(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_5

ID   LACTH_5; SV 1; linear; genomic DNA; STD; FUN; 1521774 BP.
XX
AC   CU928169;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome E complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1521774
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1521774
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1521774
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="E"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0E"
FT                   /db_xref="taxon:381046"
FT   gene            <844..>1952
FT                   /pseudo
FT                   /locus_tag="KLTH0E00110g"
FT                   /old_locus_tag="pseudo-Klth0E-844-1952"
FT   gene            <3262..>5010
FT                   /locus_tag="KLTH0E00132g"
FT                   /old_locus_tag="KLTH-ORF10338"
FT   CDS_pept        3262..5010
FT                   /locus_tag="KLTH0E00132g"
FT                   /gene_family="HOG000157706" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10338"
FT                   /product="KLTH0E00132p"
FT                   /note="weakly similar to uniprot|P53389 Saccharomyces
FT                   cerevisiae YNR055C HOL1 Putative ion transporter similar to
FT                   the major facilitator superfamily of transporters;
FT                   mutations in membrane-spanning domains permit nonselective
FT                   cation uptake"
FT                   /db_xref="GOA:C5DB82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB82"
FT                   /protein_id="CAR23058.1"
FT                   /translation="MTTVIDYNVIPGDSHLVDFDETRKSGEREGKIVLNPTPSDDPDDP
FT                   LNWTPRRKWTAVACVLIYTLGACIPTAAIYSVLPNIEANTNITLSELNNGTGYMFLFLG
FT                   LGCLIFQPLALQFGKRPIYLFSMLATALICVWPPYTKSNGEWVASKILQGFVGSSMESL
FT                   PEISMSDLFFEHERSFALSLYGLTLLSASFLAPFVAGFISEGQGWEWVMWWCAIFGAVC
FT                   FVLLFFLMEETNYDRKLKVDAATGEVITLASRKQQLGAVFTNIDEVIASNSEGNNAGEK
FT                   NETKTNDIGASLQTEEYPENINIVNQVSNVEVVDSNSYAPNYEGTKTYLQKLSLFGGRR
FT                   KKFLLQHYIFAPFLMARFPVVLWAGFLYGSSLVWFNVLNATAALILGGSPYDFSSSTIG
FT                   VAYLSPTIFSVILFFISGLCSDWLKVRVALWRGTGLSKPEDRLWILVIYCVLGCAASIL
FT                   WGVGAYYEIHWFGLVFGMGLLGGCGIFGIASSATYVVDTYKELDTEAMVVVIIIRNCMS
FT                   FGVSYGITDWVTDLGYKKCFISVAFLCFAANFTFLAMVYFGPRLRNRQKHMYWSMVDKY
FT                   RKLGMH"
FT   gene            <6352..>7461
FT                   /locus_tag="KLTH0E00154g"
FT                   /old_locus_tag="KLTH-ORF10335"
FT   CDS_pept        6352..7461
FT                   /locus_tag="KLTH0E00154g"
FT                   /gene_family="HOG000246736" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10335"
FT                   /product="KLTH0E00154p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ8"
FT                   /protein_id="CAR23059.1"
FT                   /translation="MKCLQTVLASAICLISKAAAEVFIVDNDTPTALQVLLPLAAGKQV
FT                   LGITTNLGDYDTDAATYEAAMALSTGNLTSCVPVYKGAEQPLLLDYNTYHLWQDLYGDI
FT                   VWQGAWDKDYESPVPVNASYEYNKTVGAPQWIMDTVKNSKDNVTIVAAGTMTNLALALA
FT                   QWPAMAEKVKLVIMGGYVDGQIAQTTGGDFVNDMYTDFNLMVDPEAAQTALSAPWKELV
FT                   IVGNISSEIFPTQDLYNELIAVSGGLAEIKSNKSLGYVSETVGNGTLPSFNLPYWDEVA
FT                   SAIAADPEIVTGSYDAYVSVDTSFSSPFYGSLRIYPANLRAKKGVRTGKAKMITSIDEG
FT                   KLNAMIVDALVRDWTNYCKTGSAPSVAIM"
FT   gene            <8605..>10311
FT                   /locus_tag="KLTH0E00176g"
FT                   /old_locus_tag="KLTH-ORF10330"
FT   CDS_pept        8605..10311
FT                   /locus_tag="KLTH0E00176g"
FT                   /gene_family="HOG000142052" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10330"
FT                   /product="KLTH0E00176p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DGZ9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DGZ9"
FT                   /protein_id="CAR23060.1"
FT                   /translation="MPHRSKTACALCKAEKKCCDKKRPKCSHCTDENVACSYPLTLRWG
FT                   GRPYKDKTKQIKIPKNTVLVDGVLMVRDKSHLSPNRYERRSRLVLINEGPVFTKDITKG
FT                   KVRKAVEGASEESSVQISNPCYFTPQGSMPSLKLLNCSLEHSTFFEFYVYKTSYHFVAL
FT                   NKGCKSNPFHTIVPQMAMFNPSLMKLVMAFGGEHRERFRRLENPQLCYSLDEDFVGKKP
FT                   LTMTGQELLKQGVMELVDQLASPKTVIDDTVLASVLVLASFCIYFGTIENKWHAHLYGA
FT                   EGIILRELKEKSKIEKGLLRYTCEQGPYFFLRRWFAYMRIWGCISSASFRQKTVERPLL
FT                   EIDFEEAQDPRRHKNGDVDYALYTSGMESLVLSYLAQVANLILKSETRPPGSDREYIFR
FT                   DAVELEYKIMNYLGSRKQEGEASLKRFLPLTERAPCDSTKQYSILIATNMLFGLTGVLQ
FT                   LRRRVLGLTHESLLVQNLVLKITDLIEKKLSTGTFVQPCLLFCFFSCGCELLDESLVPK
FT                   RTLFLNLLDSLIRDGVESARQARSAMQECWRTSKPWWEVLKERGLDICFAI"
FT   gene            complement(<10634..>11638)
FT                   /locus_tag="KLTH0E00198g"
FT                   /old_locus_tag="KLTH-ORF10327"
FT   CDS_pept        complement(10634..11638)
FT                   /locus_tag="KLTH0E00198g"
FT                   /gene_family="HOG000050225" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10327"
FT                   /product="KLTH0E00198p"
FT                   /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
FT                   YDL144C Hypothetical ORF"
FT                   /db_xref="GOA:C5DH00"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH00"
FT                   /protein_id="CAR23061.1"
FT                   /translation="MPNKPNVLLVGAGGVGAMASFALEYSGESSVTSVLRSDYAHVVEN
FT                   GFKINSCDYGRGIRYRPSNVVNSIEASKQYGPFDYVVLATKCIPGVSSMIDIIAPAVSK
FT                   DTAIVLIQNGIGIEDEALFKCPGNVILSGVSMIASSNVKGHIEHSDRDFLSVGYFENVN
FT                   LTNEHQEKVCKRFVSMYKNDKNQCVFDENVKYSRWRKLVYNAGLNPVCALTEADVGRLE
FT                   IFGGTDSIIRKAMKEVIAIAKSDGVELSEALMDFMIRSKDPVYYRPSMLVDIDKGNPLE
FT                   VEVICGNPVRIAKKNGVEAPYLTLIYDLLKVVQGRIMEKRGMLIVPKERQVPK"
FT   gene            complement(<12415..>13335)
FT                   /locus_tag="KLTH0E00220g"
FT                   /old_locus_tag="KLTH-ORF10326"
FT   CDS_pept        complement(12415..13335)
FT                   /locus_tag="KLTH0E00220g"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10326"
FT                   /product="KLTH0E00220p"
FT                   /note="similar to uniprot|P14065 Saccharomyces cerevisiae
FT                   YOR120W GCY1 Putative NADP( ) coupled glycerol
FT                   dehydrogenase proposed to be involved in an alternative
FT                   pathway for glycerol catabolism"
FT                   /db_xref="GOA:C5DB86"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB86"
FT                   /protein_id="CAR23062.1"
FT                   /translation="MATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHID
FT                   TAAIYRNEAAVGRAIRDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYL
FT                   MHFPVALKTDLIKDGNVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVS
FT                   NFSIKNIEEILKPELGLSVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESS
FT                   MLTDPDLIKLAEKHQVEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQ
FT                   ISKILEKLGSKRYVSPSWAPFPMYE"
FT   gene            complement(<15734..>19045)
FT                   /locus_tag="KLTH0E00242g"
FT                   /old_locus_tag="KLTH-ORF10319"
FT   CDS_pept        complement(15734..19045)
FT                   /locus_tag="KLTH0E00242g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10319"
FT                   /product="KLTH0E00242p"
FT                   /note="some similarities with uniprot|P32768 Saccharomyces
FT                   cerevisiae YAR050W FLO1 Lectin-like protein involved in
FT                   flocculation"
FT                   /db_xref="GOA:C5DH02"
FT                   /db_xref="InterPro:IPR001389"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH02"
FT                   /protein_id="CAR23063.1"
FT                   /translation="MWYLAIRLASFAFIALASSSENEENIGNHVCLPQGLSFPGFRANI
FT                   YSYKYLDRESAYSFDYLQSGYQYNSKLLKQAFGITDPSFRLVHEENGVAGGQLYGEDIT
FT                   TTNFTLELVGYFQPSQSGVYTITANEIDDGFSLMMGESAFKCCTSNSFTEQESSDGTVQ
FT                   LTKRDDQSENGEPTTDLHGFYHMGATSVQVELREGMFYPLRLVFANMERTAIMDLSLIL
FT                   PDGTIKNTFEEVTFFPEDDGSNGQCDALVVTEGYTGTVTSTSTADDTTPTIYILTPTAV
FT                   LTTTLYTPWTGSETVTYSTETTTFTGSGGVPTTETIYYVETPTAATESTTYTPWTGSET
FT                   STFSTETTTFTGSDGVPTTETIYYVETPTAATESTTYTPWTGSETVTFSTETTTFTGSD
FT                   GVPTTETIYYVETPNVGTESTIYTPWTGSETVTYSTETTTFTGSDGVPTTETIYYVETP
FT                   TVGTESTIYTPWTGSETSTFSTETTTFTGPDGIPTTETIYYVETPNVGTESTTYTPWTG
FT                   SETVTYSTETTTFTGSDGVPTTETIYYVETPTAATESTTYTPWTGSETVTFSTGTTTFT
FT                   GSDGVPTTGTIYYVETPTAPVNTPTSGKPLYPSSSAPVSETYFSVVSSAPSPSSPVSET
FT                   SSTPVSSVPSSSAPVSETSSTPVSSVPSSSALVSEYSSTPVSSVPSSSAPVSETSSTPV
FT                   SSVPSSSAPVSETSSTPVSSVPSSSAPVSETSSTPVSSAPSSSAPISSVPHSYPYYHNT
FT                   TSAAGIGSTSYPVSLSSTPATSGSAPATSETTPATSGTPATSGSVPATSGSIPTTSTCQ
FT                   TIVKSAVSGTTTIFTTTCPESTLPTTTGPAQTESVVTVTESGTVTSYTTTCPITEVEPT
FT                   TTGPDNAKTVLVSSVSGTVTSYTTTLPASESQPATTAPASSESVVVSSASGTVTSYTTT
FT                   LPASESQPATTAPASSESVVVSSASGTPVTESIVTDTVSGTTTIYTTTCPVSSAVETTS
FT                   PGPANSEIVTTSTISGTETVYTTTAPLSSAQKTEAASPSGSQTKSVESSPAYSGSYTTP
FT                   GASGSYVTQTPSSSLEVQSSSSVAAVSTTAGVSTFEGAANKLRAGLLLAIPLALL"
FT   gene            complement(<21896..>23587)
FT                   /locus_tag="KLTH0E00264g"
FT                   /old_locus_tag="KLTH-ORF10306"
FT   CDS_pept        complement(21896..23587)
FT                   /locus_tag="KLTH0E00264g"
FT                   /gene_family="HOG000231892" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10306"
FT                   /product="KLTH0E00264p"
FT                   /note="highly similar to uniprot|P38361 Saccharomyces
FT                   cerevisiae YBR296C PHO89 Na+/Pi cotransporter active in
FT                   early growth phase"
FT                   /db_xref="GOA:C5DH03"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH03"
FT                   /protein_id="CAR23064.1"
FT                   /translation="MLFAFLDAFNIGANDVANSFASAISSRSLEYWQAMILAGLCEFLG
FT                   AALTGSRVSKTIKNDIIDASTFNNDPAVLMLTMTCALVGSSCWLTIATSIGLPVSTTHS
FT                   IVGGIFGAGIAASGAGGVVWGWDGVAQIIASWFIAPVLAGLIAAIIFTISRICVLEVKT
FT                   LEKSIKNALLIVGLLVFATFSILTMLIVWKGSPNLHLDNLSETETALSIVLTGAIASVV
FT                   YFIFFYPFYRRKLLHQDWTLKLADILRGPVFYFKPLDEIPPMPENHQLTIDYYEGKRFP
FT                   QEALVGVSDEENKMPNVSTKSINDNDDNLQRTGSVETKTEPENKMTTRQYWWSLLKQGP
FT                   KQWPKLLWLVASHGWTQDVVNAQVNDKDMLSDNLVDMFKRSKYYDNRVEYIYSVLQAIT
FT                   AATMSFAHGANDVANATGPLAVVYEIWKTNATAAKSDVPVWVLAYGGAALVLGCWTYGY
FT                   KIIKNLGNKIILQSPSRGFSIELAAAITTVMATQLAIPTSTTQIAVGGIVAVGLCNKDV
FT                   KSVNWKMVAWCYSDWFFTLPIAGLIAGILNGIILNAPHFGGVYEMT"
FT   gene            <26588..>27502
FT                   /locus_tag="KLTH0E00286g"
FT                   /old_locus_tag="KLTH-ORF10301"
FT   CDS_pept        26588..27502
FT                   /locus_tag="KLTH0E00286g"
FT                   /gene_family="HOG000076648" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10301"
FT                   /product="KLTH0E00286p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH04"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH04"
FT                   /protein_id="CAR23065.1"
FT                   /translation="MYSFFVFGFFFLAIAASFPLYKRANLDVDILQFALTLERLENKFY
FT                   KEALSMWSVDDFVDANFTEDFYTQLKYIVHDEEAHLVFLEQTIRATGAEPVQACTYKLP
FT                   LDGPAGFVKNLATFEGVGVSAYLGAASLISSKKYLTVAGSILSAEAIHQAAARNAIGEI
FT                   PMANPFATPLSANAIYSIASQFIESCPVNNTKLPFKAYPELFVTQGLPTAMNSSITFAS
FT                   NGTLPNSTQIYVTFVSGLDVIPVAGSRNGSSIRATVPEMVSGQSYVFLTTGNSSNLTDS
FT                   NILYGPAIIEVTPSSPTFNVSIF"
FT   gene            complement(<28103..>29218)
FT                   /locus_tag="KLTH0E00308g"
FT                   /old_locus_tag="KLTH-ORF10298"
FT   CDS_pept        complement(28103..29218)
FT                   /locus_tag="KLTH0E00308g"
FT                   /gene_family="HOG000276738" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10298"
FT                   /product="KLTH0E00308p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH05"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH05"
FT                   /protein_id="CAR23066.1"
FT                   /translation="MSFNKIPVLSLADAYSADKKPRFLECLREALINVGFLLITDFEEH
FT                   GPSHQNFERIKTQAVKFFSLPDHVKTECEMINSPHFLGYTRLANEITGGKADWREQIDL
FT                   ATELPEPKEGEPLYKQIEGPNLWPRDEFAPEFRPVVTAYIEQMTKLSKSFRGLICEAIG
FT                   LPPDGFDSYFKENQQCKMKLIAYPEKKDTPQSSIEGSTLEQDQGQGVGAHRDSDFFTFI
FT                   YQASDHKGSLQVQNFQGDWIPIDNVQGSLVVAVGQTLEAITKGVCKATIHKVTSPQGGS
FT                   GTRLSIPFFQTIDLDAHKSAILDIPQEILKLKDKRDKLITNWGSNIGFQFTPGSNDHPI
FT                   GYAVFRNRIKSHQDVAAKWYPEILEQVLRGD"
FT   gene            complement(<30414..>31385)
FT                   /locus_tag="KLTH0E00330g"
FT                   /old_locus_tag="KLTH-ORF10297"
FT   CDS_pept        complement(30414..31385)
FT                   /locus_tag="KLTH0E00330g"
FT                   /gene_family="HOG000256365" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10297"
FT                   /product="KLTH0E00330p"
FT                   /note="highly similar to uniprot|P40447 Saccharomyces
FT                   cerevisiae YIL164C NIT1 Nitrilase member of the widely
FT                   found nitrilase branch (EC:3.5.5.1) of the nitrilase
FT                   superfamily"
FT                   /db_xref="GOA:C5DH06"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH06"
FT                   /protein_id="CAR23067.1"
FT                   /translation="MMAKKVVAALQVGTSPGGTQETLEKILSYEKEIIEAGAKLIVIPE
FT                   ATLGGYPKGSIFGTYLGYRLQSGREEFRRYHEQAIEIGKGDAYPEIAQLSMLAKRTDAT
FT                   VVCGCIERDGATLYCTMVYIDPVQGLVGKHRKLMPTAGERLIWGRGDGSTLPVVDSAVG
FT                   KLGGAICWENMMPLLRYAMYEKGVEVWCAPTVDERDIWRTAVQNIGYEGRVFVVSAVQF
FT                   MPDAKTMGLGEEFGEEGMRRMPGKGTDGSENLINGGSVIINPYGEIIAGPLLGREGLLA
FT                   AEIDTSLIVESRFEFDPTGHYSRGDVFQLTVNEKSHDTVFIK"
FT   gene            <33232..>34779
FT                   /locus_tag="KLTH0E00352g"
FT                   /old_locus_tag="KLTH-ORF10294"
FT   CDS_pept        33232..34779
FT                   /locus_tag="KLTH0E00352g"
FT                   /gene_family="HOG000074724" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10294"
FT                   /product="KLTH0E00352p"
FT                   /note="similar to uniprot|P43634 Saccharomyces cerevisiae
FT                   YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6] fungal-
FT                   type binuclear cluster domain DNA-binding transcriptional
FT                   activator or CHA1 and to YOR337W uniprot|P47988
FT                   Saccharomyces cerevisiae YOR337W TEA1 Mutants are defective
FT                   in Ty1 Enhancer-mediated Activation Ty1 enhancer activator"
FT                   /db_xref="GOA:C5DH07"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH07"
FT                   /protein_id="CAR23068.1"
FT                   /translation="MKAAKDIREIKKILQSLPINDVNQDIPEGAICSNSGNSTGLVAPK
FT                   LGNMVYSSIYPSDSLNISKEITTSNAEEALPGFLSAKARNLSKDPYILSAMSNFFRWLY
FT                   PGHYMFIHRETLLKALFEKPTTKSYYCSEELVLAVASLGSQIAESQDELLQKADEFYAT
FT                   SKSLVLGKIFQANQHTSGYSKNSSKLAIIQTLLCLAFYDIGRGENPMAWYFSGLAFRIA
FT                   HEVGLHLNPKTWNNVYASDLSRIDVEVRSRIYWGCYIADHLICTLFGRSKSLRLSNSTT
FT                   PETEDLPDIEAGIEMFQYDPAASLSVVKPLKSLIALSKVAELFVRKIFGPCSSLTQRDE
FT                   SLNKLNMSFHEWRCNLPSSLKWSKTCLKTFDFDPTKAFVWIHFYVVSLSYNKPFINDVE
FT                   SCRMVVKECIEDLYYLFSSFKRKNETLCKSSLYLCYSAILAVQCIKFGTIQQEYLEYFM
FT                   NFLKSPSQPYDLGRKILELELDTESFDVFGFFASGDDYSSEFDFEFVLSNCGIQSPS"
FT   gene            complement(<36763..>38091)
FT                   /locus_tag="KLTH0E00374g"
FT                   /old_locus_tag="KLTH-ORF10292"
FT   CDS_pept        complement(36763..38091)
FT                   /locus_tag="KLTH0E00374g"
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10292"
FT                   /product="KLTH0E00374p"
FT                   /note="weakly similar to uniprot|P07991 Saccharomyces
FT                   cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse),
FT                   catalyzes the second step of arginine degradation,
FT                   expression is dually-regulated by allophanate induction and
FT                   a specific arginine induction process; not nitrogen
FT                   catabolite repression sensitive"
FT                   /db_xref="GOA:C5DH08"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH08"
FT                   /protein_id="CAR23069.1"
FT                   /translation="MESMTLEKNQYSYFDQSTFQKASQRLLNYGARFTPQVVTYAKGSY
FT                   VYINDKKVLDFTSGQMSTLLGHGHPEIAETITKHASGLDHLYSGMVSPPVLELAEKLTS
FT                   ILPKGLDRAMFLSTGSEANEAAIKLAKNITGRFEVVGFSLSWHGMTSGSNGTTYQDGRK
FT                   NQGPLMPGNLCLPAPNAYRSIFRKPDGSHDWETELDYGFSLIDAASVGSLAACIIEPVM
FT                   SCGGMLVLPDGYLKALKKHCEKRRMLLIVDEAQTAIGRCGDMFAFESHGIVPDILTLSK
FT                   TLGNGIPLSAVVTSDEISKKSAENGYLFYTTHINDPLPAAVGVKVLEIVQRDNLVPHSR
FT                   QMGELFRKRLRELQKVYRQIGDIRGRGLMTGVELVDPDTLEADGQLAEKLASTMMKFGL
FT                   SANLIAVPAFGGVFRIAPPISVSEEEILLGVEIIQKAFSEVIS"
FT   gene            <40060..>40920
FT                   /pseudo
FT                   /locus_tag="KLTH0E00396g"
FT                   /old_locus_tag="pseudo-Klth0E-40060-40920"
FT   gene            <41913..>42527
FT                   /locus_tag="KLTH0E00418g"
