEAQTEKVWSQAKGIPKICFINKMDRVGAGFSRTVKE
FT                   LIVKMNTRVLLINIPVFSQPGPTMEPIFEGVLDVVNKTVLRWTATDVNLVNIEDVTSDS
FT                   PHWNELVKLRESLIETLSEYDEDLVEYFLETANGDYMAIPAKKIDHSVRKCSLANFATP
FT                   VLCGASFRNIGVQPLLDAVIKYLPSPVEARLPDFNHNLPVEVSNKKGVVVNKNHNLCVA
FT                   QAFKVITDPIRGIMVYVRVYTGVLNSGFAIFNSTTGAKFKVGKLVIMHANVAEEVKQLN
FT                   AGEIGVLTGSTVSENVRTGDTIIAHNMKRDGLRSLNKEKELSLKINPIITPPPVFSAAI
FT                   EPRTLGNRKAMEESINALIREDPSLRVSVDEESGQTLLSGMGELHLEIAKDRLLNELNA
FT                   DVEVGKVVVSYNETLNVSSPLQEHKSEDGYHFGIQVEPLEVATETRNENEEWHYLSNDN
FT                   NYLVMEKGAHRLKESNWPYQIPYDSIVNAILSSCLVAFQRGGKRARFPLHSCVVRVKSD
FT                   WSIPPDLNSVTPILKISKSMILEGLDKIADRDYSILEPIMNITVTVKQQDMGQVLQDLT
FT                   GACKANILSIEDEHDVSSEENFDLTFQKIAEEQYLPSDNTMDKANISSGSSINKIIKAL
FT                   VPVGEMVSYTSKLRSLTQGRGSYHMEYSGMEKVTGDRLPMILENY"
FT   LTR             314187..314449
FT                   /locus_tag="KLTH0D03278t"
FT                   /old_locus_tag="Klth0D.LTR.4"
FT   gene            <314511..>314600
FT                   /locus_tag="KLTH0D03300r"
FT                   /old_locus_tag="Klth0D.tArg.ACG.1"
FT   tRNA            join(314511..314547,314565..314600)
FT                   /locus_tag="KLTH0D03300r"
FT                   /old_locus_tag="Klth0D.tArg.ACG.1"
FT                   /note="tRNA-Arg (ACG) cove"
FT   gene            complement(<314732..>316684)
FT                   /locus_tag="KLTH0D03322g"
FT                   /old_locus_tag="KLTH-ORF12332"
FT   CDS_pept        complement(314732..316684)
FT                   /locus_tag="KLTH0D03322g"
FT                   /gene_family="HOG000199354" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12332"
FT                   /product="KLTH0D03322p"
FT                   /note="similar to uniprot|P32477 Saccharomyces cerevisiae
FT                   YJL101C GSH1 Gamma glutamylcysteine synthetase catalyzes
FT                   the first step in the gamma-glutamyl cycle for glutathione
FT                   (GSH) biosynthesis expression induced by oxidants cadmium
FT                   and mercury"
FT                   /db_xref="GOA:C5DG89"
FT                   /db_xref="InterPro:IPR004308"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG89"
FT                   /protein_id="CAR22431.1"
FT                   /translation="MGLLSLGTPLEWPESRQYNDHVRKNGIEQLLYIFLAANGRKNDPL
FT                   LWGDEIEYMMCKIDDAGRNAVLAVDDDDVLCALNTEDVGVCQAHNTSFHPEYGRYMIEA
FT                   TPARPYTGFMSNYVEENMGERRAIVDSKLEKRGVELLSLAVFPRMGCPGFTDLSESWDH
FT                   HNSASRSLYLPDEIINRHARFPTLTANIRTRRGEKVCMNVPMYKDKRTPDHDDTVFVRD
FT                   WFTIEDKEGPLASKPGHIYMDSMGFGMGCSCLQLTFQAPTVDKARYLYDSLVNFAPIFL
FT                   AATAASPAFKGWLADQDVRWNVISGAVDDRTPYERSTEPLLPEYNNGNGKSLNEHPMRI
FT                   PKSRYSAVDLYLGGNSFFDREFNDTDVPVNQEVLERLQSNDIFPMDFDLARHFSHLFIR
FT                   DPLVVFQERVDQDNKHSTDHFENIQSTNWQTLRFKPPTQEATPENKKCPGWRVEFRPME
FT                   IHLTDFENAAYANFIYLVVECLLTFSDDINAYVPMSEVWKNMEIAHRRDAVLDEEFYWK
FT                   IGFNKEGTRKLSFTEIFHHPESGIFPQFIDRILVHKGFVSSSWTELKNSRQSAHLRLYY
FT                   YLKLISDRATGALPTTARFLRDFILNHPDYKEDSRLTSVINYDMLKLASRLTHLDDTNG
FT                   ELTRFFGEEIVQFLR"
FT   gene            <317628..>319313
FT                   /locus_tag="KLTH0D03344g"
FT                   /old_locus_tag="KLTH-ORF12326"
FT   CDS_pept        317628..319313
FT                   /locus_tag="KLTH0D03344g"
FT                   /gene_family="HOG000165420" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12326"
FT                   /product="KLTH0D03344p"
FT                   /note="similar to uniprot|P42951 Saccharomyces cerevisiae
FT                   YJL100W LSB6 Phosphatidylinositol 4-kinase that binds
FT                   Las17p which is a homolog of human Wiskott-Aldrich Syndrome
FT                   protein involved in actin patch assembly and actin
FT                   polymerization"
FT                   /db_xref="GOA:C5DG90"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG90"
FT                   /protein_id="CAR22432.1"
FT                   /translation="MAQQSNNLGNANQVVTTNTYDWLQNREQQERLSDTAHNSTAFIGT
FT                   LGRWTSFVWHGGDGTPSRLTLGEEHYEIQYSVFEPLRGYTEIPVLPDRDALTQHFRCVV
FT                   KDCVDAITNYNIELQRIKAGSSGSYFVYGTGDSQTPLGVFKPKDEEPYGPLSPKWTKWA
FT                   HRTFFPCFFGRSCLIPNLGYICESAASVLDELLGTGLVPHTDTIVLMSQNFYDKRRAWF
FT                   ATEPRKLQKSGSFQLFVKDYVGAGEFLDKHPFPGMFRERVDHKQEEEFHWNAQTLQTFR
FT                   LKLEKLIILDYIMRNTDRGLDNWMIRVRKLSDNTWDLELAAIDNGLAFPWKHPDEWRSF
FT                   PYGWLYLPVNILAQPFSESTRRHFLPLLTNKKWWENCHSQLREQFSRDAEFKTRMWKKQ
FT                   WSVLKGQAFNVVETLKNPTQGPLELVRRTRTLVIDEIMQVPSSTLPLAIIQSAMRESIP
FT                   FSPSSPMVLSSLPEEGTNSGTAKDFISQRPNFTEHLQEVGEGGRPMTGESRVHNTKPST
FT                   TTDAQHGPSEEGTSVGIQASYKTKKVVIERLMLVNSKPPVFTWW"
FT   gene            <319479..>321656
FT                   /locus_tag="KLTH0D03366g"
FT                   /old_locus_tag="KLTH-ORF12324"
FT   CDS_pept        319479..321656
FT                   /locus_tag="KLTH0D03366g"
FT                   /gene_family="HOG000095187" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12324"
FT                   /product="KLTH0D03366p"
FT                   /note="similar to uniprot|P36122 Saccharomyces cerevisiae
FT                   YKR027W FMP50 The authentic non-tagged protein was
FT                   localized to the mitochondria and uniprot|P40955
FT                   Saccharomyces cerevisiae YJL099w CHS6 chitin biosynthesis
FT                   protein"
FT                   /db_xref="GOA:C5DG91"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG91"
FT                   /protein_id="CAR22433.1"
FT                   /translation="MNILPWRKKNASSVAVNEHPRDALFKDDDHLVQKLGANLEENPRI
FT                   LEVKFGESFGIRGRLLRTLAEQDLLGIGPPDMAHVTQFDRFHQTETGEYHYLTGLDTSS
FT                   EATPIAYLNTLKLAGGSSKNKNRVSTYCCTNVFSNVDIRIRYESPKHYQINVIDCISGS
FT                   SNIQLTPALWEEAFVSGFVRSIITNMDRERKLPGLVELPFALENGLAYCKKCISLVCRY
FT                   LPRGPELGCDMTKHSFPSYKNNYILDSLLSLLQVANKLNGFVVGTLEDLCMQDPENSVC
FT                   YKTAMAAVLIKSEAKDIVAIQTINSSMQNLFPNGLKDLEQSQLIHAADLLNLQIDFLMV
FT                   RGDFALALPLAQKVTSICSDGFEAWNKLARCYVELGNHEQALFAINSLPALPSSDPCKD
FT                   AMLQEAAKEHFYNRPLCSTPRSRLQSNEYHFISSTLGSVKDHDLTSMIYGRIVMPPQAK
FT                   RGCIKEIWEGPCVELGPIYGPQSKNLINFVSPQEVASLGDKNLLARNSMASQLSWSMTC
FT                   AYDLLVHIISKIGWNSLLELRSSIFVMERERGLGDAGVLRPEFKAKRLCEKWLDQLFLN
FT                   LYEDLKITFNSQEHREELYSGLEWELLGLTHLRTWLWADAVACLRTSIMARFDPVSAEK
FT                   LLDLYLTRRYPSSDVLDQDVLLALVVDKISYESRFYNFLNLADLRVLIDLSASSGVDTV
FT                   RNHIYTLPSAQTGIVALTDKLLNYVQELNDD"
FT   gene            <322117..>325185
FT                   /locus_tag="KLTH0D03388g"
FT                   /old_locus_tag="KLTH-ORF12323"
FT   CDS_pept        322117..325185
FT                   /locus_tag="KLTH0D03388g"
FT                   /gene_family="HOG000248046" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12323"
FT                   /product="KLTH0D03388p"
FT                   /note="similar to uniprot|P36123 Saccharomyces cerevisiae
FT                   or to YJL098W uniprot|P40856 Saccharomyces cerevisiae
FT                   YJL098W"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG92"
FT                   /protein_id="CAR22434.1"
FT                   /translation="MSGSFWKFGQNYASESPLSKLLNRAFIKVSSEEGAQDKQQDNDSQ
FT                   EKINRLLASPGGSSSDGSESLEKSDADAEHGSADQNNALPDSEAEYRDYEPNMEVLDEL
FT                   LDDEELYTELMCSNFKLLIFFKYPQVLAKLVDYVTNEHVLSESLEESEEEDEKPISDAP
FT                   KSGADDSEEPQNKESLGGDKNDREPMSDQLSVSSNETSITLPPDSEEQSDSRRARMAAE
FT                   ILSADVWPISSAFMDHEELLGRLWAMLDHPAPLSIVASTYFMKINERLLDMDISGMLHF
FT                   ILAQDDLVDRFLKHTDNPPLMDYLLKVISTDKPDTSTGVIEKLGSQELIPKLLDHLAAG
FT                   HSSSTKSAAGDFLKALITISANSNNEIASAIGPNGLTRELVSPPMVEKLMNIMLSGGTS
FT                   LSNGVGIIIELIRKNNSDYDFVQVMYTTLETHPPNDRDPIYLGYLIKCAAEHLPEFNKM
FT                   LVETELPPLETPFGSIEPLGFERFKICELVAELLHCSNMTLLNEPSGGSIVAERDAVRE
FT                   KILQQEKSEGSHKKDENEDVLQKMSDLRIAATNSENSSDEDGIQTKEDADAAGEEIQSE
FT                   GSSENELSEKSLRENPVVGDQLKIALQDNRVITSILEMFFDFPWNNFLHNVVFDIVQQI
FT                   FNGPLKTGFNRFLIADLFTGAKLTHMIMDGDRKCEDYENETGLRLGYMGHLTLIAEEVA
FT                   KFAAYVDEMKITFSNSAIVESLNEPRWKEYTETVLADTRENYSSVLGDFEEEEDDHEDP
FT                   DIEDENPGGKTSVTGNDEGDGYRDFDNGAGSTGNYTEYDSVDNPRYYQYEDEHGNKTEL
FT                   HLNPDIDYDIGPGTFSENNAQELEDHDITEGGKDGKNKFSNYMSRQLSKDYNTSSSSDD
FT                   DDEDIWGSSAPGSAQSSEFLKHGSKAGSSEFKDSGAFNPSHFGLEDDDDDYMDPNDDGQ
FT                   SYAKPHHPLYDSMLSQGKSENQLYYDQGDASLAENDDEDSDDSDKEDAGDEDDQYSLCR
FT                   TSSKDNMAWDHAEQNRIINTAQYRQNQQELADK"
FT   gene            <325452..>326096
FT                   /locus_tag="KLTH0D03410g"
FT                   /old_locus_tag="KLTH-ORF12321"
FT   CDS_pept        325452..326096
FT                   /locus_tag="KLTH0D03410g"
FT                   /gene_family="HOG000190538" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12321"
FT                   /product="KLTH0D03410p"
FT                   /note="similar to uniprot|P40857 Saccharomyces cerevisiae