FT                   /old_locus_tag="KLTH-ORF10285"
FT   CDS_pept        41913..42527
FT                   /locus_tag="KLTH0E00418g"
FT                   /gene_family="HOG000136024" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10285"
FT                   /product="KLTH0E00418p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH09"
FT                   /protein_id="CAR23070.1"
FT                   /translation="MSNPESFRELCRKEIHTGPTSGVLPGYIQANLLILPKCVAESFED
FT                   LCTRNPVACPILSKTEGRPQFLRNHASLIKQGTFDIRTDFPRYNVYSRGKLVQQKNNCV
FT                   NEWSSDHVGFLIGCSFTFEHALEKAGLVPKNVLYNKNVSMFRTTKFLDSAGIFHQCPYV
FT                   VSMRPYKLTEVEIVREITRKFKKTHGEPLDWGYDGAKRLGI"
FT   gene            complement(<42945..>45011)
FT                   /locus_tag="KLTH0E00440g"
FT                   /old_locus_tag="KLTH-ORF10284"
FT   CDS_pept        complement(42945..45011)
FT                   /locus_tag="KLTH0E00440g"
FT                   /gene_family="HOG000141945" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10284"
FT                   /product="KLTH0E00440p"
FT                   /note="some similarities with uniprot|P25502 Saccharomyces
FT                   cerevisiae YKL015W PUT3 Positive regulator of PUT (proline
FT                   utilization) genes zinc-finger transcription factor of the
FT                   Zn(2)-Cys(6) binuclear cluster domain type"
FT                   /db_xref="GOA:C5DDC4"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC4"
FT                   /protein_id="CAR23071.1"
FT                   /translation="MPRKKMMKACIKCKQRKKKCSGQLPCDYCVKIEQPGGCEYRTRTK
FT                   SKVVKVTERYISSLKNKIRALEAELAKASEGPDSEGCLEDGATSAEVNPLIEPEFRLTP
FT                   DLDSPKQESLTIGSVEHCVQASQHSKQFLGMSSCVQYLAKLKQSLVNSCGSSTEHFVAT
FT                   DGGWPPNDLDINRSFVENVATKELPDLRKAKELIEIAHEIIGADYMFLETGYFEDTAQH
FT                   LICKNPPPLQSEAIIEYTTELLRLVAHLALGSLFDKENAESRSLGLKYHRTTLLLYSEL
FT                   VKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTKTIVENR
FT                   VFWLCFIYDRLLAVRFGFPLMIDERNINIPLLTEVDDNLTAVSLDIYHFVSQVRLAKIT
FT                   TQIITKIYTRNPYSFLHNCHAVLKQLKNWFESLPAELKFDYNDIKTATTRSTFNLHINY
FT                   NYSIIIATRPVLLYVFNSILTENRTKEKIYEARQLELISVLLESCVQAAEIQSRILAKL
FT                   YYDGKLANRSFLDCHYIFSATTVLILTGYCSMLSGESIAFSGDIEGLFDFIQHNLKILQ
FT                   GLSEYNLAAKNFNKQLTELIDMMSSDEVVKALATGRSQNDPTSVDFQQAVASPRPMSRI
FT                   LRKRGNNPPKDFEEIGYVDLSQLVNNMDAEFRSGSTTDLFLDEDFMNYASGSL"
FT   gene            <45358..>46869
FT                   /locus_tag="KLTH0E00462g"
FT                   /old_locus_tag="KLTH-ORF10283"
FT   CDS_pept        45358..46869
FT                   /locus_tag="KLTH0E00462g"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10283"
FT                   /product="KLTH0E00462p"
FT                   /note="weakly similar to uniprot|P53322 Saccharomyces
FT                   cerevisiae YGR260W TNA1 High affinity nicotinic acid plasma
FT                   membrane permease"
FT                   /db_xref="GOA:C5DDC3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC3"
FT                   /protein_id="CAR23072.1"
FT                   /translation="MAIGLVKTVQMETTHSVATKDPIKVSIHDDAELSEELAEHVIEEE
FT                   YYIDPQDESALTRKLDTRLLPMLAFMYFLSALDRSNIGNAYTSGMKEDLRLTSHQYSNA
FT                   VSVFYSTYLAAELPAVWLLKIAKPRYYMSILVFCWSVITLSSGFVKSYHSLLATRILLG
FT                   TFEGGFFPAMTLLITMMYKPKEQAKRIAFFFGSSALSGAFGGLIATGLASVNNAGGLEG
FT                   WRWLYIIEGLISVCASFWLFFGLPDNLDKMKFLNERELSLMQIREKQRIQYMGADPAFS
FT                   WGQVWLAFKDFKTYFAFVIQFCQDIILYGFSTFLTAILKLGLGYSSREAQYMSVPVYIL
FT                   AAIVFMVSAYVSDRLQVRGPVFFCYNILGATGYIILLAVDNNAVKYFACYLITFSLYTG
FT                   TGLNITWLTNNVAPHYKRATALGLNQTLGNLSGAIVGQVYTKSPYVFGNSFSLGCIVLS
FT                   NILTAVQIAWLVKLNKDKAAILAGTKKDTKKERIGDEALDFKYCL"
FT   gene            complement(<47160..>50996)
FT                   /locus_tag="KLTH0E00484g"
FT                   /old_locus_tag="KLTH-ORF10282"
FT   CDS_pept        complement(47160..50996)
FT                   /locus_tag="KLTH0E00484g"
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10282"
FT                   /product="KLTH0E00484p"
FT                   /note="highly similar to uniprot|P28273 YKL215C
FT                   Saccharomyces cerevisiae Hypothetical ORF"
FT                   /db_xref="GOA:C5DH12"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH12"
FT                   /protein_id="CAR23073.1"
FT                   /translation="MSKIRIAIDRGGTFTDCIGNPGTGKPQDDVVIKLLSVDPKNYPDA
FT                   PLEGIRRLLEIFQKKKISRGVPLDLSDVESLRMGTTLATNCALERNGERCVFVTTKGFK
FT                   DCLLIGDQTRPRIFELAIKRPDPLYDVVIEVDERVTLEDFSEDPENVKSQPSANEGVIV
FT                   GKSGEIVRVLRKPDISTLRTALEAAFAQGIRSVGIALLHSYTFPEHEELVAALASEIGF
FT                   THVSLSSQVSPMIKYLPRANSAIADAYLTPVIQKYLSGMQAGLINTDNTNIQFMQSDGG
FT                   LVEGSKFSGLKSILSGPAGGVVGYSATCYDPVTKIPLVGFDMGGTSTDVSRYGDGKLDH
FT                   VFETTTAGIVIQSPQLDINTVAAGGSSRLFWENGLFRVGPESATADPGPAAYRKGGPLT
FT                   ITDANLLLGRLVPEFFPKIFGPNEDESLDMDITKKKFEELAETINRDLGTRFSTDQVAY
FT                   GFIKVANESMARPIRSLTEAKGHVISSHQMVTFGGAGGQHAVAVAESLGIDTVIAHRYS
FT                   SILSAYGMFLADVVEETQEPCSLVLENTSTCIKVEERFEAMTGKATDSLLKQGFSEKDL
FT                   SFEKYLNLRYEGTETSLMVLKDKSSWKFSQDFAKAHKREFGFIFSDRNIIVDDIRIRAV
FT                   AKSPVRSQTSIEEELARSLISEIDVEREVAFYKDVFFDDRRMKTPVFQIDNMPVGSRIK
FT                   GPCILADGTQTNIIPCNATATILSSHIVIKITSRSQESDTKLENRVDPVLLSIFSHRFM
FT                   DIAEQMGNQLRKTSVSTNVKERLDFSCALFDPEGNLVANAPHVPVHLGSMSTCISAQAK
FT                   LWKNKLKPGDVLVTNHPEMGGTHLPDITVITPAFSETSGKIIFYVASRAHHADIGGILP
FT                   GSVPPNSKELYEEGAAIYSELLVKEGRFDEELLIKLLVDDPAQYPGCSGSRKISDNMSD
FT                   LKAQIAANNKGVQLIAKLMTDFGFDVIVKYMLAIQENASFTVKQVLKRMTEHFGATEFA
FT                   GEDYMDDGTVIKLRVTLDTKKEEYVFDFEGTSPQVYGNLNAPEAITNSAILYCLRCLVN
FT                   EEIPLNQGCLKPITVKIPKGSILSPTKGVAVVGGNVLTSQRVTDVVLKTFKVMADSQGD
FT                   CNNFTFGTGGKDSNGKVSSGFGYYETICGGHGAGGDSWRGPGWNGAHAVHTNMTNTRMT
FT                   DVEIFERRYPVILREFSIRAGSGGKGKFAGGNGVVRDILFRKAVQASILSERRVVPPHG
FT                   FDGGEDGERGLNLWIRGSSGAVINIGAKNTISAQPGDRVIIMTPGGGGWGLPE"
FT   gene            <51804..>51904
FT                   /locus_tag="KLTH0E00506r"
FT                   /old_locus_tag="Klth0E.tLeu.CAG.1"
FT   tRNA            join(51804..51840,51861..51904)
FT                   /locus_tag="KLTH0E00506r"
FT                   /old_locus_tag="Klth0E.tLeu.CAG.1"
FT                   /note="tRNA-Leu (CAG) cove"
FT   gene            complement(<54185..>55843)
FT                   /locus_tag="KLTH0E00528g"
FT                   /old_locus_tag="KLTH-ORF10276"
FT   CDS_pept        complement(54185..55843)
FT                   /locus_tag="KLTH0E00528g"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10276"
FT                   /product="KLTH0E00528p"
FT                   /note="similar to uniprot|P38124 Saccharomyces cerevisiae
FT                   YBR008C FLR1 Plasma membrane multidrug transporter member
FT                   of the major facilitator superfamily involved in efflux of
FT                   fluconazole diazaborine benomyl methotrexate and other
FT                   drugs"
FT                   /db_xref="GOA:C5DH13"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH13"
FT                   /protein_id="CAR23074.1"
FT                   /translation="MKAFCFLASKQSKEHIVKMYKKSFKNIFLLDVLERFHLVALDSNF
FT                   AQQATNTSLWDVPKPSCDLERSIYESSSHSSGPNIQEKDTFLVDWNGPKDCENPLNWSR
FT                   LKKGFVVFQVMLLTCATYMGASIYTPGQEYIQHEFGVGHVVGTLNLSLYVLGYGLGPIV
FT                   FSPLSEVASVGRQQIYIVTLFFFMLFQVGAATVKNIGGLLVIRFISGVLCSPSLATGGG
FT                   TMGDIIKPEIVSVFIGLWAIGAVAAPVVAPLLGAAMVQAKGWRYDFWLLMWISAATLIL
FT                   LVVFFPETQHQNILHRHAVRVRKETGDLRYYTRQERVDAEIKATSFMKELFVRPFLIMA
FT                   LEPAVLAFDIYIAVCYGAFYLFFEAFPLVFIGIYNFTLVEMGLAFLGFCIGCLLAYAAL
FT                   LVYLAKYIGPKFKNNTFTPEDFLPLSMAVCWALPLSLFMFGWTARVHWILPIIAEVFFV
FT                   INVFNLFQSAFAYLAFCYPRYLASVFASNGFCRSVFACAFPLFGRAMYEKLGSEEYPVA
FT                   WGSSLIGFCSIGLAVIPFFFYKFGPRMRGKSRYAN"
FT   gene            <57109..>58680
FT                   /locus_tag="KLTH0E00550g"
FT                   /old_locus_tag="KLTH-ORF10274"
FT   CDS_pept        57109..58680
FT                   /locus_tag="KLTH0E00550g"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10274"
FT                   /product="KLTH0E00550p"
FT                   /note="similar to uniprot|P43548 Saccharomyces cerevisiae
FT                   YFL055W AGP3 Low-affinity amino acid permease may act to
FT                   supply the cell with amino acids as nitrogen source in
FT                   nitrogen-poor conditions transcription is induced under
FT                   conditions of sulfur limitation"
FT                   /db_xref="GOA:C5DH14"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH14"
FT                   /protein_id="CAR23075.1"
FT                   /translation="MPKENDKTHGSASIVSAESVDSTGYVVNAKGEVLLSNGLKPGLKN
FT                   RMINLMAICGIIGPGVFVGMGSMLKSSGGAGLLAGFAIVGVLCMYMMLSVGELNSTFDF
FT                   NFCKHGTRFVSPGFGAALALAYVVLWITNLISEYTSLTSICETYTDKVPTYGWFLIFWA
FT                   FFTLFQLLDVTAYGESEYILGFLKLGFITAFYVFAIVYASGGVPNNKPDNPFGKHPLVD
FT                   GFKGIANSFVFAGVFLSGIESVSIFASESRNPAKAIPVAVRSTVIRIFYVYFGISIAYG
FT                   ITVSPTDAALSDPHKSMKAPMTIALTNAGWVNGKYLITTIILVTCISSINSAIFLASRS
FT                   LFTWSEMGMGPKIFTKTNKKGVPYVAVHFCHLFGFLSILSYSAGSSVAYNYVVNVAGVC
FT                   AFIVWTSISFIHLRFRRGWVKQSKPLSDLGFVAPLFPWINIVGITLGTILVLVQGWSSF
FT                   CPWDKKAFIDGYIMLPVFFLVWGLYDLVLLKTKIIKSSEMDFESDRKLDLDALKKETSV
FT                   VIVEGE"
FT   gene            <59682..>61417
FT                   /pseudo
FT                   /locus_tag="KLTH0E00572g"
FT                   /old_locus_tag="pseudo-Klth0E-59682-61417"
FT   gene            complement(<61565..>62230)
FT                   /locus_tag="KLTH0E00594g"
FT                   /old_locus_tag="KLTH-ORF10270"
FT   CDS_pept        complement(61565..62230)
FT                   /locus_tag="KLTH0E00594g"
FT                   /gene_family="HOG000275033" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10270"
FT                   /product="KLTH0E00594p"
FT                   /note="similar to uniprot|P53630 Saccharomyces cerevisiae
FT                   YNR057C BIO4 Dethiobiotin synthetase catalyzes the third
FT                   step in the biotin biosynthesis pathway BIO4 is in a
FT                   cluster of 3 genes (BIO3 BIO4 and BIO5) that mediate biotin
FT                   synthesis expression appears to be repressed at low iron
FT                   levels"
FT                   /db_xref="GOA:C5DH15"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH15"
FT                   /protein_id="CAR23076.1"
FT                   /translation="MSSPIIFVTGTDTDVGKTFVSALLVQKWEANYWKPVQTGLESDVG
FT                   DTATIEQLCAGQRHEPHIFEPRYALQKPLSPLAAMEYEPTVDIQLSDFHIPGQNTDCPL
FT                   VIEGAGGVYVPLTKELHITTDLIKHLIGSTNRPVKIVVVGRSGLGTLNHMLLTLEHLCA
FT                   ANLENHILGCILNGKRNPGNVKVLQRYGRRIIAEVDHCSTDEDFVTALDGIPNLATFS"
FT   gene            <62596..>64074
FT                   /locus_tag="KLTH0E00616g"
FT                   /old_locus_tag="KLTH-ORF10269"
FT   CDS_pept        62596..64074
FT                   /locus_tag="KLTH0E00616g"
FT                   /gene_family="HOG000020209" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10269"
FT                   /product="KLTH0E00616p"
FT                   /note="similar to uniprot|P50277 Saccharomyces cerevisiae
FT                   YNR058W BIO3 7 8-diamino-pelargonic acid aminotransferase
FT                   (DAPA) catalyzes the second step in the biotin biosynthesis
FT                   pathway BIO3 is in a cluster of 3 genes (BIO3 BIO4 and
FT                   BIO5) that mediate biotin synthesis"
FT                   /db_xref="GOA:C5DH16"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH16"
FT                   /protein_id="CAR23077.1"
FT                   /translation="MSDLSFTPEVEKILDFDRKHLWHPYTSMSNPLKVYPVKSAAGATI
FT                   TLDTKGPGEATLVEAMSSWWCMIHGYNNPEINGAIIEQIGRMSHVMFGGLTHKPAVGTA
FT                   EKLLRLIDHEKLNYCFLADSGSVAVEVAMKMALQYEFTKNGDKTRKSKFLTIRNGYHGD
FT                   TFGAMSVCDPVNSMHSLYSGYLPQNIFVTAPSVIDTLPTSNFLRSNPEVFEGKVDWNER
FT                   DIIEFEEIVRARHAEICAVILEPILQGAGGMRLYHPQYLIEVRKLCTKYKVPLIMDEIA
FT                   TGFCRTGEMFAFHHCRKYQKMLNIQPENHIDVYPDILCVGKALTGGYLTLSAVVTTAEI
FT                   KDVISRRDSVTGGCFMHGPTFMGNPLACSAAEKSLEILLRGECYNQVASIEAQLMKQMY
FT                   LPLLNDLTLMSTVIKHMRVIGAVGVIELRQVVDSAWFHEKFISKRVYVRPFGKLLYIMP
FT                   PYVISEAELSKVIEAINQILREWKFHLENKKLLL"
FT   gene            <64787..>66730
FT                   /locus_tag="KLTH0E00638g"
FT                   /old_locus_tag="KLTH-ORF10267"
FT   CDS_pept        64787..66730
FT                   /locus_tag="KLTH0E00638g"
FT                   /gene_family="HOG000185184" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10267"
FT                   /product="KLTH0E00638p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH17"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH17"
FT                   /protein_id="CAR23078.1"
FT                   /translation="MSFRAFLLALNLLSALVFGSPVISGKDDLVEILNAHENFNDGSIV
FT                   AAFVDELKSLSSSNKTKCEQCVTRLAIGKSLSLLKPNLVPKVFTKWCTETGYMSNKTCI
FT                   ATFSRNTVESSNTGTNFADMLSLMDPFGYDGQLYCNYKESGACPKPLTPNVSLSHMWPE
FT                   KQPKHSIAPEPSNETFNVLHVSDFHIELDYTVGAEANCSASMCCTPHSKNSVSNNNTDQ
FT                   HKWNSYYNSSYTDDSFSKGSLIDVFQNSSVWAPATTFGNYKCDAPEILINSSLDSIAQF
FT                   SKDNDINFDFAIFTGDLVDHDEISLTSYEMTVQSEEIVFRDIKKKLADVPVYSVMGNHD
FT                   TFPYGELAQENHGFANLFSWNAELMADLWEDYGWLGPSESQYARKHYTGFSVVTKKGLK
FT                   VIALNSNVWYKKNHYAYWNASEPDTFGQFQFLIDELVESESKDQRVWILAHIPFSSDVL
FT                   PLPSKLFAEVVQRFSPYTVANIFFGHTHLDQFEILYSTSGEDAKTIENVVASSWISQAV
FT                   TPWVNNNPSWRYYTVDEKTFSIMNAYNFYTKLNETFTNDGAEPVWEFEYSSREGYNITW
FT                   PETSPLNATYWHKVASAINNSVEANQLYRNYAMRFSPYVPDCAKSTGCADDYCYLTSFT
FT                   VDEYDACVGSSS"
FT   gene            <67093..>67770
FT                   /locus_tag="KLTH0E00660g"
FT                   /old_locus_tag="KLTH-ORF10264"
FT   CDS_pept        67093..67770
FT                   /locus_tag="KLTH0E00660g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10264"
FT                   /product="KLTH0E00660p"
FT                   /note="weakly similar to uniprot|P40449 Saccharomyces
FT                   cerevisiae YIL161W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH18"
FT                   /protein_id="CAR23079.1"
FT                   /translation="MENPSAASGSQLKDGKRRRDRNMRKPKNSPKSGQVNEKSSKKDSQ
FT                   QDTKNGDVKKRSSQKRSRPERKITEDSKHSGTPLVNVPKTTRLSKQCKEQIQQFQHIIG
FT                   KENFKVFKKSKNSTSYGLSVSSVMDQENFTFVVNIPFSYPSQPLKLEPPSASRTAETCT
FT                   EGGRKLANILNNFNSKSREMTSDGAPLTAQLNYLITQWSKLSDSNYKRTDKLYKEFLAD
FT                   ITP"
FT   gene            complement(<67775..>68998)
FT                   /locus_tag="KLTH0E00682g"
FT                   /old_locus_tag="KLTH-ORF10263"
FT   CDS_pept        complement(67775..68998)
FT                   /locus_tag="KLTH0E00682g"
FT                   /gene_family="HOG000012239" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10263"
FT                   /product="KLTH0E00682p"
FT                   /note="highly similar to uniprot|P27796 Saccharomyces
FT                   cerevisiae YIL160C POT1 3-ketoacyl-CoA thiolase with broad
FT                   chain length specificity cleaves 3-ketoacyl-CoA into acyl-
FT                   CoA and acetyl-CoA during beta-oxidation of fatty acids"
FT                   /db_xref="GOA:C5DH19"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH19"
FT                   /protein_id="CAR23080.1"
FT                   /translation="MSERLTQIKDHLISAVSPSVQDQRADDVVIIAAHRSPIARGFKGG
FT                   FKDVNSDYLVHQFLQEFFKKVPSSLSENKQLIEEVACGNVLNPGAGATEHRAACLAAGI
FT                   PFSTPFVALNRQCSSGLVAVNDIANKIKVGQIGIGLALGAESMSKNYGPKALGNVSAEM
FT                   KQNKDAKKCMVPMGITNENVSHKFHVSRQSQDTFAAESHRKAERAISEGLFEDEILPIN
FT                   LPDGTTISTDEGPRKGVTADNLAQLKPAFIPEKGTTTAGNASQISDGVAAVLLARRSIA
FT                   ESMELPILGKYVACQVIGVPPEIMGVGPAYAIPKVLKDCGLAIEKVDVFEINEAFAGQA
FT                   LYCINKLQIPLAKVNPRGGAIALGHPLGCTGARQVATLLRELERGQVGIVSMCVGTGMG
FT                   AAAVFVRE"
FT   gene            <70073..>74242
FT                   /locus_tag="KLTH0E00704g"
FT                   /old_locus_tag="KLTH-ORF10260"
FT   CDS_pept        70073..74242
FT                   /locus_tag="KLTH0E00704g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10260"
FT                   /product="KLTH0E00704p"
FT                   /note="some similarities with uniprot|P40450 Saccharomyces
FT                   cerevisiae YIL159W BNR1 Formin nucleates the formation of
FT                   linear actin filaments involved in cell processes such as
FT                   budding and mitotic spindle orientation which require the
FT                   formation of polarized actin cables functionally redundant
FT                   with BNI1"
FT                   /db_xref="GOA:C5DH20"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH20"
FT                   /protein_id="CAR23081.1"
FT                   /translation="MDYRRGDPWIEPHGYAYRFFSLDEGIGRPGRDIQQSEISDPVSLG
FT                   LRLVGSGLVKKTKKAYASPYVSKARNFSTNDIEGPSNRACSASLEKLSQSDSSDAFSWP
FT                   STSDSSSIFDPHTTPPEEVVDQHFRELLESRAFFWGSARSGLKNLSSKRKWQLVCKERL
FT                   MRDEKDNTVRQQPVAVFDEAVLENLMTRLRSGENAAASLYQLEKLLRRNDFSRGFLRSD
FT                   GVARLADVLASFKREDMYVCLRCFKTLANTEEGRLSVVSEDRVVSYFCTGLIIEQVHLR
FT                   VHLLSAELLLLCTYIESPGGSNTVLHHLVPLFPEWISSISQLLESSSDDITNPDFIATP
FT                   NFHQTQKDYCLTSLFLINSMMQIISSFREKLEVVKKLRELGIHQLFRTMHGLEYKELEE
FT                   EIEKYEFLEKEVVEKTNPELPHFLNISYGNFLSTIIQEAHHNPLEHCIFQIFEDLAHLL
FT                   ISRTMSDSLKALTLFRTVLNYLKEYNYGEENTKVESVISVSLNQLVDNLQSDEIAERAM
FT                   SELKTAQNSIDQLNSEIQILQKERSVSKGSILSELEKIKKELFAKESLIGKLEKELHLS
FT                   NQQRKNDRKKLEQAAVHKVPRLPARASSLSVFEHLKTQTLKHSHQKSPRQASLSKSSRF
FT                   LSLKSVIDQQLEGENSSWQTHNKLSTPLNNSVDEVDIESTSSGSPSTEDLSCHSVADQS
FT                   ISNGHPDGYKLRHLGFEGHKIETLNSLVKKTPNYFPETPILSQETCPVLSNYQPNGADC
FT                   KPSKHIGKSSSELEADINGNQSPSKFLPPLPSSLPAPPPPPPPLPSNLESASINSIATP
FT                   QAVTQPIAVNSKTPPTAPPLPENLLASKVLVLDSNEELKNLAAPPPPPPPPPLPLALST
FT                   KKVDTTSNGFVSGATQKSAPRAPPPPSNLIGSKEVHSIVEAVTENSNLKLKQIHWDKLE
FT                   DVSETIWSQEGERQDAARHLESSGFLDEIAELFRVNQSLPIKAKSETSSGKDKVSILPR
FT                   DLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLSIIPRSIASKLE
FT                   PYATDHQPNEAPLLDREKLERADRIFLELCYNLRSYWRPRSLCLLTLSTYEKDYFDLIY
FT                   KLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMNRKQAGGIRLSSLQKLTFVKSSKDKNM
FT                   SLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFHEYTQRISGVKQSLEQG
FT                   RLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALENLMKLYGEDPSNIDS
FT                   KNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQNRSKEHSSSSQGSASEGED
FT                   NTVDILIKRLREVNNEKSTQRRSANHNSEDHLFTRTQHLLDSIQKI"
FT   gene            <74503..>75447
FT                   /locus_tag="KLTH0E00726g"
FT                   /old_locus_tag="KLTH-ORF10257"
FT   CDS_pept        74503..75447
FT                   /locus_tag="KLTH0E00726g"
FT                   /gene_family="HOG000001099" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10257"
FT                   /product="KLTH0E00726p"
FT                   /note="weakly similar to uniprot|P36169 Saccharomyces
FT                   cerevisiae YKR100C SKG1 and weakly similar to
FT                   uniprot|P40451 Saccharomyces cerevisiae YIL158w AIM20"
FT                   /db_xref="GOA:C5DH21"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DH21"
FT                   /protein_id="CAR23082.1"
FT                   /translation="MTDGLGVSVGCAVGIPCGVAVLVAVIFWYYMQRKFKKEIEDDEES
FT                   MSGDGTISFTNLHSMRVPDNPEKDLPVSHVVGGSTSSDNTTTAQNVATAGQMEAQQSQP
FT                   SKKPKNTYMPAYRKRLNSSLSTLQHQDEQRSPTDSSSTSLDTKNQNGRAHSTVLDQMIP
FT                   VLAQDDNAAAASSEFSLTHERTSSNDNLIKNLHNHDFGSYPKRRSSGNLTGMISGNVSS
FT                   ASVHTRTSSVHSGKKNNENVFDTPNSQKFHEAVAPSEEDAESKGMRSYYMLKNNYDVEN
FT                   ASQIAEEDQYENEFTNYSESKREFINSLRPKKN"
FT   gene            complement(<75584..>76132)
FT                   /locus_tag="KLTH0E00748g"
FT                   /old_locus_tag="KLTH-ORF10255"
FT   CDS_pept        complement(75584..76132)
FT                   /locus_tag="KLTH0E00748g"
FT                   /gene_family="HOG000187652" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10255"
FT                   /product="KLTH0E00748p"
FT                   /note="similar to uniprot|P40452 Saccharomyces cerevisiae
FT                   YIL157C FMP35 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="InterPro:IPR014807"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH22"
FT                   /protein_id="CAR23083.1"
FT                   /translation="MLKLLTGSAGRQFRVLGARRLFLRQLATKPELVLKDKARPLRIER
FT                   ELPDPTKDKVKNRVQLGLFTVAICVALASIFNYEKTQSPIISNSLYHLRRSQSIRDLMG
FT                   DNIDFDGLVPWVYGDLNQVAGRVNISFYIKGTKDVQGMVKLVANRENKNQEFLIHEWSI
FT                   KVGDKKIDLLAEEGGAKTL"
FT   gene            <76244..>76536
FT                   /locus_tag="KLTH0E00770g"
FT                   /old_locus_tag="Klth0E.mRNA.ibl.320.p"
FT   CDS_pept        join(76244..76252,76324..76536)
FT                   /locus_tag="KLTH0E00770g"
FT                   /gene_family="HOG000214762" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.ibl.320.p"
FT                   /product="KLTH0E00770p"
FT                   /note="similar to uniprot|Q2V2P4 Saccharomyces cerevisiae
FT                   YIL156W-B hypothetical ORF"
FT                   /db_xref="InterPro:IPR013726"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH23"
FT                   /protein_id="CAR23084.1"
FT                   /translation="MTILGKAFHISFDLVLVSACLAGIKRNTGLTPKVDVIGDPHVKGY
FT                   VSKYLNVGESCYDYTVATLGSSNYFVRK"
FT   gene            complement(<76585..>78828)
FT                   /locus_tag="KLTH0E00792g"
FT                   /old_locus_tag="KLTH-ORF10253"
FT   CDS_pept        complement(76585..78828)
FT                   /locus_tag="KLTH0E00792g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10253"
FT                   /product="KLTH0E00792p"
FT                   /note="similar to uniprot|P22035 Saccharomyces cerevisiae
FT                   YKR099W BAS1 Myb-related transcription factor involved in
FT                   regulating basal and induced expression of genes of the
FT                   purine and histidine biosynthesis pathways"
FT                   /db_xref="GOA:C5DH24"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017877"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH24"
FT                   /protein_id="CAR23085.1"
FT                   /translation="MSKEPAPGKTKKIRIDPLDVTRSLGYQTHKLKARKPWSKEEDDLL
FT                   RSCVITHLLNMGFENGIESVKTIQQSNEACKNMPWDEIATKFDRKVRKPKDIRKRWVSS
FT                   LDPNLRKGKWTPEEDELLMKSFEKWGPHWLKVSTEIPGRTEDQCAKRYIEVLDPSTKDR
FT                   LRDWSLQEDLALISKVKAYGTSWRRISLEMESRPSLTCRNRWRKIITMIMRGKASEEIT
FT                   KAVQETSQAQEVQSLDQLRESLRMKLEEMRDESPRLDEGQPCIEDQLEPRGGFKSGSSV
FT                   CGTSSGTQRSPSDNNSLEKGQSLFEDFSGNQSRGFEEREFRETTQQRHQSPQEQQQSLQ
FT                   LHQQQHQQLQPQFQKQQQQQQQPQQQPQQQQQQQQQQQQHQQQQQQKQQSLNNRLNEKR
FT                   KPQSSVLDWRFALNDNFGNIVSEGMVSNSDLVRELIDQARKNSLSVSVHQHIHNHYGTV
FT                   PSSLSTQSQSLSGEILSQLSPFAFSGDRTDKLSNDRGFDTDFLGKSPNYASLPLDPQNE
FT                   PVAQNRAPSQNFPVLPMYTQRSGPTSSVGSRSTPGAELEDIPPHRQYHFNYLPATVRPQ
FT                   LGSSEAGRSPQVGKVSNRSPAAQPKRKKRRKGKDGSSEGNTPNENYGSTGTTPRESEVS
FT                   PSNERHSKQGSLLTPGGASAAGEEDGLDFWESLRSLASVPSNARNNMNEGPLDEYDYLY
FT                   NFYEEQAEVSGENEIVNKKPAPSQHQMSSNQSMMGYTPQDPDLIHKGLPYNPS"
FT   gene            <80059..>82983
FT                   /locus_tag="KLTH0E00814g"
FT                   /old_locus_tag="KLTH-ORF10250"
FT   CDS_pept        80059..82983
FT                   /locus_tag="KLTH0E00814g"
FT                   /gene_family="HOG000142088" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10250"
FT                   /product="KLTH0E00814p"
FT                   /note="similar to uniprot|P40453 Saccharomyces cerevisiae
FT                   YIL156W UBP7 Ubiquitin-specific protease that cleaves
FT                   ubiquitin-protein fusions"
FT                   /db_xref="GOA:C5DH25"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH25"
FT                   /protein_id="CAR23086.1"
FT                   /translation="MNRLYSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAE
FT                   YLFESYRHALAANQAEDLLTAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDE
FT                   ANMTNVLLMVTEVIESMSKDEVETARIMRKRAYSVPYGKSPVTIQALSKANSATVEPDA
FT                   PTETEFENGTTMWTAPELEPNDHLKVSLGSHHSSTSSASSNEQFPKIHNESHSFPFEEP
FT                   ELHALSLGGSRTRRSSVPARASRKLGTTQASNSSDFNDQKINRYATHRKDSYHSVHMSN
FT                   DDYDAFTFNLARLQKQSVVTCDQLMRILCSQDRDNLLLIDLRFSKRFQTNHILAPNLLN
FT                   VDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVF
FT                   FQLIYTSNKNLKCTPKVLLGGYEQWKKFLSKSSQAYCDKDAFLYSSTNNGRNAPVTSHS
FT                   LPEHYPVAPPSIPPPPPPIAKTEEMTKTPYNRAPFPTPLVQAQRADHFPASSQNHTRDK
FT                   NEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGLRNIGCTCYVNSMLQCLFA
FT                   TKAFRDLFLSTKYEHYFSRKYTNPNQLSKYFNVLFKKMYMNGGCSVVPTGFLKACNALR
FT                   PDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDYPGLLLHDDKKLDVDQKEYDTWF
FT                   EKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSVFYVLSLAIPSSTSTFSQRKKV
FT                   RLEDCINLFTSDEQLTNENAWDCPKCGTSASGTGPEEEKKKKRFLLNPDTRASGNRSRF
FT                   FKLRSKSRSRSVSPFRKQSSQQQNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDL
FT                   TKKNNKVITYPLILSIVLKNEQIMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGK
FT                   QKWYYFDDETVKKDINHGDIDAGITSISSSDVYVLFYEKIDESQ"
FT   gene            complement(<83201..>85126)
FT                   /locus_tag="KLTH0E00836g"
FT                   /old_locus_tag="KLTH-ORF10249"
FT   CDS_pept        complement(83201..85126)
FT                   /locus_tag="KLTH0E00836g"
FT                   /gene_family="HOG000004813" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10249"
FT                   /product="KLTH0E00836p"
FT                   /note="similar to uniprot|P32191 Saccharomyces cerevisiae
FT                   YIL155C GUT2 Mitochondrial glycerol-3-phosphate
FT                   dehydrogenase expression is repressed by both glucose and
FT                   cAMP and derepressed by non-fermentable carbon sources in a
FT                   Snf1p Rsf1p Hap2/3/4/5 complex dependent manner"
FT                   /db_xref="GOA:C5DH26"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH26"
FT                   /protein_id="CAR23087.1"
FT                   /translation="MFARTVSRRVLAGATLAAGGYAAFALQRDRSAHNEVHVSIPLKAE
FT                   APAIPSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSS
FT                   KSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYW
FT                   QVPYFYVGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSR
FT                   MNAALAVTAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNST
FT                   GPFSDRILQMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFY
FT                   CPKQIGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQH
FT                   YIKFPVKREDVLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGG
FT                   KWTTYREMAEETIDEVVKQGHFQAKPCITKKIKLAGAEGWDPNFVAMLAQEYHLSSKMA
FT                   EHLANNYGTRSPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYS
FT                   VKYEYTRTALDFLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDF
FT                   IKTFGV"
FT   gene            complement(<86253..>87227)
FT                   /locus_tag="KLTH0E00858g"
FT                   /old_locus_tag="KLTH-ORF10242"
FT   CDS_pept        complement(86253..87227)
FT                   /locus_tag="KLTH0E00858g"
FT                   /gene_family="HOG000113065" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10242"
FT                   /product="KLTH0E00858p"
FT                   /note="some similarities with uniprot|P32351 Saccharomyces
FT                   cerevisiae YIL154C IMP2' Transcriptional activator involved
FT                   in maintenance of ion homeostasis and protection against
FT                   DNA damage"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH27"
FT                   /protein_id="CAR23088.1"
FT                   /translation="MEGGEPKRSILLPSKAETAGRDNIRILESEVPSRSERGRSREKKG
FT                   SSANTAVQHRSRTSSRLRGDVGSYLKWTVLQHDPSERLLLGTKEGAEASDDDEDVSDEE
FT                   QVSDVENEIDIDAALGYDLGARVLPNFTSSLWDVVQNQKPWVAKFNKSVEGKDSGVKLE
FT                   DLQGGYARAIKIVHGKPQQGAEAREGRSYIIYLDLTPESFYALLYVFGAVLASNDTLYV
FT                   VHISQRVPNEQLRANVERLEAEAAYLLDASSAALNAVNVVLLSVSHPYPKHLLNELVIA
FT                   LKPMALCVPLSLVLSSLQNYVCPIPTVVIRRKLKRSKKKGFEE"
FT   gene            <87353..>88468
FT                   /locus_tag="KLTH0E00880g"
FT                   /old_locus_tag="KLTH-ORF10237"
FT   CDS_pept        87353..88468
FT                   /locus_tag="KLTH0E00880g"
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10237"
FT                   /product="KLTH0E00880p"
FT                   /note="similar to uniprot|P40454 Saccharomyces cerevisiae
FT                   YIL153W RRD1 Resistant to Rapamycin Deletion"
FT                   /db_xref="GOA:C5DH28"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH28"
FT                   /protein_id="CAR23089.1"
FT                   /translation="MSLERIDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKY
FT                   VSSMSGVKIPETSTNHEVRSFAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDES
FT                   LEALLHKFLPEPCHKSIVELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGA
FT                   DFQASDVLFLFDKYYALVRKLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCA
FT                   PIAPREVQDKLIVDEYTKTNFYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQR
FT                   GLLKMYFAEVLNKFPVVQHFWFGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPA
FT                   PTNLNSARRQMNPPNLRGINRLTSQDRFRRE"
FT   gene            complement(<88552..>90186)
FT                   /locus_tag="KLTH0E00902g"
FT                   /old_locus_tag="KLTH-ORF10234"
FT   CDS_pept        complement(88552..90186)
FT                   /locus_tag="KLTH0E00902g"
FT                   /gene_family="HOG000271471" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10234"
FT                   /product="KLTH0E00902p"
FT                   /note="highly similar to uniprot|P10963 Saccharomyces
FT                   cerevisiae YKR097W PCK1 Phosphoenolpyruvate carboxykinase
FT                   key enzyme in gluconeogenesis catalyzes early reaction in
FT                   carbohydrate biosynthesis glucose represses transcription
FT                   and accelerates mRNA degradation regulated by Mcm1p and
FT                   Cat8p located in the cytosol"
FT                   /db_xref="GOA:C5DH29"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH29"
FT                   /protein_id="CAR23090.1"
FT                   /translation="MSPTKTRNHVSAKDHIRQELALGEEVVTIRRNAPAALLYEDALKE
FT                   NKTTIASSGALIAFSGSKTGRSPKDKRIVDEPTSTHNIWWGPVNKKCSEKTWLVNRERA
FT                   ADYLRTRDHLYIVDAYAGWDPRYRIKIRVVCARAYHALFMTNMLIRPTKEELENFGEPD
FT                   FTVWNAGQFPANTHTDGMTSKTTVEINFQKMEMVILGTEYAGEMKKGIFTVMFYLMPVN
FT                   HNVLTLHSSANQGIRDQDVTLFFGLSGTGKTTLSADPARKLIGDDEHCWSDHGVFNIEG
FT                   GCYAKCIGLTEAKEPEIFNAIKFGSVLENVAYDPLTRVVDYEDCEITENTRCAYPIEYI
FT                   PSAKIPCLANSHPKNIVLLTCDASGVLPPVSKLTPAQVMYHFISGYTSKVAGTEEGVTE
FT                   PEATFSSCFGQPFLALHPLKYATMLAEKMSQHRANAWLINTGWTGASFVDGGNRCPLKY
FT                   TRAILDAVHDGSLAQEDFETLPTFRLHVPRHVNNVPEHILNPAKNWFEGETKYKHRVGA
FT                   LAKLFTENFKKYQDRASADVISAGPVL"
FT   gene            <90490..>90864
FT                   /locus_tag="KLTH0E00924g"
FT                   /old_locus_tag="KLTH-ORF10229"
FT   CDS_pept        90490..90864
FT                   /locus_tag="KLTH0E00924g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10229"
FT                   /product="KLTH0E00924p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH30"
FT                   /protein_id="CAR23091.1"
FT                   /translation="MELIKGRQGLRQVLCHSHGVVAPATDTRTSPRAPQSSVGSDKGFE
FT                   IGSDADFLCQCLLLFSAGGLQAQRDALVAQALKTVPFDVTSEEAVVAYASSCAFGAIGP
FT                   FGPGGRRLGLRAQPDRSAQR"
FT   gene            <91205..>91852
FT                   /locus_tag="KLTH0E00946g"
FT                   /old_locus_tag="KLTH-ORF10226"
FT   CDS_pept        91205..91852
FT                   /locus_tag="KLTH0E00946g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10226"
FT                   /product="KLTH0E00946p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH31"
FT                   /protein_id="CAR23092.1"
FT                   /translation="MTRETRAQDRASNVFRNLSTLASKERKPLQPRPVNISQLVASQKL
FT                   RSPPNTPASAKSPASLLSNAISRSRPKSHDGSLRSVAQVIGSDYHLTPTKPHYRARAKK
FT                   RYDLAFPAGKALVNRLLKCVSAFETNRRLQRHGLSTHEYDRKLHVQYTKLLSPTELLAV
FT                   AAGPLGREVLILHMLPSTKDAEPKSGSQLLLSSNASALLYPGLRWYFEWRVI"
FT   gene            complement(<92019..>95465)
FT                   /locus_tag="KLTH0E00968g"
FT                   /old_locus_tag="KLTH-ORF10223"
FT   CDS_pept        complement(92019..95465)
FT                   /locus_tag="KLTH0E00968g"
FT                   /gene_family="HOG000142087" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10223"
FT                   /product="KLTH0E00968p"
FT                   /note="similar to uniprot|P36168 Saccharomyces cerevisiae
FT                   YKR096W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH32"
FT                   /protein_id="CAR23093.1"
FT                   /translation="MEFMRDIPTGISGVNVEASPAQQKRQHSRSCDYMGSGVNKRRLGS
FT                   GISGAAAAAAALFLDSGGSPVRRKDAQSPSYMPTTSSSNLEAAAVENENSSVRLSDICI
FT                   DPRMDSSADHNCKMRGCDLASKNQHQTFSNCIQTASAVPGAPAGNAPAYSEHSVPNNAA
FT                   QTESGEARAPVNSGGLTGRNDRGNDHDNNNNNPNENTPAAGQTSSQTSQALVQKLQDIY
FT                   RNIVKQEVELQERCSQLTHSQTTDLKNLWIIYKVNTELINNYVAFITTALLPSQPEQDL
FT                   LIGQEIVNIYRIERRLWVHGTITFLDVLKNFSNFMDPEVCCQFITHVFISISNMLGDMP
FT                   QKFATPWLERLGDLSRMAIALYPSGFIDWKLSAEHWYTQALSHIFGHGKLYYHMSTVQQ
FT                   NTLEAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAFAERNGGNQRNSLMVEYLKHSE
FT                   VMLLSSFLESPELQKVVLSFFQNKFGISSNNTDYFSHQAIFLQDGERTKYFFRHAPAFA
FT                   ESHILQMVGFGNPKNPFALLFELPKFLKERKERKERRKSKSSNSFTSMEAPSPTSPIEY
FT                   LESVDSPRFVYEFPTDLAIWQQSLSHINTTSIKCSAVVLQKFLHGPLVSAAAHLLPWAY
FT                   FLLSLAIRIDELPSPELKDFWIALCRQVFPWNSIVNFLNMIIAFALDNAWKTSSIDNLC