FT                   YJL097W Protein required for cell viability"
FT                   /db_xref="InterPro:IPR007482"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG93"
FT                   /protein_id="CAR22435.1"
FT                   /translation="MGKVSFVNPLALYNLFSAGLWGYLLYNAIVVYPKIGQPEFFYEIK
FT                   STLNAIQCGALIEVFNSLFGIVRAPLLTTFAQVASRLLLTIGVFQYLPEAENAHNKTFV
FT                   SLVIAWSITEVVRYSFYYFNLTLTCGAPKLLVLLRYNLFWVLYPLGVASELLIIYSALP
FT                   VGESKYSANVRWALIAAMLTYIPGFPMLFSHMVVQRKKIMRSIRSTTKKEN"
FT   gene            <326296..>326769
FT                   /locus_tag="KLTH0D03432g"
FT                   /old_locus_tag="KLTH-ORF12320"
FT   CDS_pept        326296..326769
FT                   /locus_tag="KLTH0D03432g"
FT                   /gene_family="HOG000066083" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12320"
FT                   /product="KLTH0D03432p"
FT                   /note="some similarities with uniprot|P40858 Saccharomyces
FT                   cerevisiae YJL096W MRPL49 Mitochondrial ribosomal protein
FT                   of the large subunit"
FT                   /db_xref="GOA:C5DG94"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR015934"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG94"
FT                   /protein_id="CAR22436.1"
FT                   /translation="MNSLRRLFPALNSFRQCAHFPTAQFSRSISSTAVSSQKFDITPLK
FT                   LSNELYAVIRIHNRPYLVTKGDKVTLPFKLKQAEVGDILNMNDVTAIGSRNYKVVDSPL
FT                   DPSLYTIKATILEKTKRPMRVREVTKRRNRKVRHAVSKPDLTVLRISELSLND"
FT   gene            <327039..>331340
FT                   /locus_tag="KLTH0D03454g"
FT                   /old_locus_tag="KLTH-ORF12319"
FT   CDS_pept        327039..331340
FT                   /locus_tag="KLTH0D03454g"
FT                   /gene_family="HOG000095188" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12319"
FT                   /product="KLTH0D03454p"
FT                   /note="similar to uniprot|Q01389 Saccharomyces cerevisiae
FT                   YJL095W BCK1 Mitogen-activated protein (MAP) kinase kinase
FT                   kinase acting in the protein kinase C signaling pathway
FT                   which controls cell integrity upon activation by Pkc1p
FT                   phosphorylates downstream kinases Mkk1p and Mkk2p"
FT                   /db_xref="GOA:C5DG95"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG95"
FT                   /protein_id="CAR22437.1"
FT                   /translation="MAFLKKKLANVNHSSRSRSGSTSSSRFHASPSTPNSPEFKLPELP
FT                   PKIPADKNSLKATPFHSHTHPIARIVPRPLDEKTDVQNSSGFTFEEDQSNEVRQNEARQ
FT                   NEVKFPSKKNSTVKNTPNYAVSNSAPGSTYTGITNSPQQGLLFSWDVTNPDEWNMVRVL
FT                   SWFRFNDFDESWVAYFKKRQIHGRSFLKLMAYDNFLEHENNLIQTKTSSYKRFQYLLKR
FT                   TLEQNVVSGHNRNRSDKSNGSRSSSDSVKIRNKMKQEFEHSRSISETMVAENKSSAIDV
FT                   NDEKIVPLRSHQKTSSASSLYRRSFISLLGSSSQDQIKPDPNINIKIPPRPVSSAESIN
FT                   QPDRCNNRTCSSPISPSYSGIFRRQHKSSSSESSIFNTLFGSNTGGSSNSIAEKPAEEH
FT                   KKPRPVKSSSLESLPREKSSLNSSEFPLPKQSYPLNDEKSRLWGKLKRKSLQPDLSATR
FT                   STSAPSEIELSEENTLVNTNLPESQEFNWEDFVLEKRFYPLKNSKTDDRFILITKDNKS
FT                   FIPLNIGIITNLDELKDSMALTLGIKHKNYTIHLTDFGCDIGCAIEDDLLETLRGNMFS
FT                   NVPSKLFIKDQTPIQSKPEIVEPSSEVTASGQLVKNKRTELSANSSIINSNDDTSTITS
FT                   CSDATSFDDIARAAGRAVYPQTPNSYYGAVVTNPNSEVDYWTVKDNLPEDPQQSRGSKT
FT                   RQRFRPRKSSGADSNVPSGSTDSDQSFQIIRKKSNDEIDFNNRRASPYVNPDFAPRREA
FT                   PKPPSSSQNSLVSTGSNSLANSPKFNRIRANTASLKRKARPPPPASILNQLSTRSSNGS
FT                   LRTSKNTAVSPSESVVHSYTPGSTQVLVPQPYKGNSDTIKPGILEDSIISYTHPPFVSR
FT                   SGSLQSTANSVLPSPPHLSKRFSTKRIVSSASAADIFDENDISFADAPNLTESDEDRHS
FT                   DSSDEIIWSSQRKQCEPKKLDGTKQATEDSDCDIDEKSLNSVDSATNTHLHFPTRKMTL
FT                   RPSPEVVYQNLERFFPGTDLDRPIVEGTTPPPSPRIVKASSPKISSLGNDQPGPDPEPR
FT                   SPNNSRVGTPQTMISKSMNDSQEVLSQSSNVLKIPRRTKTIRIIAREASDARRNSKTRS
FT                   LGRKNTKMWGTRVVEVTDKKTVAINKSKNSNGEYKEFAWIKGEIIGKGSFGSVYLGLNV
FT                   TTGEMMAVKQVEVPRYGSQDETTLSVLEALKSEVSTLKDLDHVNIVQYLGFENKNHVYS
FT                   LFLEYVAGGSVGSLIRLFGRFDEDLIRFLAVQVLRGLAYLHSKGILHRDMKADNLLLDV
FT                   DGICKISDFGISKKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCVVLE
FT                   MFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDTQKLLSAEAKSFLDACFEIDPEKRPTA
FT                   DDLLSHPFCGVRSRFVFQETSLARFIRSKPA"
FT   gene            complement(<333077..>334864)
FT                   /locus_tag="KLTH0D03476g"
FT                   /old_locus_tag="KLTH-ORF12314"
FT   CDS_pept        complement(333077..334864)
FT                   /locus_tag="KLTH0D03476g"
FT                   /gene_family="HOG000066084" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12314"
FT                   /product="KLTH0D03476p"
FT                   /note="similar to uniprot|P40310 Saccharomyces cerevisiae
FT                   YJL093C TOK1 Target Of K1 Killer Toxin outward- rectifier
FT                   potassium channel"
FT                   /db_xref="GOA:C5DG96"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG96"
FT                   /protein_id="CAR22438.1"
FT                   /translation="MVRKNSSDAEREYKRLLDESLSFNRDKVIILNAEPSSRSFVIWFI
FT                   ISSYFPVITACLGPISNTIAVAGIVGKWRADAAGKTHPDPKGVYAVNVVSLALGCVSNF
FT                   VLLLHFSKRVGYIRAQLTNIVGWTLAGGLLLADVIVCSQRDFPPNLQRTVGFWYASFTV
FT                   LLYFGSTVLLSIHYCGYKAGKYPAKFNLTDSERNVMIFTFVLSIWFIWGSAMFSKLIEI
FT                   SFDEALYFCTVSILTIGLGDIVPLSVSAKIMTLVYSMSGVIILGLIVALTRSILQSSSG
FT                   PILFFNRVETARTKVYEKLIASGEQLEGREAFEVIKNIRKVSVQRQKRWSVLSTLVIFI
FT                   AFWLLGALVFHFAERWNYFNCLYFCFLCLITIGFGDYAPKTGCGRAFFVIWAICAVPLM
FT                   TAIINTVGETLHSMSSNLEINIAKSSALLLSPVFSMFDKICSFCSNSPKETQMDHSVAD
FT                   EHGPQSASESQAEGNGELLSIHSPERPPSKPDFDSGSDSSIDSKIATKLKDYLQVIKWL
FT                   RELSHRKPDSKLDFDEWARLFSSISDDGDRTLGDPHFWVSEDSPLRYPIDEPRYVMHNL
FT                   LINLENDIERLVRKNSDEA"
FT   gene            <335566..>338838
FT                   /locus_tag="KLTH0D03498g"
FT                   /old_locus_tag="KLTH-ORF12311"
FT   CDS_pept        335566..338838
FT                   /locus_tag="KLTH0D03498g"
FT                   /gene_family="HOG000141756" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12311"
FT                   /product="KLTH0D03498p"
FT                   /note="weakly similar to uniprot|P12954 Saccharomyces
FT                   cerevisiae YJL092W HPR5 DNA helicase and DNA-dependent
FT                   ATPase involved in DNA repair required for proper timing of
FT                   commitment to meiotic recombination and the transition from
FT                   Meiosis I to Meiosis II potential Cdc28p substrate"
FT                   /db_xref="GOA:C5DG97"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG97"
FT                   /protein_id="CAR22439.1"
FT                   /translation="MERLLSSLNERQCESVTFDHTKALQVVAGPGTGKTKVLTTRVAYL
FT                   LLEKGINPGDIIITTFTKKATLEMIERLSFLLEGTNINPSSLWIGTFHSICARILRQHG
FT                   WKIGLPKDWRTFSDSDTDPIIHKLVEKVPDQIRDYAHSYTRKANLLRPNSKGNWEVHPA
FT                   SVKKMISWLKSEGVMADEYRANNEHDPALLHFYEAYQCELHSQHALDFDDLLLHAFKLL
FT                   SKERCLPHIKHVLVDEFQDTNSIQLNLMYLFARGNSTTSQGITAVGDPDQSIYAFRNAL
FT                   ASNFEDMAAKCPIPCSRIVLVENYRSSQKILTTSEMLIKQQLSGREDRLPLKAQFDSDF
FT                   PPVYIEFPAKFLEARALAREILYLRSLPKLWNYNSFALLVRHRRQIRPLETSLIEHRIP
FT                   YKIVNGRAFWELKEINGLMDLLKCVYSNYEKNAILRALQYPNRGLGPATVRKVEATFAD
FT                   YESPFVALKNIVANPNNGAYASKALNVITEFLSLIESCRELMAEATDLSAMTEIFDKLY
FT                   EGSGLKFEYLHVDGKRKAEVDPNGEPNLLNKRHINVNILRKHLANFKPFEEDLSQRQGP
FT                   GDDEVDVKEEDTDVEGKINAHDILREFINSVNLYSTETEVEESQMSEKERRQKKKREKD
FT                   GFVTISTIHGAKGLEWPVVMIPGCVEGVIPCVFGGKDDADDSDSATDGGEEGNNRGNNG
FT                   TSSPKKNRPRRNEGTLDEERRMFFVAQTRAKFLLYLTATNSNDTESRYESSTPSRFLTT
FT                   DLVNTMCEDQKVFTDVESVRKLYHNLNQPPPQESATFSLDVLVKDYEQFVNARRERLTW
FT                   KGRAVFDASRLNLGENITPSPTGFGITTAAAQLRNASTNHIEGRQNSPYGISGVSHNQG
FT                   NRNMAPVYRPSRNNSNTVLAPSRTFAPKTSPTQVKNAQAPVYAPKVEDSAKVLREKAKA
FT                   SSESANSSKIKTGQLSRSASFECSKRRTGGRSRRTIVADSINLGAMNYNHDGTDVETNE
FT                   GQVLVKGEMSAGERGNLNKTAGEMLHNPRDLRNDSRPILTNAKTLADSVRSQTSKRSSA
FT                   PSEVPKKKVKSEPMDKGYDIMSRLSQARRRADSDKDTVIVID"
FT   gene            complement(<338875..>340320)
FT                   /locus_tag="KLTH0D03520g"
FT                   /old_locus_tag="KLTH-ORF12309"
FT   CDS_pept        complement(338875..340320)
FT                   /locus_tag="KLTH0D03520g"
FT                   /gene_family="HOG000204712" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12309"
FT                   /product="KLTH0D03520p"
FT                   /note="similar to uniprot|P47026 Saccharomyces cerevisiae
FT                   YJL091C GWT1 Protein involved in the inositol acylation of
FT                   glucosaminyl phosphatidylinositol (GlcN-PI) to form
FT                   glucosaminyl(acyl)phosphatidylinositol (GlcN(acyl)PI) an
FT                   intermediate in the biosynthesis of
FT                   glycosylphosphatidylinositol (GPI) anchors"
FT                   /db_xref="GOA:C5DG98"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG98"