FT                   EQFDSVDVRTLVDHFSQNEDLPEVWKCWGALWFDVISDKSDVVDEGATYNSVQDHMFGD
FT                   MPVDGICFDEDDETGSRFWKRACRLVFIFKGIAQEFNMGLTLASVPLQSRRSLAAGHPL
FT                   QNFCFKFEDPPVDSESYALISTQMPAFENISERNLDPNAPPGQSMLEGKSLFELPGYRQ
FT                   LHADHTCFNKTGTLITCSLYTSGSLEKGPIHGGDDFNTERYSRSDELNKADNPQIKELD
FT                   KMERMWLDTCMNPEFIEQTYDMKFPFGDLSCNCDSGVSYFVPDATSWLRHFAHVYKLAT
FT                   NGVLRFAICLTTFQELRFLRKSKDESVVEAATRAVITVRQLYSEKRLLPLRFTGNVATH
FT                   LEEHLEFEEQITWRSHVDEFVIEAVYKAQNKFEALNAQAKEGGHDFIPTTEEEPFHFIA
FT                   LVSDDTNMRLKAHAQRIRTFSSRFMFAVCNQIGLAHHACTN"
FT   gene            complement(<95824..>96157)
FT                   /locus_tag="KLTH0E00990g"
FT                   /old_locus_tag="Klth0E.mRNA.3762.m"
FT   CDS_pept        complement(join(95824..96055,96120..96157))
FT                   /locus_tag="KLTH0E00990g"
FT                   /gene_family="HOG000248792" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.3762.m"
FT                   /product="KLTH0E00990p"
FT                   /note="similar to uniprot|Q3E833 Saccharomyces cerevisiae
FT                   YKR095W-A PCC1 Protein"
FT                   /db_xref="InterPro:IPR015419"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH33"
FT                   /protein_id="CAR23094.1"
FT                   /translation="MKGTRQSDLAYTLYLEVPFKTAKQAETAVKVLKPDPILKPQDFHV
FT                   EYSSKAHNLCVSFEGVDDRVLRVGVSSVIESIKTIIETIDEFSH"
FT   gene            <96295..>97455
FT                   /locus_tag="KLTH0E01012g"
FT                   /old_locus_tag="KLTH-ORF10216"
FT   CDS_pept        96295..97455
FT                   /locus_tag="KLTH0E01012g"
FT                   /gene_family="HOG000142086" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10216"
FT                   /product="KLTH0E01012p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH34"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH34"
FT                   /protein_id="CAR23095.1"
FT                   /translation="MKQVVEVPLVSTAKTQFWACVETDDNKYTSFSLVSRPNEYGDASL
FT                   DPQLTRGQKDILIVDSIKSGTGRDSRNNFGKNVLEPLFTLLGIPHKVVRTQDSDAAGQL
FT                   GHTFQPSTENTILIFLSGDTTISEFLNGLNRRVFEGLRHTLSLVPLPLGTGNAWANSLG
FT                   LRCPAASLSCFLQGQLTPRKFPLYKATFPNGFEMIFFIILSIGFHANLLHLCKQQRFQS
FT                   LGVERFKIASLEILQKYPLEYRLQVSGLPTRDYSYFALINTPNLEASYKPSPQSNSLHF
FT                   QLHVLGYSSKLQQASLVSKIMKGYSNRAGDDISGDGVIYEPYNHALEVVFDQVPENVSN
FT                   TYFEICCDGHLLNMLSLQPQDQKFDGRIRIQFLKNFSSFELNVMVP"
FT   gene            complement(<97462..>99281)
FT                   /locus_tag="KLTH0E01034g"
FT                   /old_locus_tag="Klth0E.mRNA.at.343.m"
FT   CDS_pept        complement(join(97462..99128,99197..99281))
FT                   /locus_tag="KLTH0E01034g"
FT                   /gene_family="HOG000000960" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.at.343.m"
FT                   /product="KLTH0E01034p"
FT                   /note="similar to uniprot|P32354 Saccharomyces cerevisiae
FT                   YIL150C MCM10 Essential chromatin-associated protein
FT                   involved in the initiation of DNA replication"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015408"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH35"
FT                   /protein_id="CAR23096.1"
FT                   /translation="MGQETDPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRD
FT                   RLEQKASRKKAQRQSLERVEVPASPKEERKSKASPQSQKSSKGITLAANSNNDSIEVPW
FT                   KNGPSNTTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKEL
FT                   YSGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSE
FT                   VKLTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPS
FT                   QVNNDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATD
FT                   RCEYHQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVKRKLQLLPDKHAPQA
FT                   QDGESQNTLFFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKERTLQNQLNSAIG
FT                   KTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLKFGKNVNSGLNS
FT                   KSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHFDTEKLANQKQKKTPSSESS
FT                   DSDLEIV"
FT   gene            complement(<99471..>104786)
FT                   /locus_tag="KLTH0E01056g"
FT                   /old_locus_tag="KLTH-ORF10213"
FT   CDS_pept        complement(99471..104786)
FT                   /locus_tag="KLTH0E01056g"
FT                   /gene_family="HOG000113604" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10213"
FT                   /product="KLTH0E01056p"
FT                   /note="similar to uniprot|Q02455 Saccharomyces cerevisiae
FT                   YKR095W MLP1 Myosin-like protein associated with the
FT                   nuclear envelope, connects the nuclear pore complex with
FT                   the nuclear interior; involved in the Tel1p pathway that
FT                   controls telomere length; involved in the retention of
FT                   unspliced mRNAs in the nucleus"
FT                   /db_xref="GOA:C5DH36"
FT                   /db_xref="InterPro:IPR012929"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH36"
FT                   /protein_id="CAR23097.1"
FT                   /translation="MANTDELPRLESAEAAETAASFLGIESNELLAVDGGVVVNIAAKA
FT                   REFQQLQAENLRTSVTVDELRSSSERKLGACKDQVHLLLQELESLRGESAQFEKMKLEL
FT                   TSEKQRALNDSETLRVRKEALEQQKQALESSKNDVARLLNEKISELSSFKQEADDLMQE
FT                   NRRLRQQTLDLESESRVSKSEDLQRKAELHRLSQELSLCRSNSEWLESQLGQKNAEFNA
FT                   YRHTTQSQLAALTQKLETLEQELQASTRTNKSLREHNARITNDLETQLRNVKKLTDNLN
FT                   SEKQEFTREMSLKERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQK
FT                   TQQLEESEFKVQKLEQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVIHEK
FT                   RQKEHLQNQVEAFVVELESKVPMLSSFKDRNDMLEEQLAETAYMLESISKDKESVALDL
FT                   RRTKAQIHDFEIQISELTRQRSDLARQVQYLLIQASVRSDSKGPLTTEEIAFVRRILEQ
FT                   GDLSLERDTQKVISERLVEFRDIVELQSKNSDLLRTIRNLADKLESEEEQSKMRSKTVE
FT                   NDAIREAKEAIITLQEHAQELESRIEVLTKERDAYKAIQPSTNNGNKITEHALANSKGK
FT                   MSARVDDLERSLVTEREEAEKNMKMLNSEIQELLRQKTKLAIEIEKERTSKCLAEERLK
FT                   VSQGSLKLTKQENEELNKRYHIIQDNLLKQDTKTQETLSCLIECQSKLATLESELKSSV
FT                   AKIESLSSCQKKNTESIEQLTAERNNLTILVTQLQTLQGERDKLLAETEKSYKEKVDAL
FT                   EVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTSQLESQAQTTRD
FT                   LESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKLQDAYSQIEEH
FT                   RSRYKSAEEALSAITNAFERFKNEHSKDFGNMKKKEDELVGQVEALKHQISNLNNELGH
FT                   QKKQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQLGKLTQDLNQQAAFANKAQENYE
FT                   QELQRHADVSKTISQLREESQKYKNQASVLQSSIEQLEKTLDESDGKWLNQKEEYEAQL
FT                   RSLNQRIEDLTVQNGLLLDQLDLEAKDPNSELGQSEPQEKVRELITSLRRERDILQTKL
FT                   EVSKRSETVSLRKLEAIEQELSFAKEELSSLQALSSQNSIMADEHNKLLEQLNQLNLLR
FT                   ESNITLRSEVQKKTQRCQELEGQIDNLQQSLQPLESELASLKRSVRAKDSQISLISEET
FT                   NRWKQRSQDILSKFERIDPEEHKKLGEELSQAKAELAAKADQNSELEDRFQRLKKQARE
FT                   RLDAAKAVQNNLSVELAQAREAQSNMELQLRKEQDVNKALQESLQRVESEAKADSTTQP
FT                   ELESALQKLSQAEKKAQDIESDRAQIEKALQSELEKVKSHAEELERRLDEARREVESLE
FT                   EVKQGAFTDSSELEKMKRDLEEHSNTLIAEKEAEIRSHYEELRLKEKATYEKELEENGK
FT                   HTPVDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKINKIVETRKSELEQEF
FT                   EAKLQKRASELANEKPQPASFTEVMKRHKQEMEKLKADLTREMDEEMAQVRKKAFDEGK
FT                   QQASMKSMFLEKKIAKLEAQVKASGTEAVPSAPTSKNSPTEKPVRILEASPLEDALSRN
FT                   DPNKESLPIKKISLPSLTPEPQQSQPEEAPNGQQQATKTQLTEGNATQDGLTPTKRAIE
FT                   VGNESPSKRTKPDQD"
FT   gene            <105372..>106121
FT                   /locus_tag="KLTH0E01078g"
FT                   /old_locus_tag="KLTH.mRNA.155AT.p"
FT   CDS_pept        join(105372..105379,105743..106121)
FT                   /locus_tag="KLTH0E01078g"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.155AT.p"
FT                   /product="KLTH0E01078p"
FT                   /note="highly similar to uniprot|P61864 Saccharomyces
FT                   cerevisiae YKR094c RPL40B and highly similar to
FT                   uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A"
FT                   /db_xref="GOA:C5DH37"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH37"
FT                   /protein_id="CAR23098.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKFNCEKSVCRKCYARLP
FT                   PKATNCRKRKCGHTNQLRPKKKLK"
FT   gene            complement(<106377..>109910)
FT                   /locus_tag="KLTH0E01100g"
FT                   /old_locus_tag="KLTH-ORF10207"
FT   CDS_pept        complement(106377..109910)
FT                   /locus_tag="KLTH0E01100g"
FT                   /gene_family="HOG000248613" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10207"
FT                   /product="KLTH0E01100p"
FT                   /note="similar to uniprot|P39928 Saccharomyces cerevisiae
FT                   YIL147C SLN1 Histidine kinase osmosensor that regulates a
FT                   MAP kinase cascade; transmembrane protein with an
FT                   intracellular kinase domain that signals to Ypd1p and
FT                   Ssk1p, thereby forming a phosphorelay system similar to
FT                   bacterial two-component regulators"
FT                   /db_xref="GOA:C5DH38"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH38"
FT                   /protein_id="CAR23099.1"
FT                   /translation="MARLKKFDLGAYAKRKLKPPFLISIRTQLTALVCLVALLSLIILA
FT                   VITGVYFTSSFKSMRAERLYVASQLKASQIDQNLYYLYYQCYYLSTRDVLQNALTQYLA
FT                   GNTTTENWADAVTTLDKFLGSSNLFSLARVYDSSFQDVLNASNNASGNLVPESVLTQLF
FT                   PLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSLPIFANPSIILSTSKVYGYITVVISA
FT                   EGLKTVFNDTTALEDSSVILVSTVYDNRELAGYHLVFPPYGMPSDIIDKRYTIGNDSFL
FT                   MDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLVQWVAIITQPESKFLYPSTRLARII
FT                   VGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEIITAGRGLRSDNGSTLYSHKRSSTA
FT                   ESFSSALHPASIRRSGSVARSSKHKYIPESAKGTLNKNDFEEIQPDGIENNEDAALQKV
FT                   HSPTPGSLFSEQRSARSERYITSTNLIEARVPTYNRLFSDELSELTETFNTMTDELDRH
FT                   YALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANISHELRTPLNGILGMTAIAMAEND
FT                   MQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTKLEERDFTVHEIALQVESIFGKL
FT                   AKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMNLVSNALKFTPVDGRVNVKFTLLGE
FT                   YDESKASNGCFDRAAVVPIQESEKESSTLGPTEKGGIKDVTESASSSNATWPPSPSTSE
FT                   TSNGSKAETTSGKLTESSEEDEKEEKLDHDDKDEGDEESEEEEYRGEAEVSGKDDTNNE
FT                   TQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENEDGRPLEHPRRLAIAME
FT                   VQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVG
FT                   VGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKVSKNNKRKKSHSSSSG
FT                   QNSSVGTPTVSESEVSVGSVRVDRPFLQSTGTALSTRSVTTTSVANKCKVLVAEDNNVN
FT                   QEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPRVDGLSATRM
FT                   IRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEYCPTYFKAD
FT                   GEKKGKTEGQA"
FT   gene            complement(<110889..>112307)
FT                   /locus_tag="KLTH0E01122g"
FT                   /old_locus_tag="KLTH-ORF10203"
FT   CDS_pept        complement(110889..112307)
FT                   /locus_tag="KLTH0E01122g"
FT                   /gene_family="HOG000000961" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10203"
FT                   /product="KLTH0E01122p"
FT                   /note="weakly similar to uniprot|P40458 Saccharomyces
FT                   cerevisiae YIL146C ECM37 Non-essential protein of unknown
FT                   function"
FT                   /db_xref="GOA:C5DH39"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DH39"
FT                   /protein_id="CAR23100.1"
FT                   /translation="MSQYITNPRQQSRQLRRNSPSGQEPHFATSSVPLNQRNSILDPHL
FT                   SVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTDCSMVNTQ
FT                   GDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASSLREYQN
FT                   SEIANPREENDNETVTMSLMNSSNSFVMPKLSLIQQSQKFCILIVGKPAQRFYRDIPRA
FT                   YHKMFEVRDVGHLSPREMNKYSAVMVIFGEPKEGKELLEKVAAHNSNIIAVCQRGQQQQ
FT                   ISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNTLSTEVDSGYETEVGSRKIRKR
FT                   RKSSKKRSPQITVNRWVIWSISLTVGVGLGYCISCLLSSTSSTLSVTLRSGDEVTIMED
FT                   IHNSPHESPFDNYLRHLLLAVKRAVKQVNSSFKQYLSGQSLPVLWMQRIGKEWLSEASD
FT                   PTLPGVTALDLVLV"
FT   gene            complement(<113309..>115027)
FT                   /locus_tag="KLTH0E01144g"
FT                   /old_locus_tag="KLTH-ORF10201"
FT   CDS_pept        complement(113309..115027)
FT                   /locus_tag="KLTH0E01144g"
FT                   /gene_family="HOG000171300" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10201"
FT                   /product="KLTH0E01144p"
FT                   /note="similar to uniprot|P32837 Saccharomyces cerevisiae
FT                   YDL210W Permease that serves as a gamma- aminobutyrate
FT                   (GABA) transport protein involved in the utilization of
FT                   GABA as a nitrogen source; catalyzes the transport of
FT                   putrescine and delta-aminolevulinic acid (ALA); localized
FT                   to the vacuolar membrane"
FT                   /db_xref="GOA:C5DH40"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH40"
FT                   /protein_id="CAR23101.1"
FT                   /translation="MSASSSNKGTIKNRKSHVDVEVGQMRELGTITSAHGAPIRFVDAR
FT                   SATSDQQVLAELGYKEELKREFSSIQIFGVAFSIMGLLPSIASTLDGGLSAGPVGLGWG
FT                   WFIAGGLILTIGIALGELSSAMPTAGAVYVSCYQWAPQRVRKCISYSVGFLDTLSLSAS
FT                   VCSIVYGLAQQILSAVLVSNPDFNATDPITYGVFAACIVCMAILTSLPSRITSKLQTIS
FT                   IISNCFLIVLFFIAIPIGVSRSDTLNRSFNGGDFIFGQVDNRSTWNKGWNWCIAGLMPA
FT                   IWTIGAYDSCLHMAEEARDAVRAVPFGIVGSITVCWILGWLVCIVILACMNPDIDSVLD
FT                   SQFGQAMTQIIYDALGKRWTLGFLSIFIICQFLMGASTVVANSRQFWAFARDDGFPFSN
FT                   FFKKVDGLTGVPVRAVWGSSALSLALGCLCLVGETASGALFSLSVAGMYMALIFPITLR
FT                   LTYGKKDFRPGPFYLGDFWSPIINWISVFFQAFVIIMMMFPSDSTVTPTTMNYTVVIGP
FT                   GFWVLSLIYYFVWQRKFYKGPKSNLTDEEFQEYVGDDVIDAIMSNNEADYKPGDA"
FT   gene            complement(<115445..>116380)
FT                   /locus_tag="KLTH0E01166g"
FT                   /old_locus_tag="KLTH-ORF10197"
FT   CDS_pept        complement(115445..116380)
FT                   /locus_tag="KLTH0E01166g"
FT                   /gene_family="HOG000175516" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10197"
FT                   /product="KLTH0E01166p"
FT                   /note="similar to uniprot|P40459 Saccharomyces cerevisiae
FT                   YIL145C PAN6 Pantothenate synthase, also known as pantoate-
FT                   beta-alanine ligase, required for pantothenic acid
FT                   biosynthesis, deletion causes pantothenic acid auxotrophy,
FT                   homologous to E. coli panC"
FT                   /db_xref="GOA:C5DH41"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH41"
FT                   /protein_id="CAR23102.1"
FT                   /translation="MKVLHTVREVVEWRTKNIDPRTHKSGFVPTMGCLHEGHLTLMRAA
FT                   KRENDFAIASIFVNPSQFAPTEDLDKYPRTLDDDIKLLEAEGVDVCFAPNAREMYPQGI
FT                   PLQVEEQRGPFVTVLGVSEQLEGRTRPNFFRGVATVVTKLLNIVAPTRAYFGQKDFQQF
FT                   TVLQVMARELFMNTELRMMPIVRDDAGLALSSRNRYLCGETLGRARSIYKGLSAAAALL
FT                   EQADASGAERTALLERVHAHWAPYENSGEFKVDYVSIADAATLQELEPRVSRDRDVVIS
FT                   CAVYVTDAEHPATVVRLIDNILVHAVRSSN"
FT   gene            <116753..>118783
FT                   /locus_tag="KLTH0E01188g"
FT                   /old_locus_tag="KLTH-ORF10193"
FT   CDS_pept        116753..118783
FT                   /locus_tag="KLTH0E01188g"
FT                   /gene_family="HOG000113749" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10193"
FT                   /product="KLTH0E01188p"
FT                   /note="similar to uniprot|P40460 Saccharomyces cerevisiae
FT                   YIL144W TID3 Component of the evolutionarily conserved
FT                   kinetochore-associated Ndc80 complex (Ndc80p- Nuf2p-Spc24p-
FT                   Spc25p) conserved coiled-coil protein involved in
FT                   chromosome segregation spindle checkpoint activity
FT                   kinetochore assembly and clustering"
FT                   /db_xref="InterPro:IPR005550"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH42"
FT                   /protein_id="CAR23103.1"
FT                   /translation="MEESRKRLSNESHAVLGHLDPQRFTSQIPMAVNGRRRNSTASAIG
FT                   GAGLSELINRSMAKNKPEVPKRSYTDSRRSLIADRKSLRSSQRTSLLPNHGLNSANTTN
FT                   TNNKDPRPLRDKNFQVAIQQEIYDYLHSQKFDVQTNHPISLKSLRQPTQKDFVFIFRWL
FT                   YQRMDPGYKFSKSIEHEVYTILRAIQYPYLETINKSQISAVGGSSWPKFLGMLHWLVNI
FT                   NKRLDSYLQKVDLTLISQNTQDITVLQQPIGTIDEQEDKQEKYELIVERLFIDYIVQSY
FT                   KSFLRLDDDYDQYMKELELGFEKFAQVIRSDIANIGMQNSDLSVKYQELVGKGQDVKVA
FT                   KDKFNALRSDLTKFQNYVNAMQHKSQEWPKKLEKMETERENKMSQLKATENQITEFRDL
FT                   IKGKNIEIAEVDRLNAERERLTRSLDSVSTDMDQAVSLLKAQKMEAESAYKTLLDVGKQ
FT                   YESAVESLVVARLNLGHQLNTDNRKISLPDTFYSRGYEPGQSGLDNDIPPEMDVRGTIK
FT                   PKLLELNEEVRSRVQKLQQENASFEAHLENLKQEISEKTRYLESLENELSIAKSQYDEQ
FT                   QQESQSHLLSQRIEIEKMERKLQNVRYSSHQKIAEAEQKVQSTKLKYEELKLAVNRERN
FT                   ILHGKVIQLIDYVSDFKINVQSAVEDLDYLAIEELNKIKFE"
FT   gene            complement(<118884..>121403)
FT                   /locus_tag="KLTH0E01210g"
FT                   /old_locus_tag="KLTH-ORF10191"
FT   CDS_pept        complement(118884..121403)
FT                   /locus_tag="KLTH0E01210g"
FT                   /gene_family="HOG000160172" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10191"
FT                   /product="KLTH0E01210p"
FT                   /note="similar to uniprot|Q00578 Saccharomyces cerevisiae
FT                   YIL143C SSL2"
FT                   /db_xref="GOA:C5DH43"
FT                   /db_xref="InterPro:IPR001161"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH43"
FT                   /protein_id="CAR23104.1"
FT                   /translation="MAEHQYQTRSKGGLYSNTDLNYFSDDSVATDNSDYDDGFIDGDDD
FT                   MGMTNASSRPKPKKQVRKTNQKNKKNNSSTNETLNKLAAKDQTFLHDVQTDAPPDFVPD
FT                   VVSGLFRRNDFSYLKLKPDHASRPLWISPGDGRVILESFSPLAEQAQDFLVTIAEPVSR
FT                   PSHIHEYKITAYSLYAAVSVGLETDDIIAVLDRLSKVPVAPSIINFIKSATVSYGKVKL
FT                   VIKHNRYFVETSQADILQMLLKDPVIGSLRIDSDATPAPNKAGSQQASRPNESAPSEKV
FT                   DPNDVEAVFSSVVGEIRLDDDNDDIDAVHAFEIANESVEIVKKRCQEIDYPVLEEYDFR
FT                   NDHRNPDLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTI
FT                   KKSVIVLCTSSVSVMQWRQQFLQWCTLQPENVAVFTSDNKEMFQTESGLVVSTYSMVAN
FT                   TRNRSHDSQKVMDFLTGREWGFIILDEVHVVPAAMFRRVVTTIAAHAKLGLTATLVRED
FT                   DKISDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFYQEYLRENARKRMLL
FT                   YIMNPTKFQACQFLIQYHEKRGDKIIVFSDNVYALQEYALKLGKPFIYGSTPQQERMNI
FT                   LQNFQFNDQINTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRND
FT                   EGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLHGMESLPNLTYSTARERR
FT                   ELLQEVLLKNEEAAGIEVGDDAENSVGRGAHANKKAKSKAVRGEGSLSGLAGGEDMAYV
FT                   EYSSNRNKDLKEHHPMIRKLYYRNAKK"
FT   gene            <121683..>122966
FT                   /locus_tag="KLTH0E01232g"
FT                   /old_locus_tag="KLTH-ORF10189"
FT   CDS_pept        121683..122966
FT                   /locus_tag="KLTH0E01232g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10189"
FT                   /product="KLTH0E01232p"
FT                   /note="some similarities with uniprot|P32583 Saccharomyces
FT                   cerevisiae YKR092c SRP40 suppressor of mutant AC40 of RNA
FT                   polymerase I and III singleton"
FT                   /db_xref="InterPro:IPR007718"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH44"
FT                   /protein_id="CAR23105.1"
FT                   /translation="MASKKSGKVAKSEAPKLSEKMKKEELSTSGSSSSSSSSSSSDSSS
FT                   SRSSSSDESSSSSSSSSSSSSSSSSSSSSSSSSSDSELSTSSGESSNEEKSKPGNKRKK
FT                   SPKTAKAAKKQKLSKKSSSSESSSSSSSSGSSSSSSDSESSSSSSASSDESSSSSSSDS
FT                   ESSSSGSSSSSSGSSSSSSGSSSSSSDSDSSSSDSDSSSSGSDSSSSSSDSSSSDSDSS
FT                   SSDSDSSSSGSDSSSSGSDSSSSGSSSSSSDSDSSSSSSGSSSSDSDSSESDASSSSSS
FT                   DDEAEKSQLKSHSSPAGSSSSTKKNSKHDGETQETSQGSSSSSKTASPDAPSPAAPKDG
FT                   IPAAVDELKPGQRKHFSRIDKNAIKFEDRVLTDNTYKGAAGTWGEKANEKLGRVRGKDF
FT                   TKNKNKMKRGSYRGGSITLSSGSYKFTD"
FT   gene            complement(<123483..>124442)
FT                   /locus_tag="KLTH0E01254g"
FT                   /old_locus_tag="KLTH-ORF10186"
FT   CDS_pept        complement(123483..124442)
FT                   /locus_tag="KLTH0E01254g"
FT                   /gene_family="HOG000141842" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10186"
FT                   /product="KLTH0E01254p"
FT                   /note="some similarities with uniprot|Q12416 Saccharomyces
FT                   cerevisiae YOR083W WHI5 Protein that regulates the critical
FT                   cell size required for passage through Start and commitment
FT                   to cell division; may act upstream of SCB binding factor
FT                   (SBF) and MCB binding factor (MBF); periodically expressed
FT                   in G1"
FT                   /db_xref="InterPro:IPR013734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH45"
FT                   /protein_id="CAR23106.1"
FT                   /translation="MENTPRREKTKDRHSLEGKREEFDAPSPKSPLTPSPPNNKGRRSS
FT                   VLHGFLPSPLPVAGSKRHSGIDFANPESPSVKTRLLPPTTPKTRNSELFLSPSPKLKSP
FT                   GVYKENEKPIREISNSLKTRLNYAFVKLQNGWVDKTLPELENNDGPAEPSSTSSSKHRV
FT                   SYSNRFLDDDESDSNSARAAFLNALTSPKKKQRQNSMTSPARSGSPGKIRPPPISTKPK
FT                   EPPSEVEAIETLMSLSSPKSQSRKKSAEFTLPPPPPLSQRQASQTEQPATSHSSRSSSS
FT                   DSSAPNTLAKPFLLKSEAGESSQIVLDVETDVEETNDD"
FT   gene            complement(<124975..>127488)
FT                   /locus_tag="KLTH0E01276g"
FT                   /old_locus_tag="KLTH-ORF10181"
FT   CDS_pept        complement(124975..127488)
FT                   /locus_tag="KLTH0E01276g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10181"
FT                   /product="KLTH0E01276p"
FT                   /note="weakly similar to uniprot|P36166 Saccharomyces
FT                   cerevisiae YKR090W PXL1 LIM domain-containing protein that
FT                   localizes to sites of polarized growth"
FT                   /db_xref="GOA:C5DH46"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH46"
FT                   /protein_id="CAR23107.1"
FT                   /translation="MQGWIYSSPFPALNPKVRYKTALERAGFDVNFHDKNKPREAHGSV
FT                   LPAGRHVSEGGRDVFGTRSAPNLAQTAQRAVSERDPRGYQNASALRSPPHSPFVKERSA
FT                   PALQEHYKVRRSDESKGAFSPRVGQPQEGRNFASAGSHKASPQPAAFPQLRKDSQSRGA
FT                   LDSRFQRHGSRTSPDRASLKSARTRGSSISQGRSAGEGSFQVSSAPQDRFSASETARRG
FT                   PVARQSPASAAGAAGKESPVSQARLSTEDLGNRQSSVFDFENQRNSPAERNFRSPDIDP
FT                   VERSFKQLTQNDNDSFSSQQEREFTPYARDSFTSVNQSDEVFEDAADIDDFNEKGDNAS
FT                   KWNSIMRLSKAPEDSVQEAAPLDRDSTNEYVDATPRTRPTSTSSISFTPVAELHVNLSP
FT                   NRPTEQTESINSATDAPISQAEPIGLERESSASVSGVYDIDLASGHTDLSQGVPQFSIQ
FT                   PTYHFSEENVGREQELREEQEVDTEEGTAQDPTATVKSSLQVERLLAQLDNVSLNRNLS
FT                   VGNRRHSPGSSRFKKSSAYLSGFVSNPAATGIDAKLQTGIASGDDQQFTPQVLSVAEDR
FT                   AHALSGEISPGSDDSPQFYHIRRQDEPRQADHRESDMTDFMRPSQQLTESLKVPVIQPL
FT                   QLYQLENTAEARAETAKPETKQEPHRLSSSSSLVEGSQPAEPPVPVFKYPPGEGPCRAC
FT                   GLEVTSRRIYSKKANELSGQWHRPCFKCIKCELTFSKKVVCYILDDEPYCQRHFHETNN
FT                   SICRICQGFIEGKCLENDRDERFHVDCLKCFRCGEFICEDYFLFNNELPLCANHDIEAL
FT                   KLESFGNMGQNNTVSKRRTRIINFT"
FT   gene            complement(<128187..>129554)
FT                   /locus_tag="KLTH0E01298g"
FT                   /old_locus_tag="KLTH-ORF10176"
FT   CDS_pept        complement(128187..129554)
FT                   /locus_tag="KLTH0E01298g"
FT                   /gene_family="HOG000257874" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10176"
FT                   /product="KLTH0E01298p"
FT                   /note="highly similar to uniprot|P47154 Saccharomyces
FT                   cerevisiae YJR117W STE24 Highly conserved zinc
FT                   metalloprotease that functions in two steps of a-factor
FT                   maturation C-terminal CAAX proteolysis and the first step
FT                   of N-terminal proteolytic processing contains multiple
FT                   transmembrane spans"
FT                   /db_xref="GOA:C5DH47"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH47"
FT                   /protein_id="CAR23108.1"
FT                   /translation="MSLVESIQRTFDRPNMPWKSIVTAFTLGQFCFETYVTFRQYRTLS
FT                   KKQLPKVLEGEIEEETMQKAEKYSRAKAKFSIFSDVLGLLQNLCILKFDLLPRFWHMGQ
FT                   ALAQKLPLKVAAGSTIGQSLLFLTVLTNISSLLDLPLSYYQHFVLEEKFGFNKLTLKLW
FT                   ITDKIKGTILSAAIGLPLLYAFLKIFDAFPTNFLWYICSFILAVQVLAMVLVPVYIMPL
FT                   FNKFTPLEDGELKSSIEALAKRVGFPLDQIFVVDGSKRSSHSNAYFTGLPFTSKRIVLY
FT                   DTLVKDASVDEITAVLAHEIGHWQKNHILRMLAFSEVHIFFIFSLFSAAYQNKSLYSAF
FT                   GFYVGNIASTKPSIVVTPQLPILIGFMLFNDLLQPLDCVLNFGINLFSRLHEYQADAYA
FT                   KKLGYTKDLCHALINLQVKNLSTMNVDPLYSSYHYSHPTLPERLEALDYATEKKEK"
FT   gene            complement(<129926..>130735)
FT                   /locus_tag="KLTH0E01320g"
FT                   /old_locus_tag="KLTH-ORF10171"
FT   CDS_pept        complement(129926..130735)
FT                   /locus_tag="KLTH0E01320g"
FT                   /gene_family="HOG000247924" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10171"
FT                   /product="KLTH0E01320p"
FT                   /note="similar to uniprot|P47153 Saccharomyces cerevisiae
FT                   YJR116W Hypothetical ORF"
FT                   /db_xref="GOA:C5DH48"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH48"
FT                   /protein_id="CAR23109.1"
FT                   /translation="MEDPFLKFSPFAGSDNLLVRHSLEIIGSFLVYQVVLSRWLVPRVN
FT                   ALVFGRHYTELKDKDARLNFDIHTVSMFQCVVSLGLTWPILFQPLSLSIVSYQDSYTSM
FT                   ISAITCGYFLWDLYVCLKHFSLFGIGFLGHAMASLYVFVLALRPFCQSWVGKFLIFEAS
FT                   TPFVNINWFISQLSRTSSRPVVPMWFNALNGLLLIGTFFVVRVLWGFTAIAILCAKLWE
FT                   ARKVLPTWIPTTVITLNLSLDALNLFWLSKMIKIAKKMASGSKQKGH"
FT   gene            <131090..>132115
FT                   /locus_tag="KLTH0E01342g"
FT                   /old_locus_tag="KLTH-ORF10169"
FT   CDS_pept        131090..132115
FT                   /locus_tag="KLTH0E01342g"
FT                   /gene_family="HOG000172419" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10169"
FT                   /product="KLTH0E01342p"
FT                   /note="similar to uniprot|P47143 Saccharomyces cerevisiae
FT                   YJR105W ADO1 adenosine kinase"
FT                   /db_xref="GOA:C5DH49"
FT                   /db_xref="InterPro:IPR001805"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH49"
FT                   /protein_id="CAR23110.1"
FT                   /translation="MSASPKLVCLGNPLLDIQATVDEAYLAKYSLKENDAILVDASSNE
FT                   PKMAIFDELLQFPDVKFIAGGAAQNTARGAAYVLGAGKVGYFGSVGQDKFSSKLLAENE
FT                   AAGVVSYYQEQSKVGTGKCAALITGHNRSLVTDLGAANHFTPDHLDKHWDVVEKAELFY
FT                   IGGFHLTVSPGAIVKLGKHAQATGKPFVLNLSAPFIPQFFKSALEQVLPYTTYVIGNES
FT                   EAAAYAEAFGLDCKQDDLASIAKHVLGGSTTRTVIFTHGLEPTVIVSANDVATRPVKAL
FT                   PKDSIVDTNGAGDAFAAGFMAGLTQGKNLDQSVDIGQWLAALSIQEVGASYPAEKLQYQ
FT                   G"
FT   gene            <132301..>134319
FT                   /locus_tag="KLTH0E01364g"
FT                   /old_locus_tag="KLTH-ORF10167"
FT   CDS_pept        132301..134319
FT                   /locus_tag="KLTH0E01364g"
FT                   /gene_family="HOG000112318" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10167"
FT                   /product="KLTH0E01364p"
FT                   /note="weakly similar to uniprot|P47144 Saccharomyces
FT                   cerevisiae YJR106W ECM27 Non-essential protein of unknown
FT                   function"
FT                   /db_xref="GOA:C5DH50"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH50"
FT                   /protein_id="CAR23111.1"
FT                   /translation="MHEKAENWLFRLVHPSLLYLDSKLNVQFVISSLLYLSLCFVLLGI
FT                   CASDYLCPAVSNISNGRKGSAQKGLLAAILLSWCNSSPDLFTNFMSWTSSNAAALSVGE
FT                   VLGSCGFIMCVVQGAVFIVMSKARVGLEPEQRQHVTRDLGFILVAMLMMLYVCLQNEVT
FT                   LLNCVFMMGVYAAYIASKAGVRYSKPTSDDANHTDWNSPEEAFPEMTAGAFSSGADSGH
FT                   KFNILSAMDYSALYEMMERSTSSPDDAITLQTLRSDIPGTTFVSPRPITEPSASRLPFL
FT                   DNVASPVQSSPSTFQPFHDSDDISEAGQALLAEPIKYSKIAIKRLQRLRKGAFFLLAPQ
FT                   LLGFGCKSLSAKALALATTPFTVLLRFSCPQYYEILQFDRTPSNLIELERAQLMLLLVQ
FT                   ALLAPSSSLVLLWVLAGILLRWYYLLAAGITAIALLVSVAFLQLAAKKYNRFSLNEDHS
FT                   SDDRKLKRLLNAEKAIIILFNSFGILNSILWISTLANALVEVMEVYQRFTSVSEAVLGL
FT                   TIFSWGNSISDLMSNVAMCQLYRKNEVEDTEETSRHASRSFFISLSACFGGILLNSLIG
FT                   IGLSGFVAMLINTEGTNEKNSWILRSVSLDSSGVDFKFMVSVSFIIIQNLFLLSSFCGV
FT                   RTFDSLLEDKRKLVGILMCSWWGAATLVNVLIESFVD"
FT   gene            <134534..>135754
FT                   /locus_tag="KLTH0E01386g"
FT                   /old_locus_tag="KLTH-ORF10165"
FT   CDS_pept        134534..135754
FT                   /locus_tag="KLTH0E01386g"
FT                   /gene_family="HOG000141907" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10165"
FT                   /product="KLTH0E01386p"
FT                   /note="similar to uniprot|P47145 Saccharomyces cerevisiae
FT                   YJR107W Hypothetical ORF"
FT                   /db_xref="GOA:C5DH51"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH51"
FT                   /protein_id="CAR23112.1"
FT                   /translation="MNIYPKAIVIVIFLFLQAYTLVNASNVSYGVALHNTIFIESSHIV
FT                   ASENNSNVPNQWKMNDTVLIRPHEAGHFEDVTITKELYERLVYFSKMCALTYCITSNEL
FT                   NTGLSFKGGGCPSKLEFCSNKDHNPTLERTIVELVILAESGELGTGYLAVDHEKRVVVL
FT                   SFRGSTTNQDWLSDFAVYPVPYMPCSKDFYDEWIESGRIRECEGCFVHRGFNVFLNTLS
FT                   SQFFDRIEGIFKAFPHYSLVVTGHSLGAAVASLAGIELKLRGYEPLLLTYASPNIFNGA
FT                   LRAWVDDLFETKRIHDLSVEEGEVMFQKGYFRVVHDQDYITMVPPFYEPAGLEIFINNP
FT                   CLPHKHEDLEYRGPSLDLTSLQIAGENSAVSQGRGQGHWYLGPLERLLHMYEHRSYFIL
FT                   INTCEGF"
FT   gene            complement(<136108..>137460)
FT                   /locus_tag="KLTH0E01408g"
FT                   /old_locus_tag="KLTH-ORF10163"
FT   CDS_pept        complement(136108..137460)
FT                   /locus_tag="KLTH0E01408g"
FT                   /gene_family="HOG000038730" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10163"
FT                   /product="KLTH0E01408p"
FT                   /note="similar to uniprot|P10823 Saccharomyces cerevisiae
FT                   YER020W GPA2"
FT                   /db_xref="GOA:C5DH52"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR002975"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH52"
FT                   /protein_id="CAR23113.1"
FT                   /translation="MGACMSKSTDGPPAKGGGTAAAKRSRSQKIAKGARAAEEKEAAAG
FT                   AGSGDRSQTGHTTDSSSGAEEKAATSAKGAAPDRPRLGGAVPDNSKRQQSVVSSNSGGS
FT                   TGPSMGSLSKSGGGSTDSNRALKVLLLGSGESGKSTVLQQLKILHQNGFSNEELLEFKP
FT                   FIFDNIIETGKDIINARLKFHATLEPESGLSEEDLQGVLNFNTPGAQLQQFPADLQKTL
FT                   SNLWSLPSTQELITGEHRSSFYLMDSARYFMDNLPRVAAENYKPTVRDVLLSRKKTSGI
FT                   FDTLVEMDSNLKLHIYDVGGQRSERKKWIHCFDNVTLIIFCVSLSEFDQTLLEDKSQNR
FT                   LEESLILFDSVVNSRWFARASIVLFLNKIDVFAEKIQHVPLERFFPDYTGGQDINKAAK
FT                   YILWRFVQLNRAHLNIYPHVTQATDTSNIKLVFAAIKETILENSLKDSGVL"
FT   gene            complement(<138025..>138309)
FT                   /locus_tag="KLTH0E01430g"
FT                   /old_locus_tag="KLTH-ORF10156"
FT   CDS_pept        complement(138025..138309)
FT                   /locus_tag="KLTH0E01430g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10156"
FT                   /product="KLTH0E01430p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH53"
FT                   /protein_id="CAR23114.1"
FT                   /translation="MKENSTMHNIDPYEWQLDQALLANASQAAPAGAGAWSDRAMLERS
FT                   TSAEPLPKLAPLAAPASDGSKRALEYDGRQEAPSVTPGKRTRRGSQGDT"
FT   gene            complement(<138573..>141938)
FT                   /locus_tag="KLTH0E01452g"
FT                   /old_locus_tag="KLTH-ORF10152"
FT   CDS_pept        complement(138573..141938)
FT                   /locus_tag="KLTH0E01452g"
FT                   /gene_family="HOG000234583" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10152"
FT                   /product="KLTH0E01452p"
FT                   /note="highly similar to uniprot|P03965 Saccharomyces
FT                   cerevisiae YJR109C CPA2 Large subunit of carbamoyl
FT                   phosphate synthetase, which catalyzes a step in the
FT                   synthesis of citrulline, an arginine precursor"
FT                   /db_xref="GOA:C5DH54"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH54"
FT                   /protein_id="CAR23115.1"
FT                   /translation="MSSVPSIYESTQPTTSAFNTPDYNPQLVKGVESVLVIGSGGLSIG
FT                   QAGEFDYSGSQAIKALKEANKRTILINPNIATNQTSHSLADEVYYLPVTPEYITYIIER
FT                   ERPDAILLTFGGQTGLNCGVALDKLGVLQKYGIKVLGTPIKTLITSEDRDLFAQALKEI
FT                   NIPTAESFACETVDEALSAAARVQYPVIVRSAYALGGLGSGFANNEGEMKELAAQALSL
FT                   SPQILVEKSLKGWKEVEYEVVRDRVGNCITVCNMENFDPLGVHTGDSIVFAPSQTLSDE
FT                   EFHMLRTAAIKIIRHLGVVGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATGYPL
FT                   AYTAAKIALGYTLPELPNPVTKTTVANFEPSLDYIVAKIPRWDLSKFQHVNRSVGSSMK
FT                   SVGEVMAIGRNFEEAFQKAIRQIDPSFLGFQGSDEFGDKLDDVLANPTDRRWLAIGQAL
FT                   IYEGYSVEKVHELSKVDSWFLYKCMNLVDMYKELDAVNKLEDLDKDLLTRAKKMGFSDK
FT                   QIAVSINKGSEANVHELDVRKVRKSFGIVPFVKKIDTLAAEFPANTNYLYTTYNATKSD
FT                   IDFNDNGVLVLGSGVYRIGSSVEFDWCAVNTARALREKGKKTVMINYNPETVSTDFDEV
FT                   DRLYFEELSFERVMDIYELENSESAVISVGGQLPQNIALKMLENGANILGTSPVDIDRA
FT                   ENRHKFSSILDTIGVDQPEWSELSSVAEAKEFSQSVGYPVLIRPSYVLSGAAMSVVNSE
FT                   HELETKLTNASDVSPDHPVVISKFIEGAQEIDVDAVAYNGKVLVHAVSEHVENAGVHSG
FT                   DATLILPPQSLSESIKNRLYDIAQKVAEAWKITGPFNMQIIKDDRHAGTSLKVIECNIR
FT                   ASRSFPFVSKVLGCNFIDVAVKAFLGDDVPKPVNLMSEEYPYVATKVPQFSFTRLAGAD
FT                   PFLGVEMASTGEVASFGRDALESYWTAMQSTMNFSVPLPPSGILFGGDLSKEYLGQVAH
FT                   TIGTLGFKVYTTSEDAKQYLQKYVPASCEVGIIEFPKNDKRKLREVFQHYDIKAVFNLA
FT                   AKRAESLQDVDYVMRRNAIDFALPLFNEPQTALLFAKALSAKVGEKLKILESQDVIVPP