FT                   /protein_id="CAR22440.1"
FT                   /translation="MEDLKLRKEQFVSGLTGSSIQEINAVASVALCGYVCWSLLRSTVA
FT                   DGKVMLLADFFFNWCAILLSITTYADNPLALNLLLVVPPLLLWLCVRPTRSQRDISRNS
FT                   LQKAEFKLMRHPFITAYRGSMMIVTALAILAVDFRIFPRRFAKVETWGTSLMDLGVGSF
FT                   VFSGGLVSSRALLQNKLSGGRVSALKKIIHALRSSGTILLLGLLRLYFVKNLEYQEHVT
FT                   EYGVHWNFFITLSLLPMAMIPIDAIAEYIPRVAIALVISTVYELFMVFNKDLLTFLISG
FT                   PRETFVGANREGIFSFVGYCAIFLWGQSTGFYTLGNVATKNNLLKPSVQPIKNLNNIGT
FT                   WEKLASKGPLCGLLTWSFITLSATQIVFAWHPFNVSRRFANLPYVLWVVSFNLGALSLF
FT                   CLVDKVFENSAIGSQTSVSLEAMNSNGLFLFLLANVTTGLVNMIMPTIDIAPVEAFSIL
FT                   FLYASFLASVSIFMLKKRIFIKL"
FT   gene            complement(<340512..>342635)
FT                   /locus_tag="KLTH0D03542g"
FT                   /old_locus_tag="KLTH-ORF12307"
FT   CDS_pept        complement(340512..342635)
FT                   /locus_tag="KLTH0D03542g"
FT                   /gene_family="HOG000112252" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12307"
FT                   /product="KLTH0D03542p"
FT                   /note="similar to uniprot|P47027 Saccharomyces cerevisiae
FT                   YJL090C DPB11 Essential BRCT repeat protein required on the
FT                   prereplicative complex at replication origins for loading
FT                   DNA polymerases to initiate DNA synthesis also required for
FT                   S/M checkpoint control"
FT                   /db_xref="GOA:C5DG99"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="UniProtKB/TrEMBL:C5DG99"
FT                   /protein_id="CAR22441.1"
FT                   /translation="MQKPLQGITFCPTALPEDASRSVSRKVAKLGGGFSKDLTKLVNVL
FT                   VVGSVATNKYRFAVQNRADMAFVGVDAIDTIYDLWLAGDDISMESHSNFSGIKNPRERM
FT                   LSVLRTRHQLGALKDFVVFIGRVGDDQEGKLSPDSLERLCVEQGVHSCNTRHFVKESHW
FT                   NRPTVFVTDCSRGARVDAARSQGLPIVHPKWVLDCHNRSALLDFAYYLLENNEHVSFEV
FT                   VGAGSCMCWDQISFQPSSAAANAHEDDSRLSQRVVLDKFASDGHRLWNSVMHKTKKISP
FT                   AETFPLPNAEKTKELPGLFHDKHCYLLGFPQKHKAVLHNIIVRNSGSCYDYEDGVQVRE
FT                   PSYLVIPSNVPRYTPASVDELFTHVVTEFFFERCLHYKKLLKPDPWCSPFFSNFEVIPS
FT                   DHLRQNLTVSEPLKVAITGFQGVELLHITKILEYLEPSGLKLSQKLNKETNVLIINLGA
FT                   LNSIPESHPLWKNQYASMFGEGKKLEQNQIHRNSMKRKIEFIKQRHSIPVVTAAFILEL
FT                   FSRVSKAKAQLKVSSRIHLNDVNWCISCPKGNKDQFYCDLLAKETDSTDSGLEIASSAN
FT                   DCVNRSIKQNRQEALDIFRNGPTVNSKRSLYEEGIEARHSAEKVPSPLPKIPRLVPTEA
FT                   LKPVQRSSSWGNLLSDQARKVDGLHDSDVEPSTGERELQHTQVTYGSPKQINDVQAPPT
FT                   RRLTRQRMKEIDT"
FT   gene            <343546..>346134
FT                   /locus_tag="KLTH0D03564g"
FT                   /old_locus_tag="KLTH-ORF12304"
FT   CDS_pept        343546..346134
FT                   /locus_tag="KLTH0D03564g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12304"
FT                   /product="KLTH0D03564p"
FT                   /note="weakly similar to uniprot|P46954 Saccharomyces
FT                   cerevisiae YJL089W SIP4 Possibly involved in Snf1p
FT                   regulated transcriptional activation shows homology to DNA
FT                   binding domain of Gal4p has a leucine zipper motif and
FT                   acidic region lexA-Sip4p activates transcription"
FT                   /db_xref="GOA:C5DGA0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA0"
FT                   /protein_id="CAR22442.1"
FT                   /translation="MAKRKYGSPLSPKATQLLLSKHARMSQACDRCRLKKIKCDGIKPT
FT                   CTPCTKIGFHCQTSDKLSRRGFPRGYTEMLEKEVVRLQQRLVRAGYDPGDSTEVSVSQQ
FT                   AAIGATADNSESFAGETSGQSEAPGSGATSTEPSASVQPSSEPQKQQLFHLPFINDTFH
FT                   LHENRVAADGRFLGHAAWNDIVGTLGKLPTEAMPDEDEWLCRYLVRQFQLSQHRVPAAL
FT                   LIKYHNDAGFCKKRIRRSITHFLQTSMSLVPILNSSTWEERLFKINESKNTHPAALLAY
FT                   LFIIQWQWSCFSDDKLFAATKIVVLNATQPLFRLQCLLLASYYFMGTPSMSLVYNTSTA
FT                   PYASQLLKLSFAEMINLGLFINSHRLVPLQNSPLSHSERLITFWCFQFLDSWWTLLQGT
FT                   PKSNFTMDEFLPPKISSLRNPRLKPFELLIDFVVGCLDGCNLLYALSQGANTHMIFELE
FT                   SFRKRLFQYSLYHHLKDHDYHNLSTLATCVDKPQAIEIQLTLHYLIMTFFANLKAARSA
FT                   GRSSAKAAESLRDTSYEILTLYYLIVVDSYDMKASIPQQLQVLHLLPCDNLAIVNMCLE
FT                   CLSQWAVASENKAGTDSEYRMNYEKHRSIVKAWCKIWYFDEPEDELLTRLQKNYQFSSQ
FT                   LPSGRSGQLAKLQYLNAMRTHNRRSLLLNLPDDNQVHDNVGSLNILGVESTQFRIPAAD
FT                   SANNLFESLAIQEEDEGYAEDDDDDDDTPLELPFFKKKRSNKTTIAQPPPIPVRSRSLF
FT                   DQHHPGPIIRRQSDAVAANNGRLFSGIDESHLKVLKDNSVQKETEDAKLRSEHYLLVQG
FT                   FQKSPPEVDTPRSLADILSLSGAECKFPASSGSIPEDNAHDKQQASVDHT"
FT   gene            <346309..>347241
FT                   /locus_tag="KLTH0D03586g"
FT                   /old_locus_tag="KLTH-ORF12301"
FT   CDS_pept        346309..347241
FT                   /locus_tag="KLTH0D03586g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12301"
FT                   /product="KLTH0D03586p"
FT                   /note="weakly similar to uniprot|P36118 Saccharomyces
FT                   cerevisiae YKR022C Protein required for cell viability"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA1"
FT                   /protein_id="CAR22443.1"
FT                   /translation="MFRKRAKLQPSVGSNKASGSSQKDSSETSKRRSRVDISTSYEIED
FT                   ENEHIRTSPSSRLKEKKKRAIKPNAHQYLPFEEEDITEIAYRKPLPKSGVQIMNLEELG
FT                   DDCEDDTLEGVPTRREIESIRTQRAMLQQQTDTLKTGFYDSSKNPVEHDEHQYIKLLSK
FT                   DDKHDLMEIIGGESQGAKDVQDSYMDAYLEIHGLEDGRLALSKNDLDRDEQERKLAITS
FT                   ALKNVEGDEWEARQLEKMDRGLSLIAHPILHENDFELEELVSELDSMLLSIQTKKKMFI
FT                   SQRDSVQKENKKLCEAQDKLITSLQKHVA"
FT   gene            <349672..>355387
FT                   /locus_tag="KLTH0D03608g"
FT                   /old_locus_tag="Klth0D.mRNA.185.p"
FT   CDS_pept        join(349672..349685,349747..355387)
FT                   /locus_tag="KLTH0D03608g"
FT                   /gene_family="HOG000179764" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.185.p"
FT                   /product="KLTH0D03608p"
FT                   /note="similar to uniprot|P37297 Saccharomyces cerevisiae
FT                   YLR305C STT4 Phosphatidylinositol-4-kinase that functions
FT                   in the Pkc1p protein kinase pathway; required for normal
FT                   vacuole morphology, cell wall integrity, and actin
FT                   cytoskeleton organization"
FT                   /db_xref="GOA:C5DGA2"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA2"
FT                   /protein_id="CAR22444.1"
FT                   /translation="MSAFRESPGSLRALALAKLVNHSEGSRSIDKLVASLPVSYSSHPA
FT                   KLYTIPLTLNELEVLLGVCQFVPSTAQSAQSLLKKCIIPYFLSNPRQKFTDYVINKYRQ
FT                   RGLKHPTEILSFELSRSIIRISRIFPQFIDEIREQIDEYLQYMSSNLTVENLLSFAGFL
FT                   EALVYEQNNLLSSFVISVLQAFISEDFLYAVEKTVRNSVSKDVLIDYFDHNREISSLLF
FT                   CELIEKLQVTYAASLLNVPKKQTLDSYLLDLKHAQFLDGENKALKDFEKKVGQQRSKLL
FT                   ELCKFSFRQITEVEEGAKYIDLSSQNRLESAYTAKSYMLQILSLGLFLSHEVEEVIEMI
FT                   RDAVIDLPTNSFALKTSLLTTVVCVASLLNYFTDSVSADLLRVFPLMVTTKLITKQKVA
FT                   TISSAVSKGLKPLTEDVIVGTIYNINNLLALAQDGLHMTPVKDRRLTTVLGTSNHFDRL
FT                   LSSRPTRSNTVGTYQSLQKLKIAETSIVLQHESKLENYTSRQEEVESNSTLYHDSLYEN
FT                   VVTATTTMASVYNDQSITALTITILTQKIKSASPRLDRKILEGLAHLALKVNRSEFNLL
FT                   MKFFHLSTNSALDNQDEKMMKSLIAAKSIIAEGLAKEDLHNNLFRIYLRYLLDAIVARG
FT                   DVDRSEHHRSHSEISKVADQIAVYLKPLASLLPKPGEKPLDLIHDEEITNVFRNVWFNA
FT                   AVHGFHGAAALTSKNHEELLVIAYNSPPLASDFASGNRETSLDMNTILRRGSSNHNLKQ
FT                   QKLILSDHLSMSPVQARTLSSSKVMFLAATLLLEGLRCEAGDCSKTLLYCSDRSIVKSG
FT                   LDKFVSSISVSMVQRYTKLVIKGDSVIFSAENVAKQLDNILLLLTHRDAPLQDAAYQSC
FT                   DRFIERIPSSLCHRDSLYTLLDSLTMLFDSVIACEANKHEAVFEFTLKHSNRKMMLPDS
FT                   LNWRSLTLEKLQKYATRWVTMILKTANQDTKILLQSYISDVSSTRRLNSIEFGVSFALE
FT                   MAAKILPVDRELANISQGGYRRPDSISGFLSQHAWRSRFIMDQSVLSTYDGIEAERNFS
FT                   RRKILAHLENKKPLDYKDISAFLDLSASLLILRQGNTASLVYDIVCIPFQIFTSDTIKI
FT                   ATNVWLSVINERSDVGYLLLSEIGHCWRDSIDNNTGLFSMKHNLVAEEFQYMEYSPYNK
FT                   KEINRRAHAASKSLQPHLQLIRFLSSHFEGTMFDSLHLLHIFTKLCLYGLKNLGKASLH
FT                   PFARIARSELLYFGTLVFATNVKHNTLYVPEISRFLVDGALTWFEKPKSWPFGANELKI
FT                   RADLALLIEVYRKLKSQEANLKVHCSKDVSLLEHFLLSEIYSVETWLRPLAKPTDMVKP
FT                   PTDLVSHAFKKKPELAINLVERYPFKKSSEILTQLVKENPLLCAHSQKTLSFFLAGGKD
FT                   MHYVLYWAPASPLKSINLFLPQWAQNTFVIQYNVRAIETHDVNLTFFYVPQIVQCLRYD
FT                   PLGYVERFIIDTAKISVLFSHQIIWNMLANSYKDDDGEIPDDLKPTLDRIHDKMLASFS
FT                   AEQKDFYEREFSFFNEVTGISGKLRPYIKKTKAEKKIKIDEEMQKISVLDGVYLPSNPD
FT                   GVVVDIDRSSGKPLQSHAKAPFMATFKIEKTEQDPDTGEDKKVEKWQGAIFKVGDDCRQ
FT                   DVLALQLISLFRTIWSAVGLDVFVFPYRVTATAPGCGVIDVLPNSISRDMLGREAVNGL
FT                   YEYFTTKFGHENTVEFQHARNNFVKSLAGYSVISELLQFKDRHNGNIMYDDQGHCLHID
FT                   FGFIFDIVPGGVKFEAVPFKLTKEMVKVMGGSPDTQAYREFEELCIKAYLAARPHMDLV
FT                   LECVTPMLGSGLPCFNGNKTIRNLESRFVPHKTDYEAAQHMLSLIKKSYESLFTKGYDE
FT                   FQRLTNGIPY"
FT   gene            <355806..>358145
FT                   /locus_tag="KLTH0D03630g"