FT                   EVRTWHEWIGQRPM"
FT   gene            complement(<143734..>144675)
FT                   /locus_tag="KLTH0E01474g"
FT                   /old_locus_tag="KLTH-ORF10148"
FT   CDS_pept        complement(143734..144675)
FT                   /locus_tag="KLTH0E01474g"
FT                   /gene_family="HOG000250286" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10148"
FT                   /product="KLTH0E01474p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH55"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH55"
FT                   /protein_id="CAR23116.1"
FT                   /translation="MPQPPKIIYGAFTFASLTQEEASKFVDVLEKYKVEELDTARIYPG
FT                   SEEAIGKFELPKSFIIDTKARGFGEGTLTKESINESIEESFGLLGVESVEIFYLHCPDP
FT                   ATPLEETLDAIDALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVG
FT                   RKIETSLFPVLRELGLSFYAYSPIAGGFLAKTPEEVLGGKGRFDTSNHVGALYSKLYNK
FT                   PLLIKGLGQWGKIAEKVGISRASLAYRWVYNNSILDGKFGDGVIIGARTPESLAENIES
FT                   LKAGPLDPEVVKEIEEIWTLVEKEAILDNYSH"
FT   gene            complement(<146000..>148444)
FT                   /locus_tag="KLTH0E01496g"
FT                   /old_locus_tag="KLTH-ORF10145"
FT   CDS_pept        complement(146000..148444)
FT                   /locus_tag="KLTH0E01496g"
FT                   /gene_family="HOG000166970" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10145"
FT                   /product="KLTH0E01496p"
FT                   /note="similar to uniprot|P40897 Saccharomyces cerevisiae
FT                   YJL212C OPT1 Plasma membrane transporter that transports
FT                   tetra- and pentapeptides and glutathione member of the OPT
FT                   family"
FT                   /db_xref="GOA:C5DH56"
FT                   /db_xref="InterPro:IPR004648"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH56"
FT                   /protein_id="CAR23117.1"
FT                   /translation="MKNVLKSILSSDAPVTDKKLLHPADSSSGAAASSASDAGKGKGDT
FT                   IVVTERDSSDHDIEKSRSVGLAALRSADYDPLGGKISAIAENDEYAGITVEDDSPYPEV
FT                   RASVPSTDDPSLVQNTIRMWTIGMIMTTIGCGLNMLFSMHSPTIVLTTFVTSILAWPLG
FT                   RAWDMVMPDKPVFGRFGGPSLNPGPFNVKEHALITAMGNVAFGSGNAYATDIILSMNNF
FT                   YNKDFGWGFDLLAVWSTQCIGFAMAGLSRKVLVTPASMIWPANLVTCTFLTNMHINENH
FT                   VANGWKISRLKFFMIVFIVGFVYYWFPGFIFQALSYFAWVTWIKPKDVIVNQVFGASTG
FT                   LGLIPLTFDWNQIAGYVGSPLVPPLGVIATILLSMVIIFWIVVPAVHYSNIWYGKYLPI
FT                   SDSGSYDRFQNTYNVSKIVSESLTFNKDAYREYSPLYLSATFAISYGLSFAGTMATITH
FT                   AICFHGKQIWGAIRNITSSEEEDVHAKLMRNYRDVPQWWFIVVFLIFFGLSIATVRAWP
FT                   TEMPVFTLIIALLIAFFFLLPVGIIYALTNIAVGLNVITEFIIGYMTPGKPIAMMFFKT
FT                   FGYITNNQAITFAQDMKIGHYMKVAPRVLFSAQLVATVWGGLVQMCVMKWAQGNIEDIC
FT                   TSKQKSHFTCPGSKVFFNASIIWGVIGPQRMFSAGQMYDKLMYFFILGAGLPVVNWLVL
FT                   KKWPRSLVRYLNWPVFFSGTGLIPPATPYNYGAYCMVGIFFGYFIKKNYFNWWAKYNYS
FT                   LSAGLDISLAWSSLIIFLALGLTNTDAPSWWGNNVINTIDYDGTAIQHQLTDGESFGLK
FT                   KW"
FT   gene            <149793..>150748
FT                   /locus_tag="KLTH0E01518g"
FT                   /old_locus_tag="Klth0E.mRNA.87.p"
FT   CDS_pept        join(149793..149822,149900..150748)
FT                   /locus_tag="KLTH0E01518g"
FT                   /gene_family="HOG000165015" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.87.p"
FT                   /product="KLTH0E01518p"
FT                   /note="highly similar to uniprot|P32602 Saccharomyces
FT                   cerevisiae YBL050W SEC17"
FT                   /db_xref="GOA:C5DH57"
FT                   /db_xref="InterPro:IPR000744"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH57"
FT                   /protein_id="CAR23118.1"
FT                   /translation="MSDPQALVQKARKKAQPSSGFFKLFGASDSYKFEEAADLFVEAAN
FT                   LYKLRRELEPAGELFLEAASCQIKAGNDDEAGNTYVEAFKAFKAGASPSKACDALNRAI
FT                   EIFTRRGQFRRGANFKFELAEILESDLHDFPHAIDAYEAAADWYAQDQALALANKAYLK
FT                   CADLKALDARYIEACDVYRKVIANSVGNKLSQWSLKDYYLKTALCYLAADDQVAARRTE
FT                   SEALAEDSNFAGSREHDLLAALLEACSEGDAEKLSAKVYEFDRFSKLDKWKTTILLKIK
FT                   DTIATADDDLL"
FT   gene            <152132..>154267
FT                   /locus_tag="KLTH0E01540g"
FT                   /old_locus_tag="KLTH-ORF10126"
FT   CDS_pept        152132..154267
FT                   /locus_tag="KLTH0E01540g"
FT                   /gene_family="HOG000141856" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10126"
FT                   /product="KLTH0E01540p"
FT                   /note="weakly similar to uniprot|Q08905 Saccharomyces
FT                   cerevisiae YOR381w FRE3 protein Ferric reductase, reduces
FT                   siderophore-bound iron prior to uptake by transporters"
FT                   /db_xref="GOA:C5DH58"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH58"
FT                   /protein_id="CAR23119.1"
FT                   /translation="MKFLFTAVLATVMTAVSAELGYQYDEVDYVGFSCKRALSVTAKFC
FT                   KVDTATSYDCYCEEPNAIASFFSCTNENLKSSKNRKAMEDFFQFRCPNITDSEMRSVTQ
FT                   NLSSSLVNTSLISGFNKTKPVTYPVYANKTAYQISYDSYKTRYSQFRMGQHYGAALVGY
FT                   WGIIMVCGMLSNLFCKFAPNLALSLNKKSSQLAPVRLYRKHISIPATFRSKHTTRNFVK
FT                   GLIPTRLESLIIFGFVVLCVIFHAVNFHSVPNNILFTTKPLEISRHVGDRSAMLANYLM
FT                   TLTFLLAGRNQIFITLTGWKQSTFMTYHKWVGRMLFCSVLVHTISMFTYSLMRDYYTYW
FT                   AAEEWWKYGAVAVVAGGIIAIQSFSWFREWNYELFLYVHIATAIAFLVGAWRHIHYFHY
FT                   AEWAYATAAVWCFDRFVRLVRIFMFGVKTAKVGIVSEETLVITVNKGSWWPFFPGAFGY
FT                   LHIMKLNIFWQSHPFTVVKTDNNELRFFIKIKRGATKKLYNQLLKEPNHESEIKVALEG
FT                   PYGDKKPVEAYDQVLLYSGGNGIPGPFAYAKELGEISKEAKSKFVKLYWVIRHWNSLDW
FT                   FLDELMILQRFSNVQTIIYVTRADDGKVGEKLAHHFDQGESESSEGEKGSNVVATTISD
FT                   YAETMQKALPHIEFRKGRPDIAALVEQDIDECHDQNAAIITCGHNEMCDRIRQTVAVKV
FT                   GDHKTSRIDFFEELQTW"
FT   gene            <154987..>155340
FT                   /locus_tag="KLTH0E01562g"
FT                   /old_locus_tag="KLTH-ORF10119"
FT   CDS_pept        154987..155340
FT                   /locus_tag="KLTH0E01562g"
FT                   /gene_family="HOG000184254" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10119"
FT                   /product="KLTH0E01562p"
FT                   /note="similar to uniprot|P38191 Saccharomyces cerevisiae
FT                   YBL049W MOH1"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH59"
FT                   /protein_id="CAR23120.1"
FT                   /translation="MGIRYTSYIDHPKNKHTQFVTYGCCHCRTHLSSSAQVMSKDYRGT
FT                   TGDAYLMNRVVNVEEGGRETRCMLTGCYVVCDIKCHMCKNLVGWKYVESERKDQRYKEG
FT                   KFILELQTICKVR"
FT   gene            <155974..>158007
FT                   /locus_tag="KLTH0E01584g"
FT                   /old_locus_tag="Klth0E.mRNA.113.p"
FT   CDS_pept        join(155974..155997,156058..158007)
FT                   /locus_tag="KLTH0E01584g"
FT                   /gene_family="HOG000210599" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.113.p"
FT                   /product="KLTH0E01584p"
FT                   /note="similar to uniprot|P47147 Saccharomyces cerevisiae
FT                   YJR110W YMR1 Phosphatidylinositol 3-phosphate"
FT                   /db_xref="GOA:C5DH60"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR017906"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH60"
FT                   /protein_id="CAR23121.1"
FT                   /translation="MEYIKIANVDDVILHRRGISAKGTLHLTTHHMIFSSAMLAREFWF
FT                   AYPTIGAAFKNRGSALISKSKDHNERQDPLYSGMDIWSFCNIKIVGKDYTVFSLDFQDE
FT                   RMAQDVYDSVLKLTVLQEETQLYAFIYTPNKAEKPFNSWNIYDPVREFHRQGLALDHAC
FT                   PWRLSDINKDYNFCKTYPHVLVVPRAISDTLLTHASRYRSQNRLPALTFYYRKTNSSIT
FT                   RCAQPLPGLIQQRSIQDEKLVNEIFGCSVPAGNEIPRAVKNIVVDARPATNAMAQTALG
FT                   GGTENMDNYNFGGTASRMFLGIDNIHIMRDSLNNVVDNHLVDNDLNLPIDRGSLNDGKC
FT                   AQWLKYIRTLLSSTETLVKSILFNQSNILIHCSDGWDRTTQVCSLVQLCLDPYFRTLEG
FT                   FMVLIEKDWVSFGHRFAERSGHLSSKNTFHDNSMRISISEAATTMTQGIDLNSRLFGFS
FT                   NSNNGSPQEKTEASTGELSDLSFSSQLPSSSELMHKVSRRVANRKSSNTSPIFQQFLDC
FT                   VHQLQRQNPSQFEFNERFLRRLVYHLYSCQYGTFLFNSEQERVAHDAQNKTRSVWDYFR
FT                   SRPAEFLNASYAPTSPSDDDWILPDLKDVKWWWQLFGRKNEEMNGTSKPSEDRPCSSEE
FT                   GKKTGLKFPSLRLDIFNRGNNR"
FT   gene            complement(<158057..>158872)
FT                   /locus_tag="KLTH0E01606g"
FT                   /old_locus_tag="KLTH-ORF10114"
FT   CDS_pept        complement(158057..158872)
FT                   /locus_tag="KLTH0E01606g"
FT                   /gene_family="HOG000000820" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10114"
FT                   /product="KLTH0E01606p"
FT                   /note="similar to uniprot|P47148 Saccharomyces cerevisiae
FT                   YJR111C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH61"
FT                   /protein_id="CAR23122.1"
FT                   /translation="MTVHILTAQRLVQLATFHPKLQNTWYLLAAATFSACNEPQEIPRL
FT                   YHFAMINELWMGQTLRAANKAIEITHDAENLQSQLNEVYREPTPFQKLATDKFREVLLK
FT                   SSALTGLPKAINSLQALKVVTPEGLGAAAEQVDTKSDMAWTDTKRCAEQNGQQTIRDGI
FT                   EHWSKIYNKVSDKVANNLNSSYPDLWQFTLCHVYGPLLSYDEVLSAQETSLAIIASLVP
FT                   QDVNPQLWGHLKGAVNVGCDPETIDAARNLSILVATWCNVRWRSEVVKL"
FT   gene            <159063..>159671
FT                   /locus_tag="KLTH0E01628g"
FT                   /old_locus_tag="KLTH-ORF10113"
FT   CDS_pept        159063..159671
FT                   /locus_tag="KLTH0E01628g"
FT                   /gene_family="HOG000248864" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10113"
FT                   /product="KLTH0E01628p"
FT                   /note="similar to uniprot|P47149 Saccharomyces cerevisiae
FT                   YJR112W NNF1 Essential component of the MIND kinetochore
FT                   complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
FT                   kinetochore subunits contacting DNA to those contacting
FT                   microtubules required for accurate chromosome segregation"
FT                   /db_xref="InterPro:IPR007128"
FT                   /db_xref="InterPro:IPR016851"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH62"
FT                   /protein_id="CAR23123.1"
FT                   /translation="MSEHVRIRYLRLNQVCKKALQQSVNKVHNWDKIVSCFPQYATVDE
FT                   GATNLANCQRQVVEFWMELSKREFEEIFKERDIENKLNELDDLISRAKTIQRSMCDEGS
FT                   TRECIDELSPEQLISGNMHDTRVNLMNQLDERLDKMTNLNIQLEEQLQQLQAELELETG
FT                   DIHELYDRHLGEDSSLQDEALQQGLKNMLLDMRKEEPFD"
FT   gene            complement(<159757..>163947)
FT                   /locus_tag="KLTH0E01650g"
FT                   /old_locus_tag="KLTH-ORF10109"
FT   CDS_pept        complement(159757..163947)
FT                   /locus_tag="KLTH0E01650g"
FT                   /gene_family="HOG000112328" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10109"
FT                   /product="KLTH0E01650p"
FT                   /note="similar to uniprot|P34216 Saccharomyces cerevisiae
FT                   YBL047C EDE1 Key endocytic protein involved in a network of
FT                   interactions with other endocytic proteins binds membranes
FT                   in a ubiquitin-dependent manner may also bind ubiquitinated
FT                   membrane-associated proteins"
FT                   /db_xref="GOA:C5DH63"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH63"
FT                   /protein_id="CAR23124.1"
FT                   /translation="MASVTFKTPLSAQEQEVYGQHFRKLDPEDLGIVTGESVKHLFNQS
FT                   GLNAQLLSQIWAICDNGNQGFLNLSQFSAALRIIGHLQSNPSLTVSADLFQKPPSKLAS
FT                   LNKPGMSLSNTSTGNSNTGAIPPVSSYDIAKFSQLFDRSTNGAPILPGDKAKDIFLKAK
FT                   LPTATLGSIWNLCDRENSGSLDKSEFIMAMHLIQLAMTNNPVLATVPDSLPGYLWEAVN
FT                   PSNLPQSSLSPSSTGLSVNSPVSRQPSLVRVPSSTFSNAASDWTLSFEKKQQFDAIFDS
FT                   LDKSKAGTLSSQTLVPFFLSSRLSQDTLASVWDLADIHNNAEFTKLEFAIAMFLIQKKK
FT                   TGIELPDVVPDQLLRSPALGLYPPAQQQAPASLPAVPSRDTKPSFNAPPQTVQRNQSAL
FT                   GDLLTLNESFSPQPTPVRAPSNPTGNSMGVPQSPAAGSTTGMRKFQPSSTFGQSIIKEE
FT                   AAESTPQNAGHFEPQQTTRQPLNPQYEAAQQPQYQTPQQQSQYQASQPQPQPQYQAHQQ
FT                   PPQFQSPIQTNQSLPNEESASNGAFEASRTTNTAAQPTSRSLAQQPQQGSHSSSLPNVP
FT                   NFSSPPLRQASLNISSQNDGNASLQLSQATTELANLSNQVGSLTNQATLVNERKTRAQQ
FT                   ELKRINNLKSSIETKMTTLRGSYEKELSETEQLESILTKSRQESEELKRELAVAEANHH
FT                   AVQGSLAELQQQLQESEQSNSQLKEKIGNLNAIAASLQAELNERQQKVKQERSMVDVNS
FT                   RQLEVSEITTTNLQNEIQGLEQHLDIFKQKHKELEDYKSTLESKHGELNSRHQVLEEQH
FT                   AGISRREQEVQERSRQVEEQEKIYHQEIAKLQSMFEDLSAQRESFAKAEDELQKQQFEY
FT                   AQKVQELSERRMKLAMGELPEDSDEISKNHRSFSSNQDHIAKFVDESVTNSRLGAQEDE
FT                   DKQESDVFDKDVPTVGSQTEIDDEDRRSNDDETAAQALADRFDGDLNEYGIPRTESVTS
FT                   SVMNNAPQSVRDYAEGDLATLAAPGENAPRTAEAQNAKTTETVEGNMPGGWSAEQANGA
FT                   KQQEEHQGPLPKSSDQESEAETLKNTTKESYEEPSESAGKAITEEFPPIQELDINESES
FT                   DSSLSDDDEGFKDAEGSAQQAAAKPTATKGTSSVKATAPAQGPKPAEEPVFPAQKTDAD
FT                   KPSAVGAIVENAANAKPATEQHAPQESASVKPSTEANPSTERTLKAEPSSMGAYTQEEK
FT                   SITKEKPSEDFDDEFAGLEQAAPEEEAIDHLNENEYSEGFETIDHNDLDEELNQGGFTG
FT                   APAAEEHAGTDNSAATVGADEWDEIFAGFGNAGQGPVSVTQPATSRIKQPTPVRTSREA
FT                   PAAPVNRGIATTPKSLAVEELGSMGFTTEEATKALEHCNWDLGAATNYLLDSS"
FT   gene            <164801..>164882
FT                   /locus_tag="KLTH0E01672r"
FT                   /old_locus_tag="Klth0E.tSer.AGA.2"
FT   tRNA            164801..164882
FT                   /locus_tag="KLTH0E01672r"
FT                   /old_locus_tag="Klth0E.tSer.AGA.2"
FT                   /note="tRNA-Ser (AGA) cove score=80.04"
FT   gene            <165164..>165550
FT                   /locus_tag="KLTH0E01694g"
FT                   /old_locus_tag="KLTH-ORF10103"
FT   CDS_pept        165164..165550
FT                   /locus_tag="KLTH0E01694g"
FT                   /gene_family="HOG000000821" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10103"
FT                   /product="KLTH0E01694p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH64"
FT                   /protein_id="CAR23125.1"
FT                   /translation="MPLINKKYFSTLLASSVLALFLGLTTDSKLTYFTSDHDKAAHFVV
FT                   FFLESWLFTKSLIPRRIKLLSHTVDKYILSLLVCAVGAGVGSEFAQAVLSRGRRQFDSL
FT                   DIVCNVCGGTLGVAVAGHAEFLWR"
FT   gene            complement(<165606..>166409)
FT                   /locus_tag="KLTH0E01716g"
FT                   /old_locus_tag="KLTH-ORF10100"
FT   CDS_pept        complement(165606..166409)
FT                   /locus_tag="KLTH0E01716g"
FT                   /gene_family="HOG000000824" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10100"
FT                   /product="KLTH0E01716p"
FT                   /note="similar to uniprot|P47150 Saccharomyces cerevisiae
FT                   YJR113C RSM7 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="GOA:C5DH65"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH65"
FT                   /protein_id="CAR23126.1"
FT                   /translation="MFALRRQLSPALWKNGPRLPASCVAVRHCELPNCIRFQSGTVDQR
FT                   TAEKASEDRSSLPDTEINSWLEAIESLRSEFTEQPYLPESSLAGPGQSKVNLLEEALNA
FT                   KKTFEPSEEQIAEWEVLKTVPLPERQDETLQHVTNMIMRHGKKQRAEKTLSRALYLVFC
FT                   YTRQDPIQLLKKALDDLAPMMVVKTFKTGVAKAAVIPVPLNARQRNRMAWKWIMEGANK
FT                   RVSSDFAVRLGEELISVFKGNSSGFDKRDQMHKTAIAHRAYIKLK"
FT   gene            <166653..>167789
FT                   /locus_tag="KLTH0E01738g"
FT                   /old_locus_tag="KLTH-ORF10099"
FT   CDS_pept        166653..167789
FT                   /locus_tag="KLTH0E01738g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10099"
FT                   /product="KLTH0E01738p"
FT                   /note="some similarities with uniprot|P38193 Saccharomyces
FT                   cerevisiae YBL046W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR015267"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH66"
FT                   /protein_id="CAR23127.1"
FT                   /translation="MMGIRSDFLYQSLTLMVVEKDASVLRKVEPQQLIPELLVHMTDTI
FT                   PHEIFQTGSDTESLVARLKFMGEHLTSQFANNHVYPFTMHRICEVCFHPLKYFKTHELG
FT                   KFVNALEKCCLVSSPLEEESETACEDVSDAGNVSLSKIPWVTQVDEKDLASFLREIEAT
FT                   VSANFGYEQDDDEGEEGDGLDISRNSDVQHNLLDDDDDDDDEDDEDYSDDLNDEEDAGS
FT                   GGGEDEEIIVEEQIEEDESYSDDETSNGSNEHRGEIEGAGAIDEGETTSEDEDTETSDA
FT                   LRKRKTTELDDFGERDSEVFPVNTTPKKKKHGLAGDASLAESPLFAQGTAVQSKSVEHQ
FT                   VSVLISPSTAIPPQPDKVAAVTDDGNETSPLSYKSSRR"
FT   gene            complement(<168037..>169383)
FT                   /locus_tag="KLTH0E01760g"
FT                   /old_locus_tag="KLTH-ORF10098"
FT   CDS_pept        complement(168037..169383)
FT                   /locus_tag="KLTH0E01760g"
FT                   /gene_family="HOG000242450" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10098"
FT                   /product="KLTH0E01760p"
FT                   /note="similar to uniprot|P07256 Saccharomyces cerevisiae
FT                   YBL045C COR1 Core subunit of the ubiquinol- cytochrome c
FT                   reductase complex (bc1 complex) which is a component of the
FT                   mitochondrial inner membrane electron transport chain"
FT                   /db_xref="GOA:C5DH67"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH67"
FT                   /protein_id="CAR23128.1"
FT                   /translation="MLRSATRSVFKRGLVTPASKPVVTELSNGIKVATLTNEQSAAATV
FT                   GVVFGSGSASENPYNNGVSNVLAHLFHSEGAQQAAKAGIQLSTKTARDYQSYVASFAAG
FT                   SGAVSKPLDLLQSHISAALESSSDAATAGALAKTAKEVAAFEASNHPGRVLEHLHATAF
FT                   QNTPLGLPVRGTVESIEALEKADLQTHARYHFHNSNAVIVGSGNVAHDELVKAVESQIS
FT                   LQSGDKPVEKKKSSFLGSEVRLRDDTLPKAWIAIAAEGEPVTSPNYYVAKVAAQVFGSY
FT                   AEAEPASRLQGVKLIDEVQEYHLCDSFDHYSLSYKDAGLWGFSAETSNIHQIDDLTHFT
FT                   LKQWNRLSISVTEQEVARAKSLLKLQLGSVAADSVKLAHSLGAETLALGAAPDLTRVFE
FT                   KIDNITVKDVKAWASDRLWDQDIAIAGTGKIEGLLDYMRLRNDMSMMRW"
FT   gene            <170763..>171386
FT                   /locus_tag="KLTH0E01782g"
FT                   /old_locus_tag="KLTH-ORF10089"
FT   CDS_pept        170763..171386
FT                   /locus_tag="KLTH0E01782g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10089"
FT                   /product="KLTH0E01782p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH68"
FT                   /protein_id="CAR23129.1"
FT                   /translation="MNQTPLLMSVSRQCLLAQKVRQKLIRCASPAKDTDIDLRLLVGHA
FT                   NLLDRLAREAADAAAAAVPYEATEQRTKSRHHVPKSSQSVLELENSDSESDSDADSDAD
FT                   ADEFWSSSDSDDDADSDDFYSESDGDSDLDPEEEADAEWDTQMGIAKYEAAGPYCLYKP
FT                   VSRYITTTTVVLSDEEDEDDEEPVCHDHTALRRFPAVEPALIRA"
FT   gene            <171881..>173620
FT                   /locus_tag="KLTH0E01804g"
FT                   /old_locus_tag="KLTH-ORF10084"
FT   CDS_pept        171881..173620
FT                   /locus_tag="KLTH0E01804g"
FT                   /gene_family="HOG000194592" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10084"
FT                   /product="KLTH0E01804p"
FT                   /note="similar to uniprot|P27614 Saccharomyces cerevisiae
FT                   YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
FT                   induced under low-nitrogen conditions"
FT                   /db_xref="GOA:C5DH69"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017141"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH69"
FT                   /protein_id="CAR23130.1"
FT                   /translation="MTNDYIPIDRPKPVQARRKWMITALAAFLTVCLCRLAYVTSHRAP
FT                   PAGQTLACDSVKTISELPVHKIQKLLDDKALYNQTLAKLQNAVRVPTEVYDTVVNPEID
FT                   ADDAVWAPFVEIHKQLARDFPAVWANLRVEKVNHYGLLITWEGSDSDLKPAMFAAHMDV
FT                   VPVERKTWSQWKHEPFSGDLTVDPDFGTLLWGRGSFDDKNMLIGVLQALEYMLTQEPEF
FT                   KPKRGVVVSVGFDEEIGGHFGAAYLTKILQERYGHKGMLSIIDEGVVGVKEIENVMIAA
FT                   PGIGEKGRIDLWFHLNTPGGHSSVPPDHTSIGIAAELISDIESEKFPATFAPQNPLSQY
FT                   YRCIAKNSDTMEKSLKRDFEFSMQDPKANSRVVEYLIETGGKKIEYLLRSTHAVDIIQG
FT                   GIKANALPETVSFLVDSRIAVDSSVAEVQDVFIKRAVKIAKKYDLGVVFEGEVLLPATP
FT                   NGNFNITLAGKPLEPAPPSPENDVWGIFAGSIKTFYEDVIFPKTFSEPRELVVGPSIMS
FT                   ANTDTAHYWDLTDNIYRYQPGFAMEDTLSTIHSVNEHINFDTVMHVVGFTYGYIHAVNK
FT                   FEK"
FT   gene            <173841..>174569
FT                   /locus_tag="KLTH0E01826g"
FT                   /old_locus_tag="KLTH-ORF10078"
FT   CDS_pept        173841..174569
FT                   /locus_tag="KLTH0E01826g"
FT                   /gene_family="HOG000091081" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10078"
FT                   /product="KLTH0E01826p"
FT                   /note="highly similar to uniprot|P23724 Saccharomyces
FT                   cerevisiae YBL041W PRE7 20S proteasome beta-type subunit"
FT                   /db_xref="GOA:C5DH70"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH70"
FT                   /protein_id="CAR23131.1"
FT                   /translation="MATTVASEYSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAG
FT                   DTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGNALVKRFQNSLKWYHFDHNDKKL
FT                   SMRSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAA
FT                   SLIMPFLDNQVNFKNQYEPDSHGTKRKHVKFLTVEEVVQLVRDAFSSATERHIHVGDGV
FT                   EILIVTKEGVRKEFFELKRD"
FT   gene            complement(<174685..>175347)
FT                   /locus_tag="KLTH0E01848g"
FT                   /old_locus_tag="KLTH-ORF10075"
FT   CDS_pept        complement(174685..175347)
FT                   /locus_tag="KLTH0E01848g"
FT                   /gene_family="HOG000231400" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10075"
FT                   /product="KLTH0E01848p"
FT                   /note="similar to uniprot|P18414 Saccharomyces cerevisiae
FT                   YBL040C ERD2 Integral membrane protein that binds to the
FT                   HDEL motif in proteins destined for retention in the
FT                   endoplasmic reticulum; has a role in maintenance of normal
FT                   levels of ER-resident proteins"
FT                   /db_xref="GOA:C5DH71"
FT                   /db_xref="InterPro:IPR000133"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH71"
FT                   /protein_id="CAR23132.1"
FT                   /translation="MFNIFRISADLAHLASILILVHNIRKTRQIDGISLKTQVLYVLVF
FT                   CTRYLDLLTFRWRSVYNTLMKFVFIGSSVYVVSLIQKCRVTNPVAYRDMLVRDTFHIKY
FT                   LLAGSAVLALIFNYKFTFLEIFWSFSVWLESFAIMPQLFMISRSGKASTITSHYIFAMG
FT                   LYRALYIPNWIWRYSIDGRPLDKLSFCTGLIQTALYSDFFYVYYKKVVKGSGFQLPH"
FT   gene            complement(<175513..>176523)
FT                   /locus_tag="KLTH0E01870g"
FT                   /old_locus_tag="KLTH-ORF10074"
FT   CDS_pept        complement(175513..176523)
FT                   /locus_tag="KLTH0E01870g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10074"
FT                   /product="KLTH0E01870p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH72"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH72"
FT                   /protein_id="CAR23133.1"
FT                   /translation="MLTPWLLLLSALYFGAKIALALSDVHTTPDAYEYLRSSQLPVLVM
FT                   VYMHGCRFCQELEPNFLFLERVFAGELALLKVDGKRAMTFSHDLNIRSFPELLLYGPGE
FT                   GAQAEAGSTLLGRYPSARDRDLGSLAMFVSERSALMAHWPHSSVRDVTQDPHAQLDALR
FT                   SEPLRVSVLVFVTPWMERRSLQLFNGEQSTCILDQLAETPELRENNVEIYRIDASNSTT
FT                   ALWTREFRVAVYPTIVLLAPDASGSQREIHVPLRAGDLELRNHEKDTLLRLVRHCAAGR
FT                   AADPDCLDFVRSYHGLRSLEPQGALPRNETQMAVEGPEFDFSSDDEQLFDSLRDL"
FT   gene            <177826..>178361
FT                   /locus_tag="KLTH0E01892g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.411.p"
FT   CDS_pept        join(177826..177838,177910..178361)
FT                   /locus_tag="KLTH0E01892g"
FT                   /gene_family="HOG000263447" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.gf.411.p"
FT                   /product="KLTH0E01892p"
FT                   /note="highly similar to uniprot|P00445 Saccharomyces
FT                   cerevisiae YJR104C SOD1 Cu Zn superoxide dismutase some
FT                   mutations are analogous to those that cause ALS
FT                   (amyotrophic lateral sclerosis) in humans"
FT                   /db_xref="GOA:C5DH73"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH73"
FT                   /protein_id="CAR23134.1"
FT                   /translation="MVKAVAVLRGDAGVSGTVHLEQKAENEPTTVSYEIAGFGSSGDHG
FT                   FHIHEFGDNTNGCTSAGPHFNPFKKTHGSPSDEVRHVGDLGNIAANDKGVCKGVLTDSL
FT                   VKLIGPTSVLGRTVVVHSGQDDLGKGGNEESLKTGNAGTRPACGVIGISN"
FT   gene            complement(<178565..>180295)
FT                   /locus_tag="KLTH0E01914g"
FT                   /old_locus_tag="KLTH-ORF10064"
FT   CDS_pept        complement(178565..180295)
FT                   /locus_tag="KLTH0E01914g"
FT                   /gene_family="HOG000077514" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10064"
FT                   /product="KLTH0E01914p"
FT                   /note="highly similar to uniprot|P28274 Saccharomyces
FT                   cerevisiae YBL039C"
FT                   /db_xref="GOA:C5DH74"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH74"
FT                   /protein_id="CAR23135.1"
FT                   /translation="MKYVIVSGGVISGIGKGVLASSTGMLLKTLGLRVTSIKIDPYMNI
FT                   DAGTMSPLEHGECFVLNDGGETDLDLGNYERYLGVTLTRDHNITTGKMYSHVISRERRG
FT                   DYLGKTVQVVPHLTDAIQDWIERVARIPVDDSGAEPEVCIIELGGTVGDIESAPFVEAL
FT                   RQFQFRVGKDNFSLIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCSEKLEE
FT                   HVINKIAMFCHVGPEQVVNVHDVNSTYHVPLLLLEQKMIDYLSARLKLSDIALNSEDKK
FT                   RGDNLLNRWRSLTTSIDESFECVKIALVGKYTNLKDSYLSVIKALEHSSMRCHRRLEIV
FT                   WVEASDLEPETTEHEKSKFHEAWNKLSAADGVLVPGGFGTRGTEGMVLAAKWARENNIP
FT                   YLGVCLGLQVATLEFARNVLGMKNVTSAEFDPDCAEEDQGVVYMPEIDKENMGGTMRLG
FT                   LRPTIFQAETEWSKLRKLYGGSHEVHERHRHRYEVNPKLVPRLEEQGLMFVGRDESGER
FT                   CEILELRNHPYFVATQYHPEYMSKVLDPSQPFLGLMAASAGILDEMLANDTRSNERAEF
FT                   "
FT   gene            complement(<181119..>181727)
FT                   /locus_tag="KLTH0E01936g"
FT                   /old_locus_tag="KLTH-ORF10058"
FT   CDS_pept        complement(181119..181727)
FT                   /locus_tag="KLTH0E01936g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10058"
FT                   /product="KLTH0E01936p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH75"
FT                   /protein_id="CAR23136.1"
FT                   /translation="MESRLQELEERHVSVYRELLTALDELYLLRKGIQPEDETLLVVRR
FT                   KLQSSLTMTAPMMSAMNGKTALDKRLTRLMKENHELDAEVAAHQDEKLRLLRELSDERM
FT                   RYKELVNNARELTERQAHAQGIGEQRMPRGRQDANKSTDSDLYDSSEQGDSTEAGSEQR
FT                   DKAQIERENEALRELLVGMIVHGGYLGTNKVFDEWLGDL"
FT   gene            <181815..>182357
FT                   /locus_tag="KLTH0E01958g"
FT                   /old_locus_tag="KLTH-ORF10056"
FT   CDS_pept        181815..182357
FT                   /locus_tag="KLTH0E01958g"
FT                   /gene_family="HOG000191978" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10056"
FT                   /product="KLTH0E01958p"
FT                   /note="similar to uniprot|P47142 Saccharomyces cerevisiae
FT                   YJR102C VPS25 Component of the ESCRT-II complex, which is
FT                   involved in ubiquitin-dependent sorting of proteins into
FT                   the endosome"
FT                   /db_xref="InterPro:IPR008570"
FT                   /db_xref="InterPro:IPR014040"
FT                   /db_xref="InterPro:IPR014041"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH76"
FT                   /protein_id="CAR23137.1"
FT                   /translation="MTEKLPPIYNFPPLYTCQPNVLIREQQLSTWCDLILDFAKTNNAW
FT                   CMSQEGTVIKDSESSGQSIFRNESIQRSISVPFRDQIWNKMVQSEKAIKSNNGVFFILW
FT                   RSVDYWSSQILQWFETTGKVNQVVTVYELLEGDETLGWEFHGMHPSLCEESLQKLRDRG
FT                   RATLLKEQNKIMGVKVV"
FT   gene            complement(<182400..>183158)
FT                   /locus_tag="KLTH0E01980g"
FT                   /old_locus_tag="KLTH-ORF10055"
FT   CDS_pept        complement(182400..183158)
FT                   /locus_tag="KLTH0E01980g"
FT                   /gene_family="HOG000248397" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10055"
FT                   /product="KLTH0E01980p"
FT                   /note="similar to uniprot|P47141 Saccharomyces cerevisiae
FT                   YJR101W RSM26 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="GOA:C5DH77"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH77"
FT                   /protein_id="CAR23138.1"
FT                   /translation="MFRFASKRSIHSVPKLKNSGHVLEQGIPNVLSASGFNIAWTQQQK
FT                   YLCDKLTLATAGTSQESYLPFHLILNTAKKPFQTNIFNLASAAHNNHLFVENVLPGPAN
FT                   TAPSRLFRTRIEEQYNCTWEEFKTEMVRRAETDVVGQGWLFLVENSDKELHILTVQNNG
FT                   TPYYFPRNQSFDLNSALKLEEYSQLDAVRTIVKKGGKIQDWTMPLIAVSLWDHAYLHDY
FT                   GVKGRSQYVKNVLDNLNWTVVNNRLYTGPA"
FT   gene            <184381..>185367
FT                   /locus_tag="KLTH0E02002g"
FT                   /old_locus_tag="KLTH-ORF10054"
FT   CDS_pept        184381..185367
FT                   /locus_tag="KLTH0E02002g"
FT                   /gene_family="HOG000248395" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10054"
FT                   /product="KLTH0E02002p"
FT                   /note="similar to uniprot|P47140 Saccharomyces cerevisiae
FT                   YJR100C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR005552"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH78"
FT                   /protein_id="CAR23139.1"
FT                   /translation="MFRRAFNRRWYSPLPRVVRHRPVPRAGRTTNAIYDATPSRGANEL
FT                   GSTRSIIQPHHPVATTILNEPTVVIERQIEMMNVFLGFEQANKYVIMDALGNRIGYMQE
FT                   RDFSIAKAVMRQFYRLHRPFVVDVFDNWGNLLLTIKRPFSWINSHIKAILPDDASPQQS
FT                   LGSSSVDVAPFGSGPVPKSTSTFGEGGILVGESVQNWHLWRRRYELFEREAPTEDSFSQ
FT                   FAEIDAPFLSFEFALKDEVGKTMGGVDRNWVGLGRELFTDTGVYIVRMDSQQSLQGVLP
FT                   AEIISDRILNLDQRAVLLANAVSIDFDYFSRHSRHGGGFIGFGDYGE"
FT   gene            <185547..>186506
FT                   /locus_tag="KLTH0E02024g"
FT                   /old_locus_tag="KLTH-ORF10052"
FT   CDS_pept        185547..186506
FT                   /locus_tag="KLTH0E02024g"
FT                   /gene_family="HOG000203918" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10052"
FT                   /product="KLTH0E02024p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH79"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH79"
FT                   /protein_id="CAR23140.1"
FT                   /translation="MSWNTIESDAGVFTQLIRDLGVSGVQFAEIPMLDSLEELAPSLYG
FT                   VIFLFKYNSSDYAGNEPVQGAYDFDYPDSLFFANQTIQNACGTLAVLNTLLSLSNDFPE
FT                   EIRLGDTLSEFISFTAAFKDPVLRGESVSNSDHIRNVHNSFSTPEPFVLDEKTPDDGRK
FT                   AAEVFHFVSFVEHEGVLYELDGLRPTPIVHREYSNDSRDRLTFAQNIISVLQKRMQLCV
FT                   NSGGKFSVIAIHRDAIERLEDLRQQGAITDQDYQLECSRELQKRETWAKELSMRRQNLY
FT                   GLIFELLKQVSSSMTDEEFADHIKIAQKTTLERLKRRN"
FT   gene            <187098..>188762
FT                   /locus_tag="KLTH0E02046g"
FT                   /old_locus_tag="KLTH-ORF10050"
FT   CDS_pept        187098..188762
FT                   /locus_tag="KLTH0E02046g"
FT                   /gene_family="HOG000184681" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10050"
FT                   /product="KLTH0E02046p"
FT                   /note="similar to uniprot|Q07109 Saccharomyces cerevisiae
FT                   YPR045C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH80"
FT                   /protein_id="CAR23141.1"
FT                   /translation="MDGAHHIPSKREVQISPSMKDQHGLSQVFDIDDVRERRMKKGGKK
FT                   YNQVQPVALGQSRKIPSSENRKAMSEKEKTELLQRIIGGGSQQFPSGMREFILGCFQLA
FT                   EQHKFDQSAHMLLVQQLKDLISKAYTEKKEYINDWWSQTIPCLTKSRTELVLACDKPSR
FT                   KPSAPVSSPRQSSLPPPPPPPPPSQEAVRGTLRVPPPPPTVDMARRQNSNTVAPDRLAS
FT                   RSRGSTELERRRKRMERFSNDSTGSKKSKVTSDENFANLNAISTNFYKFDKNKPVVGRC
FT                   QTLEKKYLRLTSEPNPDLVRPLNVLKKAYDSILEKHTKGEASYAYLCDQFKSMRQDLRV
FT                   QIIENQFALKVYQTHARLALQNNDIGEFNQCQSRLGQLFELPNLPNSNLEEFVSYRILY
FT                   YLMMNNQNSINELKLKYMTAENLAVYRHPIVRHALKMANSLLMDDYHSFFKLYAETSGP
FT                   TRCLVDTFISRERLRALNTISKSYNQIPLPFLFKELQLQSFDEGVEFIEQLGLSQYVSY
FT                   KNKGQEGELATLNTKTSRFSIIQQFEKSKRVDIKGQI"
FT   gene            complement(<188805..>189506)
FT                   /locus_tag="KLTH0E02068g"
FT                   /old_locus_tag="KLTH-ORF10049"
FT   CDS_pept        complement(188805..189506)
FT                   /locus_tag="KLTH0E02068g"
FT                   /gene_family="HOG000182400" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10049"
FT                   /product="KLTH0E02068p"
FT                   /note="similar to uniprot|P35127 Saccharomyces cerevisiae
FT                   YJR099W YUH1 Ubiquitin C-terminal hydrolase that cleaves
FT                   ubiquitin-protein fusions to generate monomeric ubiquitin
FT                   hydrolyzes the peptide bond at the C-terminus of ubiquitin
FT                   also the major processing enzyme for the ubiquitin-like
FT                   protein Rub1p"
FT                   /db_xref="GOA:C5DH81"
FT                   /db_xref="InterPro:IPR001578"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH81"
FT                   /protein_id="CAR23142.1"
FT                   /translation="MSLPRSVVPLESNPEVFTRFAHELGLSPEYAVHDIYSLTEPDLMA
FT                   FLPRPMKAIVLLFPINDVYESSKDTSTRNEGASQASPIWFKQTVKNACGLYALLHSLAN
FT                   NPDTLQENSKISHFLSSNPRPDNRFADEKTDEFIVSISELYNKNSSYGQTAVPQAEDEV
FT                   NLHFITYVKSGDYIFEMDGRRNGANLLGTSSSQDLLEEPLVRERVEWYMNNADENMKLS
FT                   FSLLGLAPSWD"
FT   gene            <189685..>190230
FT                   /locus_tag="KLTH0E02090g"
FT                   /old_locus_tag="KLTH-ORF10047"
FT   CDS_pept        189685..190230
FT                   /locus_tag="KLTH0E02090g"
FT                   /gene_family="HOG000142065" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10047"
FT                   /product="KLTH0E02090p"
FT                   /note="similar to uniprot|P40993 Saccharomyces cerevisiae
FT                   YDR478W SNM1 Subunit of RNase MRP, which cleaves pre-rRNA;
FT                   not shared between Rnase MRP and nuclear Rnase P, in
FT                   contrast to all other Rnase MRP protein subunits; binds to
FT                   the NME1 RNA subunit of Rnase MRP"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH82"
FT                   /protein_id="CAR23143.1"
FT                   /translation="MSLNRQQREKFMASHICHKYNLLHVLPGIGQSQLSGLYLKSFYNG
FT                   VKRNQLQLPEPLVNGSKFCDSCGVVYIAGVNLDMKVQEAENDGVGAKSLVYTCRNCGKH
FT                   KHFQISVKIREPTPKPAEAFVAKWPAKKDESKVKKLTGKERAKKRKLDSLSSMLSRKRE
FT                   EEESKKKLSLSLDDFLQK"
FT   gene            complement(<190315..>191943)
FT                   /locus_tag="KLTH0E02112g"