FT                   /old_locus_tag="KLTH-ORF12294"
FT   CDS_pept        355806..358145
FT                   /locus_tag="KLTH0D03630g"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12294"
FT                   /product="KLTH0D03630p"
FT                   /note="highly similar to uniprot|P19414 Saccharomyces
FT                   cerevisiae YLR304C ACO1 Mitochondrial aconitase required
FT                   for the tricarboxylic acid (TCA) cycle mutation leads to
FT                   glutamate auxotrophy"
FT                   /db_xref="GOA:C5DGA3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006248"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA3"
FT                   /protein_id="CAR22445.1"
FT                   /translation="MLSARSIAQKPVARGLATVSKLTRDSKVHQNLLEDHSFINYKQNL
FT                   ENVDIVRKRLNRPLTYAEKILYGHLDDPHGQDIERGVSYLKLRPDRVACQDATAQMAIL
FT                   QFMSAGLPQVAKPVTVHCDHLIQAQVGGEKDLKRAIDLNKEVFDFLATATAKYNMGFWK
FT                   PGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMSDLPWELKA
FT                   PKILGVKLTGKMSGWTSPKDIILKLAGITTVKGGTGKIVEYYGEGVNTFSATGMGTICN
FT                   MGAEIGATTSVFPFNHSMVDYLKATRRGEIADFAKLYNSDLLSADKGAEYDEVIEINLS
FT                   ELEPYVNGPFTPDLATPISKMKEVAVHNNWPLEVKVGLIGSCTNSSYEDMSRAASIAED
FT                   AASHGLKSKSLFTISPGSEQVRSTIARDGQLKTFQDFGGVVLANACGPCIGQWDRQDIK
FT                   KGDKNTIVSSFNRNFTSRNDGNPETHSFVASPEITTALAIAGDLRFNPMTDKLKDKDGN
FT                   EFMLKPPTGVGLPVKGYDQGVNTYQAPPAERSSVEVKVSPTSDRLQLLTPFDAWDGKDP
FT                   VDLPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENKKANCVKNFFTG
FT                   EYAGVPDTAREYKKRGQKWVVVGGENFGEGSSREHAALEPRYLGAYAIITKSFARIHET
FT                   NLKKQGLLPLTFGKPEDYDRINPDDLVDLVGVTELAPGKPVTMRLKTKSGETWETPLNH
FT                   TFNSEQIGWFKAGSALNMITQSKKSA"
FT   gene            complement(<358612..>359946)
FT                   /locus_tag="KLTH0D03652g"
FT                   /old_locus_tag="KLTH-ORF12290"
FT   CDS_pept        complement(358612..359946)
FT                   /locus_tag="KLTH0D03652g"
FT                   /gene_family="HOG000246417" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12290"
FT                   /product="KLTH0D03652p"
FT                   /note="highly similar to uniprot|P06106 Saccharomyces
FT                   cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
FT                   serine sulfhydrylase required for sulfur amino acid
FT                   synthesis"
FT                   /db_xref="GOA:C5DGA4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA4"
FT                   /protein_id="CAR22446.1"
FT                   /translation="MPSHFDTLQLHAGQEDATENAHNPRAVPIYATSSYVFNDSQHGAQ
FT                   LFGLEKPGYMYSRIVNPTVDVFERRIAALEGGVAALAVASGQAAQALAISGLAHAGDNI
FT                   VSTSFLYGGTYNQFKVAFRRLGIETRFIEGDKPEDFEKAFDDKTKAVYLETIGNPKYNV
FT                   PDFEKIVAVAHKHGIPVVVDNTFGAGGYFAQPIKYGADIVTHSATKWIGGHGTTIGGVI
FT                   VDSGKFPWKEYPEKFPQFSKPSEGYHGLVINDALGPLAYIGHVRIELLRDLGPALNPFA
FT                   AFQLLQGVETLSLRCERHATNALKLAQYLEKSPYVSWVSYPGLSSHSHHENAKKYLQNG
FT                   FGGVLSFGVKDLPNAHEIEDPFKASGAQVVDSLKIASNLANVGDSKTLVIAPYFTTHQQ
FT                   LTDEEKLASGVTKDLIRVSVGTEFIDDIIGDFEQAFEKVFNGQKP"
FT   gene            complement(<361666..>361766)
FT                   /locus_tag="KLTH0D03674r"
FT                   /old_locus_tag="Klth0D.tLeu.TAG.26"
FT   tRNA            complement(join(361666..361709,361730..361766))
FT                   /locus_tag="KLTH0D03674r"
FT                   /old_locus_tag="Klth0D.tLeu.TAG.26"
FT                   /note="tRNA-Leu (TAG) cove"
FT   gene            <362623..>362694
FT                   /locus_tag="KLTH0D03696r"
FT                   /old_locus_tag="Klth0D.tArg.TCT.2"
FT   tRNA            362623..362694
FT                   /locus_tag="KLTH0D03696r"
FT                   /old_locus_tag="Klth0D.tArg.TCT.2"
FT                   /note="tRNA-Arg (TCT) cove score=67.63"
FT   gene            complement(<362790..>364790)
FT                   /locus_tag="KLTH0D03718g"
FT                   /old_locus_tag="KLTH-ORF12280"
FT   CDS_pept        complement(362790..364790)
FT                   /locus_tag="KLTH0D03718g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12280"
FT                   /product="KLTH0D03718p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DGA5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA5"
FT                   /protein_id="CAR22447.1"
FT                   /translation="MSRAPEDGFESMPSSRESEAGGQKRPNDCDQDHLSQKKRVTRRRH
FT                   RNSRLGCDECKRRRIKCDETIPECRNCQNRQKREPGKRCSYLSMNEEELQSFKLKKQQN
FT                   RLVEGTRVNKILEDHPDEIAYEIKMIAHESVELPVSVWTCVSGMESVRVPKALYLQVLL
FT                   NANQDWDMSSRSFVVLALYSIMNSMSHKITLADQGQGDSAQEILLAEREILERIAVKYK
FT                   KEFLTYAREIISMFLTSKAAVGNEYLGTRLLITNTVLQYIQLYSNAQYDSNHYAAMIDM
FT                   CLEIYKNNDPEKVVRTVQFYWSSMPRNLFHLYFPAYSTDLLFELKAVLKEFEPIILAAG
FT                   DERVQLHHKELGDFIHYVIGLLPLSTSVLPLPVDELYEMYRTWFLGIPSEAFCISRTMP
FT                   GVQRVFYTFYHSIASYLNNLFPAGCYLMSRPFHGPTSLYPFSLNIVFEDLDHLLGPFAE
FT                   FSVRLLSFMERREHILQNFFEVKDPLPPGLHKFRFQKGEVRNLKEKFISSLREELITWD
FT                   NYPDLVPNTEHSEGKDMKYFVLTEREAAKSQIQRWRQAKNTYSGAEHFPTESNGLLIDQ
FT                   ILEQMKSADPFLAMQRKKPLGSFGIEYSSDRGYQMGDRGLFQQDCDVSLFFEQSSPAFL
FT                   SVLPSVEHVQDYKADRICVVSNTGSRKLYNY"
FT   gene            complement(<365191..>366253)
FT                   /locus_tag="KLTH0D03740g"
FT                   /old_locus_tag="Klth0D.mRNA.2750.m"
FT   CDS_pept        complement(join(365191..366136,366198..366253))
FT                   /locus_tag="KLTH0D03740g"
FT                   /gene_family="HOG000203695" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.2750.m"
FT                   /product="KLTH0D03740p"
FT                   /note="similar to uniprot|P53290 Saccharomyces cerevisiae
FT                   YGR163W GTR2 Cytoplasmic GTP binding protein functions as a
FT                   negative regulator of the Ran/Tc4 GTPase cycle downstream
FT                   of its binding partner and homolog Gtr1p homolog of human
FT                   RagC and RagD proteins"
FT                   /db_xref="GOA:C5DGA6"
FT                   /db_xref="InterPro:IPR006762"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA6"
FT                   /protein_id="CAR22448.1"
FT                   /translation="MNSEENSDKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLESTS
FT                   NPTMEHFSTLIDLAVMELPGQLNYFEPNYDSERLFKSVGALVYVIDSQDEYMNALTNFA
FT                   IIVEYAYKVNPDINIEVLIHKVDGLSEDFKVDTQRDIMQRTGEELLELGLDGVQVSFYL
FT                   TSIFDHSIYEAFSRIVQKLVPELPFLENMLDNLVQHSKIEKCFLFDINSKIYVSTDSSP
FT                   VDIVTYETCAEFVDVTIDLHDLYKIQGKEDALAGSTGNKPPPEVKGVSALNNGVVIYLR
FT                   QMIRGLALVALIRPDDTDVESCLTVVDYNVDIFKKGLEQVWAHARITSPEGK"
FT   gene            <366599..>367396
FT                   /locus_tag="KLTH0D03762g"
FT                   /old_locus_tag="KLTH-ORF12277"
FT   CDS_pept        366599..367396
FT                   /locus_tag="KLTH0D03762g"
FT                   /gene_family="HOG000247848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12277"
FT                   /product="KLTH0D03762p"
FT                   /note="similar to uniprot|P53177 Saccharomyces cerevisiae
FT                   YGL050W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA7"
FT                   /protein_id="CAR22449.1"
FT                   /translation="MVQDAFQQKKEHILAEIKSSSLDLSPKGTIDELCFPIMNLINSHM
FT                   DMVTTSSCSGRLSVFVEGNKVHDKEIKTGGKGEGGKWLFVTHDREQVKSWFEKLEEPVS
FT                   FQPDYNPGYMDASTRYILYKYEPFILHVKCRDFRSASALFNTAMSCGFRESGIGSNNIV
FT                   ALRVNIKLDVPIGYLNELTSKLVFFVDSKYIELMDHITLGKFTENENKMQELYKKIEAH
FT                   ILKAPLETPKDLDKVETKEERRERKIKEGLLRQKMVRSQDTQN"
FT   gene            complement(<367647..>370937)
FT                   /locus_tag="KLTH0D03784g"
FT                   /old_locus_tag="KLTH-ORF12275"
FT   CDS_pept        complement(367647..370937)
FT                   /locus_tag="KLTH0D03784g"
FT                   /gene_family="HOG000065985" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12275"
FT                   /product="KLTH0D03784p"
FT                   /note="some similarities with uniprot|P39935 Saccharomyces
FT                   cerevisiae YGR162W TIF4631 also called eIF4 (eIF-4) gamma
FT                   mRNA cap-binding protein (eIF-4F) 150K subunit highly
FT                   homologous to Tif4632p homologs of mammalian p220"
FT                   /db_xref="GOA:C5DGA8"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022745"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA8"
FT                   /protein_id="CAR22450.1"
FT                   /translation="MSEQQTGEKPSGTESQQPVQPNQPYQQQQRYPRNSGQKSSGQKGS
FT                   RSNSKSYNGYQGNNGGNGGGNHRYNKNGFHHKNNRSAGAVPGMQWAYGSYGMAGQPQFY
FT                   PSYGYGYVPAMAAQGYNPAGGPSSSASPVEPAATLTPTTPVSKKIEITNRSGEHVDLNA
FT                   IHSQHISSSAGQPAHSPVKESSTPAAPTPEPKAAVEPSKPATPEPSKTEPSADDLLKMS
FT                   FLEQVRMRKAMRAQKKAGDSPSVQTAEVIASAPEVKTESAPEAATPTPKVPSENSSNDV
FT                   TNATQEAVSSDAQGIHEESIPKDAPKDDSATTQNPSVETVAEATSKAPVATDADAPSEQ
FT                   SETVVVKAVSKAAPEVISEAVPEAATEAAPETAPETAPETAPETAPEATPEATPEATPE
FT                   AVPEVAPEAAPESAPEPEKETSIVTENTEASEPVKEDAQPARPLTFSEKLKLKTKASAK
FT                   SDADTTATDTQPGETASTSEPTGEAEPQDASEKASEASEEAEVANTAPVEEEQKIDSAA
FT                   EPELQVSAEAKEPTGEEPKAEGDQEDSDVDDGRITMTEFLARLDQVSPVDDIYSFKYPE
FT                   GIEAPDARYKREKAKYTYGPTFLLQFKDKVNVRPDAEWKEKVASKIVIPPGSVRPGGRS
FT                   RGDSKFGPGAGFKKSGSLRGMEGRSNSRSSSKRKSKKMGDDRKSNRAYTSRKDRERMAE
FT                   EDDKPKEDVAPLIPSANRWVPKSKQKKTEKKFAPDGVTELLNKEEAQRKMKSLLNKLTL
FT                   EKFDPISEEIIKIADQSKWETDCETLKVVIEEIFMKACDEPHWSSMYAQLCGKVVKDMD
FT                   PEIKEEGNEGKAGPKLVLHYLVDRCHAEFQKGWTDKLPTKEDGSPLEPEMMSDEYYQMA
FT                   AAKRRGLGLVRLIGFLYRSHLLTAKMMFECFRRLMKDLADSPTEETLESVIELLNTVGE
FT                   QFEKDRLVQPSGSLEGSTVLDQLFYMLDKITESSEISSRIKFKLVDMKELREVKHWNST
FT                   KRDEGPKTIQQIHEEEAAKKAMEERERKMKGSSRSGSRRNNSNSMMGNRSNSRREPVSV
FT                   SKDSFISTRSSSLRHVQSAAPAKEETPAQKTAVNMFDALMGAESDDDE"
FT   gene            complement(<371457..>372674)
FT                   /locus_tag="KLTH0D03806g"
FT                   /old_locus_tag="KLTH-ORF12266"
FT   CDS_pept        complement(371457..372674)
FT                   /locus_tag="KLTH0D03806g"
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12266"
FT                   /product="KLTH0D03806p"
FT                   /note="highly similar to uniprot|Q01939 Saccharomyces
FT                   cerevisiae YGL048C RPT6 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates bound by ubiquitin-
FT                   protein ligases Ubr1p and Ufd4p localized mainly to the
FT                   nucleus throughout the cell cycle"
FT                   /db_xref="GOA:C5DGA9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGA9"
FT                   /protein_id="CAR22451.1"
FT                   /translation="MSAAAVSEVTLNTHESGIKPFFDQKIQDTELKIRAKTQNLRRLEA
FT                   QRNALNDKVRFIKDELRLLQEPGSYVGEVVKVVSDKKVLVKIQPEGKYIVDIAKDINVK
FT                   DLKASQRVCLKSDSYALHKILENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVI
FT                   ELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYI
FT                   GEGSRMVRELFIMAREHAPSIIFMDEIDSIGSSRVEGGSGGGDSEVQRTMLELLNQLDG
FT                   FETSKDIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIHSRKMNLTRG
FT                   INLRKIAEKMNGCSGADVKGVCTEAGMFALRERRIHVTQEDFELAVGKVMNKNDETAIS
FT                   VAKLFK"
FT   gene            <372909..>373505
FT                   /locus_tag="KLTH0D03828g"
FT                   /old_locus_tag="KLTH-ORF12264"
FT   CDS_pept        372909..373505
FT                   /locus_tag="KLTH0D03828g"
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12264"
FT                   /product="KLTH0D03828p"
FT                   /note="similar to uniprot|P53178 Saccharomyces cerevisiae
FT                   YGL047W"
FT                   /db_xref="GOA:C5DGB0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB0"
FT                   /protein_id="CAR22452.1"
FT                   /translation="MGSTVVVTCGATVPFPELIAALLDKQVLDTLLRMHYTRLIVQYGR
FT                   GYTSKFAQLLGCVRAHVEEPADNGASNLAAGVEVQVRGHYQSLEVCGFEFTGAIHELLR
FT                   DNADLVISHAGTGSIVDALRLGKRLLVVANTSLMDNHQLQIARKFESRGHLQSAAAQPK
FT                   ALIAALRRVEAAPQVPLPNGYNSSFERLLMDVAQS"
FT   gene            complement(<373652..>373725)
FT                   /locus_tag="KLTH0D03850r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.25"
FT   tRNA            complement(373652..373725)
FT                   /locus_tag="KLTH0D03850r"
FT                   /old_locus_tag="Klth0D.tVal.AAC.25"
FT                   /note="tRNA-Val (AAC) cove score=68.42"
FT   gene            <374437..>375381
FT                   /locus_tag="KLTH0D03872g"
FT                   /old_locus_tag="KLTH-ORF12263"
FT   CDS_pept        374437..375381
FT                   /locus_tag="KLTH0D03872g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12263"
FT                   /product="KLTH0D03872p"
FT                   /note="some similarities with YGR161c, uniprot|P53289
FT                   Saccharomyces cerevisiae Hypothetical ORF, RTS3
FT                   SGDID:S0003393"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB1"
FT                   /protein_id="CAR22453.1"
FT                   /translation="MEVTTHAQHKAVTLYKEPHHLDSVNWEEGLGKGCGKSAQQDLDQL
FT                   TVVDSIVVTPDAAPQSPQDYTRSGRPAVPHYTLSSSGSAMADKQHTFKAPSPARTPGRP
FT                   TRPTLNVQSSSSSSLSSLRSRARRLSSEEIINEMENEQDAIVVRLLREIDQLKDENNRL
FT                   RKNLCAVLNGDPQTPAGPALSRRSSLNSCASNSSGSGSLSSSHAGTTPGVLAATPTASS
FT                   PALSRRPSSSATPIDTLTPTLLLQRKRNSLSSSVPATPKNSGDFVDLYAPAPVSKFGAV
FT                   DVSLDAPGSCGYRRRRSSMKSTEGSNKLQRSTR"
FT   gene            <376254..>378374
FT                   /locus_tag="KLTH0D03894g"
FT                   /old_locus_tag="KLTH-ORF12262"
FT   CDS_pept        376254..378374
FT                   /locus_tag="KLTH0D03894g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12262"
FT                   /product="KLTH0D03894p"
FT                   /note="some similarities with uniprot|P08068 Saccharomyces
FT                   cerevisiae YIR019C GPI-anchored cell surface glycoprotein
FT                   required for diploid pseudohyphal formation and haploid
FT                   invasive growth"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB2"
FT                   /protein_id="CAR22454.1"
FT                   /translation="MLCRPILLLFTAFGGFASCISALSTTTITTESITTSFVCGRCTTN
FT                   QHETTLSSSSTTAVETSACHQCVTSQYESSLSSISTSVSSTSTIPTSPLSSTTISSTIV
FT                   STSYVCGKCTTNISFREVVVSSTSETVPSAKHSSSTPTSSTSASDESSSATPSSAMPSS
FT                   ATPSSAMPSSATPSSTTTASSTASSTTISTTTSSSSASSSSTISSFTISSTTPSSIASS
FT                   NATPSIITISSDTSSSSTLSSASSSVARTSSGNVESSPSGPKTTTTLNKSTTTETESCD
FT                   CTTYPGSSISTTTTLVSTISTSSSATTQSSTQSSTTSGTSSLSSEMSSSKSSASSVSLS
FT                   SSSKVSSRTGFSSTETSRATTVSETQHSLSSESNTPTTLTSIPGSLSTSATFSSFSSTA
FT                   FSSVSTSSPTAESVSSLVSSTPSVGSQTSSTLTSSTSFPGVPSSVTSSGNVPSSFSDIG
FT                   TSSTSVLTTTYSTTNSGSTSITLTTDSSFRTLESSASSTPASSTPASSTPASSTPASST
FT                   TASSTTASSTTVTVSSSLPGLNMSTTLSSSTLLSTTSPGQPISTASTSTGPLTIPTASN
FT                   SLPVLLVSTSCTAANDTNCAVPTTDSAPAPTSTSTPPSSSSSNASKSEEVPSSAASSSS
FT                   PATVSGPTSSQSSVHTTSSTFASYAPKSFSFGSTSTQPFPTASSTASLLSSYTGGASKA
FT                   VPRIAFAVLLLL"
FT   gene            <378839..>380356
FT                   /locus_tag="KLTH0D03916g"
FT                   /old_locus_tag="KLTH-ORF12255"
FT   CDS_pept        378839..380356
FT                   /locus_tag="KLTH0D03916g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12255"
FT                   /product="KLTH0D03916p"
FT                   /note="some similarities with uniprot|P27476 Saccharomyces
FT                   cerevisiae YGR159C NSR1 Nucleolar protein that binds
FT                   nuclear localization sequences required for pre- rRNA
FT                   processing and ribosome biogenesis"
FT                   /db_xref="GOA:C5DGB3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB3"
FT                   /protein_id="CAR22455.1"
FT                   /translation="MAKQVAKKVSKKDVKSKKQEKEAVAAKSESSSSSSSSESSSSSSE
FT                   SSSSSSESESESSSSSSSSDSESSDSSSDSEEEQEVKKDTKKDTKKDTKKEAKKDSKKD
FT                   SKKEAKKETVKEAKKGSKKAVAPESDSESGSESDTESSDSESSDSDSSSSSESESEAEA
FT                   EAETESKKAKESATSSSSSNSSSGSDSSSSSSSSESEGSSSSSDSDSSSEEEEAKEKDT
FT                   SSKKRKAEESDVSEESEDATESKKAKTESNGEPATIFVGRLSWSVDDEWLKTEFEPIGG
FT                   VISARVIMERGTDRSRGYGYVDFENKFYAEKAVKEMHGKEIDGRPINCDMSTSKPAGNP
FT                   RNDRAKQFGDTPSQPSDTLFLGNLSFNADRDNIFETFAEHGEVVSVRLPTHPETNQPKG
FT                   FGYVQYSSVDEAQKAFEALQGHYIDNRPVRLDFSTPKPRDEGSRGGFRGGRGGSRGGSR
FT                   GGFGGGRGGFGGGNRGDFKPSGSGSNSAPLGKGRQTAEFQGNKKKFD"
FT   gene            <380728..>382380
FT                   /locus_tag="KLTH0D03938g"
FT                   /old_locus_tag="KLTH-ORF12251"
FT   CDS_pept        380728..382380
FT                   /locus_tag="KLTH0D03938g"
FT                   /gene_family="HOG000115430" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12251"
FT                   /product="KLTH0D03938p"
FT                   /note="similar to uniprot|P53180 Saccharomyces cerevisiae
FT                   YGL045W RIM8"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB4"
FT                   /protein_id="CAR22456.1"
FT                   /translation="MGFLTKLKAVSSRNSDPSISSTKVSAVSDAKTRYNYAKRSRFRHA
FT                   CAARDFYINQESPHKVWKPNEQISGEAVLVLKDDLENVAVRLSLIGEVRIRGSGSKTHC
FT                   DQLFEKTTLVYGDQEEVAPETRSIVNGLTKGEHRFPFRLKVPSKNIFTSIKFERGSISY
FT                   CIRCTLEPLRCSDPEKVLAACEKSISVMVPLDVSDMPKPNTKSVVLQSPSAVKQIKLAN
FT                   GEQDASSSFTRRTGGSKNSGSTVNTSGSLKTVTINVDLPSSGYVIGEVIPVKLNLCHYR
FT                   EYSHSTGLIATLVRICRVGGASKENPMEMYRKDICQTVSPIYVNPDTFECSVTVYLKIP
FT                   LDAFPTLRLPDRKFSFQYYVEVLVNLSRKNIAFTESNRVVDTTTNSHVSASPGKTIEET
FT                   FTLLQRKIRSGSETEPFKNNDRESMIFFKDLINVDKLKRLRNVTGMSIEVIVGTNRSEI
FT                   PQDSSLDEVEENPETTNSGLQSIDYTNTAVNNYTVAGYSPLGDCKDVLNFDGGSVLPLP
FT                   VYTPNSHYNAADDKDELELQRLQELESEPPMAT"
FT   gene            <382557..>383288
FT                   /locus_tag="KLTH0D03960g"
FT                   /old_locus_tag="KLTH-ORF12247"
FT   CDS_pept        382557..383288
FT                   /locus_tag="KLTH0D03960g"
FT                   /gene_family="HOG000113690" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12247"
FT                   /product="KLTH0D03960p"
FT                   /note="similar to uniprot|P48240 Saccharomyces cerevisiae
FT                   YGR158C MTR3 3'5' exoribonuclease exosome subunit nucleolar
FT                   protein involved in export of mRNA and ribosomal subunits
FT                   homologous to the E. coli exonuclease RNase PH"
FT                   /db_xref="GOA:C5DGB5"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB5"
FT                   /protein_id="CAR22457.1"
FT                   /translation="MNITDRRRILGPSNAKPLVFERLESSEQAAQPPQEKNNENESMYI
FT                   KNGLVSNANGSSYLELKRGESSEQCTILLSSVYGPRPSRGAFSSKASLSVQFKEVTIEK
FT                   IPSGELKEICNFLSNIFSAVINLERYPKSGIDIFLSLIKNPITSDEANLEPIIAACVNG
FT                   ITLALADAGIEIFDTVSAGTYKRNVVAFSKNGTEVVGLWKDKEDDTANDILSVIENCRG
FT                   NYLQNRKGIIEYLIRSKNADI"
FT   gene            complement(<383372..>385900)
FT                   /locus_tag="KLTH0D03982g"
FT                   /old_locus_tag="KLTH-ORF12245"
FT   CDS_pept        complement(383372..385900)
FT                   /locus_tag="KLTH0D03982g"
FT                   /gene_family="HOG000247858" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12245"
FT                   /product="KLTH0D03982p"
FT                   /note="similar to uniprot|P05374 Saccharomyces cerevisiae
FT                   YGR157W CHO2 First step in the methylation pathway for
FT                   phosphatidylcholine biosynthesis Phosphatidyl- ethanolamine
FT                   N-methyltransferase"
FT                   /db_xref="GOA:C5DGB6"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="InterPro:IPR016219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB6"
FT                   /protein_id="CAR22458.1"
FT                   /translation="MIKERKPSKSRAPGKGHKQIPGVAKESQPIARTRTGNVEFTPAKT
FT                   HDMVRSLFDPTLKKSFLECWISLAILSNVVLCYFMATKFGASFTKKFFLWQYVFWRLCY
FT                   NVGIGVVLHFQSNYETLTNFAKMRSLFSKKNQQWLARFCRFEIESKMPNTYCLEEYPEE
FT                   FNVWLLFRQFVDLILMQDFTTYILFVVLSIPKTVLSSHTVSFALGVIMILFNVWVKVDA
FT                   HRVVKDYAWYWGDFFFFQDSKLVFDGVFNVSPHPMYSIGYMGYYGLSLISGDYKVLLVS
FT                   IGGHLLQFLFLKYCENPHIEKIYGSDAVENDNAHIDELLVKENPNYSKPLITKGLWFTN
FT                   VDKLRLTDYFTILTVASIVLFTFFLKPSTKALFWATLVAKITTSLFISLVLHKQSTSKW
FT                   FTRLFLKNGYTQVHSFYQWQFLYNYCLTVSYTLLILQTWSQFRHLESRNYTQIIFGFLL
FT                   CWLQKWCDDEILTAISEFGWFYGDFFLTNYISSRKLNSRGIYRYLSNPERFLGVAGCWG
FT                   AVLITHFSPYNLILAALWTAANIALVKLVEEPHVSKVYGTSERKSGVSKTLMGFKPIRR
FT                   FSEIMDKMELRLVRHLTSNDSPFEEEAPTSEEAQWNEVVQLALQSVTANLAPNCEFKLG
FT                   DGKCDTFIIPGPVEAHWKLPSKLYNNDDWIGLYKVFETGEDRQRTRVSSNGRWTGTNEA
FT                   AFPYSGRPKKSIVKFQRTGDFVNGTVKFDHSLMFYEEGVYELRYHSGNTHKVLMISQPF
FT                   RLSLPIVKAESAEELSEGLHQFLAEVHALDGNSFNPNSNRYLGDRFLKGLIKKASGVDL
FT                   SVKYLRRINYDVSIIGKRVQEIKAVLENLE"
FT   gene            complement(<386364..>387077)
FT                   /locus_tag="KLTH0D04004g"
FT                   /old_locus_tag="KLTH-ORF12243"
FT   CDS_pept        complement(386364..387077)
FT                   /locus_tag="KLTH0D04004g"
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12243"
FT                   /product="KLTH0D04004p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB7"
FT                   /protein_id="CAR22459.1"
FT                   /translation="MSHQCEHEHDHHHDSPPPATNNAQSLFSFVNTPNVQCLNTNSHGS
FT                   SDSAACFIKSRDDQYDVSKYLESDADCQMILHIPFTCICRIFSLVLRTSRSSSGTTSPK
FT                   TIKIFKNFSKNIDFDTLEDSKPQHEVEHPRDVGIDLDGAPRTEITDTDDSSFVEHHLPR
FT                   HLFQNAHSLTLFMQSAWEDDEDITRCFYLEMRGESAGQKRGNNAVPLLTVYESAPNPVD
FT                   HQKLENEQQGSSLGM"
FT   gene            <387535..>388557
FT                   /locus_tag="KLTH0D04026g"
FT                   /old_locus_tag="KLTH-ORF12240"
FT   CDS_pept        387535..388557
FT                   /locus_tag="KLTH0D04026g"
FT                   /gene_family="HOG000020323" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12240"
FT                   /product="KLTH0D04026p"
FT                   /note="highly similar to uniprot|P05373 Saccharomyces
FT                   cerevisiae YGL040C HEM2 Delta-aminolevulinate dehydratase a
FT                   homo-octameric enzyme catalyzes the conversion of delta-
FT                   aminolevulinic acid to porphobilinogen the second step in
FT                   the heme biosynthetic pathway localizes to both the
FT                   cytoplasm and nucleus"
FT                   /db_xref="GOA:C5DGB8"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB8"
FT                   /protein_id="CAR22460.1"
FT                   /translation="MHTAEFLDAHPTEISSILAGGYNHPLLREWQNERQLTKNMFIFPL
FT                   FISDDADEETPIDSLPNIKRFGVNRLAQYLAPLIEKGLKAVILFGVPMKEGCKDQYGTA
FT                   ADDPEGPVIQGINLLRREFPDLYIICDVCLCEYTSHGHCGVLYDDGSINREESVRRIAA
FT                   VAVNYAKAGAHSIAPSDMIDGRIRDIKYGLIKAGLAHKTFVMSYAAKFSGNLYGPFRDA
FT                   ACSSPSSGDRKCYQLPSGGRGLARRALRRDLDEGTDGIIVKPSTFYLDIMADASEIARD
FT                   VPICAYHVSGEYAMLHAAAEKGVVDFKTIAFESHQGFLRAGARLIISYLTPEFLEWLGQ
FT                   "
FT   gene            complement(<388657..>389301)
FT                   /locus_tag="KLTH0D04048g"
FT                   /old_locus_tag="KLTH-ORF12237"
FT   CDS_pept        complement(388657..389301)
FT                   /locus_tag="KLTH0D04048g"
FT                   /gene_family="HOG000208642" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12237"
FT                   /product="KLTH0D04048p"
FT                   /note="similar to uniprot|Q04272 Saccharomyces cerevisiae
FT                   YMR077C VPS20 vaculolar protein sorting (putative)"
FT                   /db_xref="GOA:C5DGB9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGB9"
FT                   /protein_id="CAR22461.1"
FT                   /translation="MGQKGSKIEVTKTDKAILQIKLSKDELHRYTRRTEILIGREREKL
FT                   KALLREDPKNGKKNPRARILLKKIHYQNHLLEQAADQLINLENLVSTVEFKLVEQQFMM
FT                   GLKQGNEVLTKLNKEFSGAEDLMDSVADQIAYQDEVDQILSSSVVGGFEEELDRELQQL
FT                   DQEVNGPAHEPAKAEPNLPSTEGLPALSEPEAEEPQQEPQSDGRQREAVLT"
FT   gene            <389632..>390534
FT                   /locus_tag="KLTH0D04070g"
FT                   /old_locus_tag="KLTH-ORF12234"
FT   CDS_pept        389632..390534
FT                   /locus_tag="KLTH0D04070g"
FT                   /gene_family="HOG000139266" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12234"
FT                   /product="KLTH0D04070p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC0"
FT                   /protein_id="CAR22462.1"
FT                   /translation="MSSNLTFVSQRSEKKNYGKPKPIPAYFPTSKKSILIPNFEFYDRV
FT                   KAAPRKLAATHAVPVRSGKAWKASKGSIVRISTPEGPQVCDFNCWEANSGFKEHMWASR
FT                   TRQLHSAHVSVYDKLWSNLPYLRPLLTIIDDSLAGYGPDEHGGRVHDLLGTRCDPYVDK
FT                   LLSGEDNDFHCHSNLYRAIREFGGEEEHVHDVLNIFQLTGLNENDQYFMETCPAKPGDY
FT                   FEFFCEVDVVCAVSSCPGGDLSDWGWGEGGTDSEANVGDMSAKCRPLKVEVFELENPEE
FT                   ALEGWESPQPVKYQGNHGF"
FT   gene            <391381..>392862
FT                   /locus_tag="KLTH0D04092g"
FT                   /old_locus_tag="KLTH-ORF12232"
FT   CDS_pept        391381..392862
FT                   /locus_tag="KLTH0D04092g"
FT                   /gene_family="HOG000217392" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12232"
FT                   /product="KLTH0D04092p"
FT                   /note="highly similar to uniprot|P32582 Saccharomyces
FT                   cerevisiae YGR155W CYS4 Cystathionine beta-synthase
FT                   catalyzes the synthesis of cystathionine from serine and
FT                   homocysteine the first committed step in cysteine
FT                   biosynthesis"
FT                   /db_xref="GOA:C5DGC1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005857"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC1"
FT                   /protein_id="CAR22463.1"
FT                   /translation="MTQYDSRTSVADLVGNTPMVHLTKLPKALGVKPQVYAKLELYNPG
FT                   GSIKDRIAKSMIEDAEKSGRIHPSRTTLIEPTSGNTGIGLALMGAVKGYRTIITLPEKM
FT                   SNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPHAVILDQYNNMKNPEAH
FT                   YQGTGKEIQGQLQQLGEYENLHGVFAGAGTGGTISGISKYLKEQNPEIKIIGADPEGSI
FT                   LAQPESLNETEAAEYKVEGIGYDFIPKVLDRGLVDTWYKTNDIDSFRYARQLIANEGLL
FT                   VGGSSGSAFSAMMKYCKDHPELTEKDVLVIILPDSIRSYLTKFADDEWLKKNNLWDDDI
FT                   LKPLGRSQKDIFKGATVKDLNLKPVVSVKENASTSDVVKILTDNGFDQLPVLTEDGKLC
FT                   GLVTLSQLLKGLSSGEEVSSIKGHFFDFRKLNNFDEVSSYNENKSGKKKFVNFDVNSKL
FT                   SDLNQFFEKNSSAVITDGLKPIHIVTKMDLLAFLA"
FT   gene            complement(<392935..>393360)
FT                   /locus_tag="KLTH0D04114g"
FT                   /old_locus_tag="KLTH-ORF12229"
FT   CDS_pept        complement(392935..393360)
FT                   /locus_tag="KLTH0D04114g"
FT                   /gene_family="HOG000141773" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12229"
FT                   /product="KLTH0D04114p"
FT                   /note="similar to uniprot|P0C5N3 Saccharomyces cerevisiae
FT                   YGL041W-A Identified by expression profiling and mass
FT                   spectrometry"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC2"
FT                   /protein_id="CAR22464.1"
FT                   /translation="MFKTLLRSASSVPFRQPALPRAIVQTPRSLFYAKRCYAKSWDGNN
FT                   SSPDVEAHLKVQKLLDDIQQHPGVAAKLHAVSEIMVSKGLANESAPPGPWQVVKILTDK
FT                   DVRKAMGEFKAELEKSGIELGPDQLGPLMTVLGMEKK"
FT   gene            complement(<393617..>394498)
FT                   /locus_tag="KLTH0D04136g"
FT                   /old_locus_tag="KLTH-ORF12227"
FT   CDS_pept        complement(393617..394498)
FT                   /locus_tag="KLTH0D04136g"
FT                   /gene_family="HOG000195015" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12227"
FT                   /product="KLTH0D04136p"
FT                   /note="similar to uniprot|P07273 YGL043W Saccharomyces
FT                   cerevisiae DST1 General transcription elongation factor
FT                   TFIIS"
FT                   /db_xref="GOA:C5DGC3"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR006289"
FT                   /db_xref="InterPro:IPR016492"
FT                   /db_xref="InterPro:IPR017923"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC3"
FT                   /protein_id="CAR22465.1"
FT                   /translation="MESKEVITLVKNLEKSKNNDESVIEILSLLDKDLKPTEKLLRETK
FT                   VGVVVNQFKKSSNAKIAGLVKKMIGEWRDAISREKKQRAMAKTGTTAASSSSATSSSEP
FT                   KRQGKFVSTKPRNAKNDGVVTTIYNHKLRDMVIRAFYDALAKESEHPPQSILTTAIAIE
FT                   KELNKVNNCELNEKAYKDKYRVVYANVISKNNPDLKHRITGGDVSPEYLVNCDPKELAP
FT                   EHLKKKNEEIARQNLFNAQGATLERSVTDRFTCGKCKEKKVSYYQLQTRSADEPLTTFC
FT                   TCEVCGNRWKFS"
FT   gene            <394755..>395537
FT                   /locus_tag="KLTH0D04158g"
FT                   /old_locus_tag="KLTH-ORF12223"
FT   CDS_pept        394755..395537
FT                   /locus_tag="KLTH0D04158g"
FT                   /gene_family="HOG000247912" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12223"
FT                   /product="KLTH0D04158p"
FT                   /note="similar to uniprot|P25299 Saccharomyces cerevisiae
FT                   YGL044C RNA15 Cleavage and polyadenylation factor I (CF I)
FT                   component involved in cleavage and polyadenylation of mRNA
FT                   3' ends interacts with the A-rich polyadenylation signal in
FT                   complex with Rna14p and Hrp1p"
FT                   /db_xref="GOA:C5DGC4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC4"
FT                   /protein_id="CAR22466.1"
FT                   /translation="MMNRSVHNNPPARTVYLGSIPYDQTEEQILDLCSNVGPVANLKMM
FT                   FDPQTGKSKGYAFIEYKSLEASASAVRNLNGYQLGNRLLKCGYYSGGDMGGGGMPGNGN
FT                   ANDEDRSTVFSGLPPGVDVNINMTTPAMMISSVLSQGSKEEQLDLLKTLQKMAQADSDQ
FT                   FASLLEQCPQLSFVVAELLLTAGLSSVDDLTQLAVQQNSTNSTPEASQDPKVQEQQREL
FT                   LRQVLQLTDSEIAVLPDDEKMTLWDLKQRAMRGEFGML"
FT   gene            <395761..>396993
FT                   /locus_tag="KLTH0D04180g"
FT                   /old_locus_tag="KLTH-ORF12222"
FT   CDS_pept        395761..396993
FT                   /locus_tag="KLTH0D04180g"
FT                   /gene_family="HOG000000936" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12222"
FT                   /product="KLTH0D04180p"
FT                   /note="weakly similar to uniprot|P39927 Saccharomyces
FT                   cerevisiae YGR156W PTI1 Pta1p Interacting protein"
FT                   /db_xref="GOA:C5DGC5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC5"
FT                   /protein_id="CAR22467.1"
FT                   /translation="MSDPRWRKARHLLTPELLSSSIQITNLPASWNESTISSIVAGSGP
FT                   IVNVSTKTDPRNGKLLGITVDYATSKDSKRALDVLRKIKKFPCDLERIMPNNKEQKEPR
FT                   KPLDLNRDAFPWEFGLELPFELVSEVPLPRRPTNPVPVSNSGPSGSDASSGVVAFPDIL
FT                   KEASKHLPGLQPNSMTSPDAISANLGKIAPLQLLEMISNLKILASQDANRDQLTKFLAS
FT                   NPDISVAVTQALLEMGFVNYSVVTKVIAEQPASRAHASPVPNNVQSIYSNGSTPGTTPM
FT                   NNSAPLNTFTAPVQQPQPQQPAPAPAVAPPMMFNAPPVPAFGFNGVAGPAPFMPAPMGA
FT                   PMGTPMAPPVVPPMPVANGAPRVNTMKLATLPQNQQDMIKQVLQLSPDQIRLLPPGQVA
FT                   MVENFKREYLM"
FT   gene            complement(<397110..>397223)
FT                   /locus_tag="KLTH0D04202r"
FT                   /old_locus_tag="Klth0D.tLeu.CAA.24"
FT   tRNA            complement(join(397110..397153,397186..397223))
FT                   /locus_tag="KLTH0D04202r"
FT                   /old_locus_tag="Klth0D.tLeu.CAA.24"
FT                   /note="tRNA-Leu (CAA) cove"
FT   gene            <397596..>398858
FT                   /locus_tag="KLTH0D04224g"
FT                   /old_locus_tag="KLTH-ORF12217"
FT   CDS_pept        397596..398858
FT                   /locus_tag="KLTH0D04224g"
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12217"
FT                   /product="KLTH0D04224p"
FT                   /note="similar to uniprot|P23542 Saccharomyces cerevisiae
FT                   YLR027C AAT2 Cytosolic aspartate aminotransferase involved
FT                   in nitrogen metabolism localizes to peroxisomes in oleate-
FT                   grown cells"
FT                   /db_xref="GOA:C5DGC6"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC6"
FT                   /protein_id="CAR22468.1"
FT                   /translation="MSCTIFNNVEQLPPDALFGIKQRLSQDPRPVKVDLGIGAYRDDSG
FT                   KPWVLPSVREAEEVIRQDPGYNHEYLGISGLTALIQGAAKVLFGEDSAALAEGRVVSTQ
FT                   SLSGTGALHVAARFISKFCGDKVVYLSDPTWANHNAIFETMGLKTATYPYWDAASKSLN
FT                   LEGYLEAIKTAPKGSVFVLHACAHNPTGLDPDQSQWTSILDAIIEREHIVLFDSAYQGF
FT                   ASGDLDRDAFAVRLGLQKLADVSPVIVCQSFAKNVGMYGERAGCFHLVLPRQDASVDTS
FT                   AIKSAVLSQLNKITRSELSNPPAYGAKIVATVLNTPRLTEQWHKDMVTMSSRIIKMRHA
FT                   LRDHLAKLNTPGNWDHIVNQTGMFSYTGLRPEMVKRLEEEHAVYLVSSGRASIAGLNSG
FT                   NVEYVAKAINEVVTHFGGAKL"
FT   gene            <399391..>400305
FT                   /locus_tag="KLTH0D04246g"
FT                   /old_locus_tag="KLTH-ORF12210"
FT   CDS_pept        399391..400305
FT                   /locus_tag="KLTH0D04246g"
FT                   /gene_family="HOG000194860" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12210"
FT                   /product="KLTH0D04246p"
FT                   /note="similar to uniprot|Q01590 Saccharomyces cerevisiae
FT                   YLR026C SED5 Sed5p is a t-SNARE (soluble NSF attachment
FT                   protein receptor) required in ER to Golgi transport"
FT                   /db_xref="GOA:C5DGC7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR021538"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC7"
FT                   /protein_id="CAR22469.1"
FT                   /translation="MDIRNRTTEFQRSVFAYSKRNGGGAPKPAAGDAAARKSEFQQKAS
FT                   TVAHEIAQTAQLLAKLAQLAKRKPMLNDNPVEIAELTYVIKRKIYSVEQSMLELSRLGG
FT                   KPGAPLPAQHSKNVMNLLNTKMKNISGDFKSVLEQRQRLEATNRDRWEKLSAQTDDEKA
FT                   RSPQVQQTYNSSNPFMSSVLEESPAGGSEAQLALPQDSSMLLLEEQNASSAYLQERSRA
FT                   VETIESTIQEVGNLFQQLAHMVQEQGEVIQRIDANVDDIDVNISGAQRELLKYFDRVSS
FT                   NRWLAVKIFAVLFVFFLVWVLVN"
FT   gene            complement(<400463..>401158)
FT                   /locus_tag="KLTH0D04268g"
FT                   /old_locus_tag="KLTH-ORF12204"
FT   CDS_pept        complement(400463..401158)
FT                   /locus_tag="KLTH0D04268g"
FT                   /gene_family="HOG000209960" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12204"
FT                   /product="KLTH0D04268p"
FT                   /note="some similarities with uniprot|P39929 Saccharomyces
FT                   cerevisiae YLR025W SNF7 Involved in derepression of SUC2 in
FT                   response to glucose limitation involved in glucose
FT                   derepression"
FT                   /db_xref="GOA:C5DGC8"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC8"
FT                   /protein_id="CAR22470.1"
FT                   /translation="MLSYFFGGGSTSKNKDAPKKAILDLREHITLLGKKEAHLQTQVAS
FT                   QEQQARTLLGKNNKTGAKNALKRKKTYESQLVKIQAQMDSLEQQLYSIESANLNLETMK
FT                   AMKQGASAMKNIHKGMDIDKVDETMDEIREQVELGEEISDAISRPLHAGAEVDEDEIDE
FT                   ELAALAQESVKQEVVAPPQGLPSVPLGKVSTPHAATLPAGQEQDAEAEEEEEDEDERAL
FT                   RELQAEMGL"
FT   gene            <402264..>402911
FT                   /locus_tag="KLTH0D04290g"
FT                   /old_locus_tag="KLTH-ORF12196"
FT   CDS_pept        402264..402911
FT                   /locus_tag="KLTH0D04290g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12196"
FT                   /product="KLTH0D04290p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGC9"
FT                   /protein_id="CAR22471.1"
FT                   /translation="MHSESNTSPQQRIITSEQWVFDRRGSREESKAGGRPKRTPISKQE
FT                   RELRRKQRELENEQLQQEHQTVANENARLKAVVARLKQDIDAYTRLILEATAHASPAPA
FT                   QAVAQAQSTQGQAARETQDRGVALPQQALPQLLDELPPMETLLVNTAKRRKHAAAGGVR
FT                   TGAGADAGAQEQDPPVLKSTHADVMLAPQSAEVGPEEVALMRKLKDVLAEME"
FT   gene            <403678..>404184
FT                   /locus_tag="KLTH0D04312g"
FT                   /old_locus_tag="KLTH-ORF12189"
FT   CDS_pept        403678..404184
FT                   /locus_tag="KLTH0D04312g"
FT                   /gene_family="HOG000160253" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12189"
FT                   /product="KLTH0D04312p"
FT                   /note="some similarities with uniprot|Q04487 Saccharomyces
FT                   cerevisiae YMR118C Hypothetical ORF and to YKL141W
FT                   uniprot|P33421 Saccharomyces cerevisiae YKL141W SDH3
FT                   Cytochrome b subunit of succinate dehydrogenase (Sdh1p
FT                   Sdh2p Sdh3p Sdh4p) which couples the oxidation of succinate
FT                   to the transfer of electrons to ubiquinone , member of
FT                   GLR.231"
FT                   /db_xref="GOA:C5DGD0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR014361"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD0"
FT                   /protein_id="CAR22472.1"
FT                   /translation="MFSLGLNSGAFWARPLRTASRRMIATAKTSPARQQEILIAQRKNR
FT                   PVSPHLTIYQPQLTWYLSSLHRVSGVILAFGFFATTIAFGTSALLGLGLTSNNLARWYH
FT                   EKVPRWMDLTAKGSFAYLFAFHFANGLRHLIWDAGKALTLRGVYTTGYAVMAVMALGGT
FT                   YLLTW"
FT   gene            <404397..>405824
FT                   /locus_tag="KLTH0D04334g"
FT                   /old_locus_tag="KLTH-ORF12187"
FT   CDS_pept        404397..405824
FT                   /locus_tag="KLTH0D04334g"
FT                   /gene_family="HOG000173756" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12187"
FT                   /product="KLTH0D04334p"
FT                   /note="similar to uniprot|P34163 Saccharomyces cerevisiae
FT                   YKL140W TGL1 Steryl ester hydrolase one of three gene
FT                   products (Yeh1p Yeh2p Tgl1p) responsible for steryl ester
FT                   hydrolase activity and involved in sterol homeostasis
FT                   localized to lipid particle membranes"
FT                   /db_xref="GOA:C5DGD1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006693"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD1"
FT                   /protein_id="CAR22473.1"
FT                   /translation="MPTVVPFLGRISFTDYVILFLVSLEKLLAVLLNCIPQALFDAAAL
FT                   LINCVTRKAVNPVDAMARQLRDARGIHEMGRLFDVDIEDHIVRTEDDYLLTVHRIAPRE
FT                   GSSNGQVVYLHHGLLMCSDVWMCNTARERNLPLVLHDLGFDVWLGNNRGNKYSTQHLYR
FT                   RPGSHEFWDFSIDEFAFFDIPNSIEFVLEHTQLPQLICIGFSQGSAQTFASLSVREDLN
FT                   SKISLFVAISPAMTPQGLHNRIVDSLLKSSPRLMYLFFGNRILLPSATVWQKTLHPTIF
FT                   NFIIDVANRVLFNWRSENISPHQKQASYAKLYSTTSVKSVVHWFQILHAQKFQMFEEYD
FT                   IVINSWNPTRSYQITTFPTRTNIRIPVLLLYGGSDSLVDIEVMKSNLPSSQVFDVMIPE
FT                   HEHLDLIWGRDVANLVIPNVLRFIWFFNDVKALDKEASFEGDADDYDDATGALDSVQDL
FT                   ASPFNKSYSASTSTKDI"
FT   gene            <405904..>407401
FT                   /locus_tag="KLTH0D04356g"
FT                   /old_locus_tag="Klth0D.mRNA.238.p"
FT   CDS_pept        join(405904..405987,406076..407401)
FT                   /locus_tag="KLTH0D04356g"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0D.mRNA.238.p"
FT                   /product="KLTH0D04356p"
FT                   /note="similar to uniprot|Q03957 Saccharomyces cerevisiae
FT                   YKL139W CTK1 Catalytic (alpha) subunit of C-terminal domain
FT                   kinase I (CTDK-I), which phosphorylates the C- terminal
FT                   repeated domain of the RNA polymerase II large subunit
FT                   (Rpo21p) to affect both transcription and pre-mRNA 3' end
FT                   processing"
FT                   /db_xref="GOA:C5DGD2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD2"
FT                   /protein_id="CAR22474.1"
FT                   /translation="MLKNWKLYFLVLRHRKTTRCIKTTPLLDRTGPRPTGPSDASRNGP
FT                   HSAFPERSNGHQVSAAGSLGPERKRPRVGNSRYAGSRYQDAGFHSSSKQRLNVQNIPTG
FT                   HRDVPKRQSRYDPGNAKPKAVPVTVVVRERDSSVYERIQQVGEGTYGKVYKARNTLTGQ
FT                   LVALKRLRLEGEREGFPITSIREIKLLQSFDHRNISTLSEIMVESQKTVYMIFEYADND
FT                   LSGLLMNEQIVLSSANCKHLFKSLLEGIHYLHSNGILHRDIKGSNILIDNKGQLKITDF
FT                   GLARKMRDDSDYTNRVITLWYRPPELLMGSTNYGTAVDMWGCGCLLVELFQKTAIFQGT
FT                   NEVEQLNAIFSIMGTPSVEQWPTLFEMPWFFMMIPQQNRKYEPRFDEKFGAVLPSPAAV
FT                   SLAKGLLLYDEKRRLSASEALRHQYFREEPQPQPLDLSGFDGWHEFEAKRHRRKEREEQ
FT                   KRREKSESQGS"
FT   gene            <407803..>408396
FT                   /locus_tag="KLTH0D04378g"
FT                   /old_locus_tag="KLTH-ORF12173"
FT   CDS_pept        407803..408396
FT                   /locus_tag="KLTH0D04378g"
FT                   /gene_family="HOG000154375" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12173"
FT                   /product="KLTH0D04378p"
FT                   /note="weakly similar to uniprot|Q04477 Saccharomyces
FT                   cerevisiae YMR117C SPC24 Component of the evolutionarily
FT                   conserved kinetochore-associated Ndc80 complex (Ndc80p-
FT                   Nuf2p-Spc24p-Spc25p) involved in chromosome segregation
FT                   spindle checkpoint activity and kinetochore clustering"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD3"
FT                   /protein_id="CAR22475.1"
FT                   /translation="MSEEALIENPSNLIRETRTNFSIVNDTEALSNISKNLNELQRIVK
FT                   EKLDRKSNELSQSESALEKNEARLDTLRRARTESGSGQLQGGSSEDVLEMARELESLER
FT                   RLVELRQEVDRGLEQLIEKNADDGKVQELEESQTEDPEHRTNVLKIQLYRSLGVVLDAD
FT                   NNRALISKDGTLDVVPVGGDASAYFRTKYLWDRI"
FT   gene            complement(<408480..>408875)
FT                   /locus_tag="KLTH0D04400g"
FT                   /old_locus_tag="KLTH-ORF12171"
FT   CDS_pept        complement(408480..408875)
FT                   /locus_tag="KLTH0D04400g"
FT                   /gene_family="HOG000166603" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12171"
FT                   /product="KLTH0D04400p"
FT                   /note="similar to uniprot|P14063 Saccharomyces cerevisiae
FT                   YKL138C MRPL31 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="InterPro:IPR016340"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD4"
FT                   /protein_id="CAR22476.1"
FT                   /translation="MFGPFKSSNTLLGGLLWKIPWRMSRPQKQRQRHRLQDVDSVIKSL
FT                   NLGLHAERSVQKGISYDEAINSSKQLKPGVKQLRLLNKPSLFPNEPQMSYKDKYTYFNK
FT                   QAKGYRKGIHKLPKWTKITQRRNPAFF"
FT   gene            <409088..>409414
FT                   /locus_tag="KLTH0D04422g"
FT                   /old_locus_tag="KLTH-ORF12169"
FT   CDS_pept        409088..409414
FT                   /locus_tag="KLTH0D04422g"
FT                   /gene_family="HOG000111896" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12169"
FT                   /product="KLTH0D04422p"
FT                   /note="similar to uniprot|P36064 Saccharomyces cerevisiae
FT                   YKL137W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR013892"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD5"
FT                   /protein_id="CAR22477.1"
FT                   /translation="MAQEQDTPQARRLPVWVLGPREEKEARQNLKKFAYSKCDEYVKAM
FT                   VECSKLHGLKVFPACEPQRDKMAECILSYQGDNYLDQQRDKLVQRKIEKLEEQLKQQQQ
FT                   NELK"
FT   gene            complement(<409499..>411616)
FT                   /locus_tag="KLTH0D04444g"
FT                   /old_locus_tag="KLTH-ORF12168"
FT   CDS_pept        complement(409499..411616)
FT                   /locus_tag="KLTH0D04444g"
FT                   /gene_family="HOG000163270" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF12168"
FT                   /product="KLTH0D04444p"
FT                   /note="similar to uniprot|P36000 Saccharomyces cerevisiae
FT                   YKL135C APL2 Beta-adaptin large subunit of the clathrin-
FT                   associated protein (AP-1) complex"
FT                   /db_xref="GOA:C5DGD6"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016342"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGD6"
FT                   /protein_id="CAR22478.1"
FT                   /translation="MEKMLKKFIQNATRVAPKISKKGELFELRNGLVSQYPQTRKDAIK
FT                   KTIQQMTLGKDVSSLFPDILKNIATSDVEQKKLVYLYVMNYAETHPELCILAVNTFVSD
FT                   AQDTNPLIRCMAIRTMSMIRVDKILEYVEIPLRKTLQDDNPYVRKTAVICVAKLFALNK
FT                   ELCQELGVLEDLISALEDSNPMVVANAIAALSDIYEADESVVPLPKLIQSHVSQFLLAL
FT                   NECTEWARIIILGALAEYTAKDSLEAQEIIDRVTPHLQHVNAAVVLASIKVVIKNLPQV
FT                   QANTESPIFSKLSSALVSLMSTPPEMQYVALRNIRIVLEKYPHILSRELRIFYVKFNDP
FT                   LYVKLEKIDTLVRLVDPSNLKQCTLLLAELKEYAMEFEPEFVSRAILALSQLGVKYSEP
FT                   KFITKVLEIIIELCNTRDSFQDDCLVAMCNLLRHAGPDQEGMVTQVCSLAEAWSSVENL
FT                   LQTDYAKCNYIWLLGQFPQKFNNVERKLQASIDSFTQEESLTQMSLLISVVKLHSILPG
FT                   SMLQNLLELATTSTDEVDVRDMAIMYWRCLSVESSHDGLINELCNSSLPEIATTLDTFS
FT                   PELLETLLRELSLLSSVYFKPVSTMTKPKSSSGNHLKGKQLDELQFMAQDEILKNMNED
FT                   NLLDFDNDWPAASNSNYKSEAQGSTVDYLNDIFGLSSPAPPVENSMADLSLNKKDEKQK
FT                   SSNTQDLLDLF"
FT   gene            <413024..>414238
FT                   /locus_tag="KLTH0D04466g"
FT                   /old_locus_tag="Klth0D.mRNA.267.p"
FT   gene            <413639..>413725