FT                   /old_locus_tag="KLTH-ORF10045"
FT   CDS_pept        complement(190315..191943)
FT                   /locus_tag="KLTH0E02112g"
FT                   /gene_family="HOG000248734" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10045"
FT                   /product="KLTH0E02112p"
FT                   /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
FT                   YDR479C PEX29 Peroxisomal integral membrane protein,
FT                   involved in regulation of peroxisome size and number;
FT                   genetic interactions suggest that Pex28p and Pex29p act at
FT                   steps upstream of those mediated by Pex30p, Pex31p, and
FT                   Pex32p"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH83"
FT                   /protein_id="CAR23144.1"
FT                   /translation="MDSVAGFFWDDAATKRRRSSHNDPADGAKPSLSNERKGSVGSLQG
FT                   QGGVGSVSQNYLADKLVEKLIYMALPPSSELAKKTIEHRVEASRNRPGLSVPIMSRNFV
FT                   QLNSRLGPPFQVIDEVIKIFNWTNTAYTLSVLSLFTYTVMKPLPTLTSIPIFYLLFGVM
FT                   VPQYLKIHKPDSSLVFASNPVPATGPPLVKAEVPKPVPEFSKEFILNLTDLQNHMLLYV
FT                   SAFDFVNGILARFAFFTDESTSSAAFLALLVLAWFNALFMDTLSRFIPLKSLLIISGWA
FT                   LALALHPRYRDHFLSKIYSEETRLRALMISSKVEKRVNEYFQYREPRELRQASIFEVQK
FT                   LDTSIKTWGLVGYSTDHYALFSDYRISEKGLEDASHTLEEVKAPLEWEWTKGSKWVQDL
FT                   DPVSWVASEFVDYVDIDVEAKWVYDACLDGSRGDYRRRRWIRQCTRIAEQISVSENTSS
FT                   DTTDDVYQQGQFNGYASSFAPETVSGSTGVPKLQKDQPVAASSIPKSNSVGSASSVGSK
FT                   TTASESGKASSSKAAKSLTDLLNLT"
FT   gene            <192040..>193065
FT                   /locus_tag="KLTH0E02134g"
FT                   /old_locus_tag="KLTH-ORF10043"
FT   CDS_pept        192040..193065
FT                   /locus_tag="KLTH0E02134g"
FT                   /gene_family="HOG000247885" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10043"
FT                   /product="KLTH0E02134p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH84"
FT                   /protein_id="CAR23145.1"
FT                   /translation="MLNHICTKTLKFKTSLARKVRHQRPNCKLGMQFECLKNVPEDLVS
FT                   SLLVSDRTPHINVTAWDGTVSLYDYNANELVVRMKHTDPLLCSAWLEHGSKKYAGSVAG
FT                   EVLEVDMESGKFHLVSDAAELGISAMRCSENDVLAGSWDGSLQALDTRSGKAWFTVRHE
FT                   NRKVLALDCAGNTVVVATTGGKVTIYDLRNMHNPKLQESGLKFQTRDIKLMPSGGGYVQ
FT                   SSLDGRVAVEYFGQDSSRFAFRCHRMNLSDTQFVFPVNALCFNRSDELLYTGGSDGRVF
FT                   SWNLTTRKKSEELPKFEDSVLKLGCNDDVFCVATGDDSFKTLATIQDADVQPGKIYYTK
FT                   L"
FT   gene            complement(<193083..>194579)
FT                   /locus_tag="KLTH0E02156g"
FT                   /old_locus_tag="KLTH-ORF10042"
FT   CDS_pept        complement(193083..194579)
FT                   /locus_tag="KLTH0E02156g"
FT                   /gene_family="HOG000247886" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10042"
FT                   /product="KLTH0E02156p"
FT                   /note="similar to uniprot|Q07015 Saccharomyces cerevisiae
FT                   YDR257C SET7 Nuclear protein that contains a SET-domain
FT                   which have been shown to mediate methyltransferase activity
FT                   in other proteins"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH85"
FT                   /protein_id="CAR23146.1"
FT                   /translation="MDTSEFETKTNNFLRWASKDAKLWISDKVKLLGTRDGDQGRYMVA
FT                   TQEIIKGEKLFEVPRGSALNVATLSLSMRDKQVYKKLTTEVGHWEGLVIAILYEFKVMN
FT                   QNSKWWPYFEVLPEPARLNSLMYWTGAELEYLKPSGVYERVDREGAEEMYARVMKCAED
FT                   LKITELTNITWEEFMHVASIIMAYSFDMERPDYEDSDEEVEESDEEEEEEKNTVWNDGY
FT                   FKSMVPMADMLNSDTHKCNANLTYSPEALIMVAVADIPSGEQIYNNYGEYPNSELLRRY
FT                   GYVEWSGSKFDCGEMPLETLLKAIEVCLEAPRRLIDKLVEILSHDNDIVEDILEGEPLV
FT                   MESYDCFLDGQVVPECATLVQILTIALQLPDVQQYDEKTLSGYLQRIIKRAIKTVNSVK
FT                   ITKKCLQVWKTASDARLQDYPSHSFREPSPDHVALTGDSLRRRMAECVLQSEVQSFQNC
FT                   FSSLEQRSKVIEDQQLLDMVLKRKQTAEKGSQKQQKRLKK"
FT   gene            <194914..>196695
FT                   /locus_tag="KLTH0E02178g"
FT                   /old_locus_tag="KLTH-ORF10038"
FT   CDS_pept        194914..196695
FT                   /locus_tag="KLTH0E02178g"
FT                   /gene_family="HOG000186562" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10038"
FT                   /product="KLTH0E02178p"
FT                   /note="highly similar to uniprot|P15705 Saccharomyces
FT                   cerevisiae YOR027W STI1 Heat shock protein also induced by
FT                   canavanine and entry into stationary phase"
FT                   /db_xref="GOA:C5DH86"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH86"
FT                   /protein_id="CAR23147.1"
FT                   /translation="MSAEEFKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRS
FT                   ACFTSLKKFNEALNDANECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEIDTS
FT                   NKAAQDGLEQVQKAQKSQQQPDLGFGQMFSDPNMIEKLKNNPKTAELMKDPQLVSKVLQ
FT                   FQSNPQMMGPEILQDPRMMTIMAAMLGVDLSIGGDSNGQEPAAPSKEAPATKETASEAE
FT                   SAKPAPEAKAAPSASSAEASSSATADAGPMEVDEPQPEQDSKKNADAEKAEGNKFYKAR
FT                   KFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGREMRADYKLI
FT                   SKSFARIGNAYLKLEDFKKAIEFYQKSLTEHRTPDILTKLRNCEKEQKVREAQAYIDPE
FT                   KAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDC
FT                   DMAISKDPNFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNNGANVREIDQLYIK
FT                   ASQQRFQPQDPNETPEQAYARALKDPEVASIMQDPVMQSILSQAQQNPAALQEHMKNPE
FT                   VFNKIQTLIAAGIIRTR"
FT   gene            complement(<197021..>199363)
FT                   /locus_tag="KLTH0E02200g"
FT                   /old_locus_tag="KLTH-ORF10034"
FT   CDS_pept        complement(197021..199363)
FT                   /locus_tag="KLTH0E02200g"
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10034"
FT                   /product="KLTH0E02200p"
FT                   /note="highly similar to uniprot|P33416 Saccharomyces
FT                   cerevisiae YDR258C HSP78 Oligomeric mitochondrial matrix
FT                   chaperone that cooperates with Ssc1p in mitochondrial
FT                   thermotolerance after heat shock; prevents the aggregation
FT                   of misfolded matrix proteins; component of the
FT                   mitochondrial proteolysis system"
FT                   /db_xref="GOA:C5DH87"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH87"
FT                   /protein_id="CAR23148.1"
FT                   /translation="MLRLARTSALRASLARTATAASTRAAMASPARRLSALRVPATRFT
FT                   RPCNQYRTYVSLNMNNQEPQKPALEQFGTNLTQLAQEGKLDPVIGRDEEIARAIQILSR
FT                   RTKNNPVLIGRAGVGKTSLIDGLAQRIVSGQVPDSLKNKKLVTLDLGSLVAGAKYRGEF
FT                   EERLKNVLEEIDKSNGEVIVFIDEVHMLLGLGKTDGSMDASNILKPRLAKGLRCISATT
FT                   IDEFKIIEKDPALSRRFQPIMLNEPNVADTISILRGLKERYEVHHGVRITDSALVSAAT
FT                   LSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDAIQSLDRAIMRIQIELESLKKETD
FT                   PVSLERRTALEDELELKRKEHARLTEIWEKEKAEIESIKTAKADLEQARIDLEITQREG
FT                   NFAKASELRYAKIPELERRVARNAQKDAKENLLHDSVSSDDISNVIAKMTGIPMETVLK
FT                   GDKDRLLYMEDSLRKRVVGQDEAIDAVSDAVRLQRAGLTSEKRPIASFMFLGPTGTGKT
FT                   ELTKALAEFLFDNESNVIRFDMSEFQEKHTVSRLIGAPPGYVMSESGGQLTEAVRRKPY
FT                   AVVLFDEFEKAHPDVCKVLLQVLDEGKLTDSQGHQVDFRNTIIVMTSNIGQDILLSDTE
FT                   LGNDGKVSKATQERVIEAMKKSYPPEFINRIDDVLVFNRLSKDVLRSIVDIRIEEIQER
FT                   IADKRMKLNISDAAKEWLTDNGYDQLYGARPLNRLIHKRILNSMAMYLLRGQIRPEETV
FT                   NVDVKDGKLVVEPNHEEGEVVPAKDEA"
FT   gene            complement(<199706..>200500)
FT                   /locus_tag="KLTH0E02222g"
FT                   /old_locus_tag="KLTH-ORF10027"
FT   CDS_pept        complement(199706..200500)
FT                   /locus_tag="KLTH0E02222g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10027"
FT                   /product="KLTH0E02222p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DH88"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH88"
FT                   /protein_id="CAR23149.1"
FT                   /translation="MSNQSLPQMQGVQVLPSLNMRGGGAVNAAPGTGGATAQQQQQQQQ
FT                   QQHQHQQQLQAAVQPPQPQLQTGLVPHGALSAQGQHPGGLALPHPGQPLSMPYIPQVGP
FT                   HLGLSLGALGGVSGVSGAVNGVRVTSSSATPQPPGAGAGPAAGAAGGAAADARASEGEH
FT                   LDNSTGQLIGKSGKPLRNTKRAAQNRNAQKAFRQRRERYIKDLEVKAKEYDRMDAQTAA
FT                   LVQENESLKRYVLELEQRLGVRRAASTVGLPHEAHPAIKPPE"
FT   gene            complement(<200939..>201328)
FT                   /locus_tag="KLTH0E02244g"
FT   CDS_pept        complement(200939..201328)
FT                   /locus_tag="KLTH0E02244g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0E02244p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH89"
FT                   /protein_id="CAR23150.1"
FT                   /translation="MYRDSHFQSHHMLRSHHVLYLDWNNDVFTAPDQPVSNAPRAGSSA
FT                   LPINPFWDYFHDDDDWDRFHPLQVDCSGQLTAMPPLVPTPTALGSLFAPRRAELGAWRD
FT                   TGDLTSADLADRDPDAQAQGQGPDA"
FT   gene            <201608..>201680
FT                   /locus_tag="KLTH0E02266r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.3"
FT   tRNA            201608..201680
FT                   /locus_tag="KLTH0E02266r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.3"
FT                   /note="tRNA-Ala (CGC) cove score=68.35"
FT   gene            <201991..>202062
FT                   /locus_tag="KLTH0E02288r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.4"
FT   tRNA            201991..202062
FT                   /locus_tag="KLTH0E02288r"
FT                   /old_locus_tag="Klth0E.tAla.CGC.4"
FT                   /note="tRNA-Ala (CGC) cove score=79.87"
FT   gene            <202124..>203809
FT                   /locus_tag="KLTH0E02310g"
FT   CDS_pept        202124..203809
FT                   /locus_tag="KLTH0E02310g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0E02310p"
FT                   /note="some similarities with uniprot|Q99234 Saccharomyces
FT                   cerevisiae YOR030W DFG16 Probable multiple transmembrane
FT                   protein involved in invasive growth upon nitrogen
FT                   starvation"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH90"
FT                   /protein_id="CAR23151.1"
FT                   /translation="MLSSRHVRIAWARCGSLQLLTHLSRAHPRCCTPRTPLSPPPPPHS
FT                   RLSRAMLRYAEDNTEGYQDGLETLLNLLRIEMGSDRWANCSVRMLNSGNLLLRNASTGQ
FT                   MCNRSSSSPSFFVWCADNSTLEYKALVDVLRNHTLPTFGVQIEKDGFSAGCLMASFILC
FT                   IVCAGSWMLLLVLLLLPANNHNHRKKMVYLGVVYQAIWHTVILDRSMDTVFEEQYMGNY
FT                   QNAGALYDNVMTSTLYSVMLFFATVISNLNWLDIVYYMFHNYRKTNSSWVPRLFNNRNK
FT                   RIIAVGVALTCAQAVLKAVKLWGARRYVGTVDVVLRSVDFTIYTLFSLSVAYYVWHDFG
FT                   FTLEPQKQQRARSWRALFVFIWNDYHETVLLLFYNAVVMASLYMCTILIMTMPRHVFTW
FT                   MQSLISFLNVLVTVNTWGLIGVLERRERTLSKETVLGRKINNRDKFFVDPKVDYDHGDG
FT                   LVVSDDLGLAPDAATVQNSVHRRFGLDPVLRPAKVLRSKLAAKRRRGENASRSRHEGST
FT                   FEIQSMRHSIGERRASADQDWAQGGDNESAETLLTRNYIYDHDG"
FT   gene            <204114..>204184
FT                   /locus_tag="KLTH0E02332r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.5"
FT   tRNA            204114..204184
FT                   /locus_tag="KLTH0E02332r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.5"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            <204306..>205139
FT                   /locus_tag="KLTH0E02354g"
FT                   /old_locus_tag="KLTH-ORF10013"
FT   CDS_pept        204306..205139
FT                   /locus_tag="KLTH0E02354g"
FT                   /gene_family="HOG000065942" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10013"
FT                   /product="KLTH0E02354p"
FT                   /note="weakly similar to uniprot|Q12331 Saccharomyces
FT                   cerevisiae YDR262W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH91"
FT                   /protein_id="CAR23152.1"
FT                   /translation="MKILNKPFSVGVLCTIPFLLACMVDGKNVANLDIVLDKQTGKLKR
FT                   QLPSLHARDGSLLRRDPKRLPLDLEDLFEGKLDKRSERETDRQEFFINHGQEGNADQGE
FT                   PSDPICLDSRIPSMNEISIFGSYLRDDITMSRIIEDPLEDVIIFAPSDSAIESLPLKPW
FT                   QFPADVSDIESGAEDEEAVDKLVSSNIRHFVNSHIATGTSIDKARSMKKCMGGSVVLRS
FT                   FAFEGDENSGDIMLKKKRGKYYVASSLDKKFQKVKRVERAQNGLILVIDATLISP"
FT   gene            complement(<205420..>207708)
FT                   /locus_tag="KLTH0E02376g"
FT                   /old_locus_tag="KLTH-ORF10010"
FT   CDS_pept        complement(205420..207708)
FT                   /locus_tag="KLTH0E02376g"
FT                   /gene_family="HOG000184675" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10010"
FT                   /product="KLTH0E02376p"
FT                   /note="some similarities with uniprot|Q12398 Saccharomyces
FT                   cerevisiae YOR032C HMS1 C2H2 zinc-finger protein with
FT                   similarity to myc-family transcription factors;
FT                   overexpression confers hyperfilamentous growth and
FT                   suppresses the pseudohyphal filamentation defect of a
FT                   diploid mep1 mep2 homozygous null mutant"
FT                   /db_xref="GOA:C5DH92"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH92"
FT                   /protein_id="CAR23153.1"
FT                   /translation="MTSMGFNSGFSEAEMFLATLQSEDSSDGDKSDYNGYGLLQESPDQ
FT                   SMGNYGAWNNKQEPNLTPESFHSGVADLAEPRAPTRPAQDVQAGPGGVSATPLQQISSF
FT                   GSSSSYANGFDVSAGVNAGAPDSAVRIKEDASPELSLEPHELRELLADGSHEAQAGSVG
FT                   GPGCSKVFKPKRERTSHNVIEKKYRTNINDKILQLRDIVPTLRVATKREAGLMITAEDH
FT                   EELDGLDPARKLNKASILVKTIEYIRHLENKCEAYKYENTKLRSGQAFTTPESDRHASA
FT                   GYSELAPTGIQQAPTQSTPYANAYPTTSKDMTSQFLMGGLALTMGASCFGEGNDYDNAK
FT                   GLMSLPVFHYSPASGFTMTNANGVINLPTALLSLFRIFLLFATAFHLLSSLALRFRQGK
FT                   DKTREFPVVQFADTVCLGTGLVDTLKKTMIINRLKYPVNSIERIESEIANCFALKLYNP
FT                   SFPLNVLAARHIDFTWSKIKEQVETANKRSKGALKNGIEWEMITNVLTTSKDDTLSRGQ
FT                   LLEALARKGTFTLEGLVEFINNFLVKTRNESVVVDLLEETCASERPIKEVVENVFETEV
FT                   FNNEKLQLSSDNFVMLRCLFENTESNIDSLLKLVKANTGLGSEKGFNHDQVLVLYSSIV
FT                   QNLISQNQLKQAYHWVSKISPELVNTEEVSIVGVAAVFLLLRSLRENDADENVQSIYPR
FT                   LESLSGKLRVWLGSATGGCLNLGLRGKLVDFCVDTTLKCGMTAAKELEEDTDVEEDLDE
FT                   VSDDEAGDL"
FT   gene            complement(<209336..>211333)
FT                   /locus_tag="KLTH0E02398g"
FT                   /old_locus_tag="KLTH-ORF10002"
FT   CDS_pept        complement(209336..211333)
FT                   /locus_tag="KLTH0E02398g"
FT                   /gene_family="HOG000112416" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF10002"
FT                   /product="KLTH0E02398p"
FT                   /note="some similarities with uniprot|P39875 Saccharomyces
FT                   cerevisiae YOR033C EXO1 5'-3' exonuclease and flap-
FT                   endonuclease involved in recombination double-strand break
FT                   repair and DNA mismatch repair member of the Rad2p nuclease
FT                   family with conserved N and I nuclease domains"
FT                   /db_xref="GOA:C5DH93"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH93"
FT                   /protein_id="CAR23154.1"
FT                   /translation="MGIQGLLPQLKPIQQPITLIRYDGQTLAIDGYAWLHRAAHSCAEE
FT                   LALGRPTSKYLEFFIKRLNMLRNRFNINPYLVFDGDAIMVKKDTELKRKQKRAENKERA
FT                   LALWKAGDKRQAYDYFQKCVDVTPEMAKCVIEYCQVQDIKYIVAPFEADAQMVYLEKKG
FT                   LVHGIISEDSDLLIFGCRKLITKLTDHGEGIEICRDDFPRLPSKFPLSQLCPEETRAMV
FT                   CLSGCDYTAGIPKIGLLTAMKLVRKHKTMDNIIKNIQREGKFVVPKEFLEEYQLASFAF
FT                   QFQRVYCPENGMMTTLSEIPEELRNCQALFSCIGKVISKSEHTKVVIVDDSEVDHHLHG
FT                   RIAAGELCPYNFQKILVNRERKLQLTTKSEPIIGKPLASQAGSIDTFFSKTASVSVSST
FT                   STGVTTQMRFAIKKQEEKLIENERKIASAVERRKLFRRDTPVVAGVGMSRYFGKSQDHP
FT                   TNEEKDVTSTMATPTPVEPLISPRLPDFTKASTNSNFASCSNESLGSQDEAATDIPSSL
FT                   LSTEVPSSMVPTQVDMESSPYSEEDSEVLSEIEDTAEARRDEKASNKRHCNSIADLRES
FT                   FSYHRAPLQDKSVNVASGNGLLRNSKGAKSHVSAVKAPSLGLNSHVGAVKAPSLGTKRP
FT                   RHYVASPSSATAPRQATRTLSLSDFIYRGQ"
FT   gene            complement(<211548..>213752)
FT                   /locus_tag="KLTH0E02420g"
FT                   /old_locus_tag="KLTH-ORF9999"
FT   CDS_pept        complement(211548..213752)
FT                   /locus_tag="KLTH0E02420g"
FT                   /gene_family="HOG000033883" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9999"
FT                   /product="KLTH0E02420p"
FT                   /note="similar to uniprot|P39010 Saccharomyces cerevisiae
FT                   YDR264C AKR1 Palmitoyl transferase involved in protein
FT                   palmitoylation acts as a negative regulator of pheromone
FT                   response pathway required for endocytosis of pheromone
FT                   receptors involved in cell shape control contains ankyrin
FT                   repeats"
FT                   /db_xref="GOA:C5DH94"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH94"
FT                   /protein_id="CAR23155.1"
FT                   /translation="MGTVEEGTESQTTNVDPNSQASVTSLEPIAPANSNPASTSDISLG
FT                   ANESSTHNQNPELQEYRDACQSGDLAKVKEMVELGLIDITHDYHEDEMVSGLHWASINN
FT                   RLGVAKYLVGKGADVNFKGGNLKATPLHWAARYGYVYIVDFLLESGADPTLTDHQGFNL
FT                   LHLSINSSNIMLVLYVLFFVVGDKISIDCVDPDNRTPILWAAYQGDSLSVKALLDFKAD
FT                   FRIADNGGFTPLHWATVKGQPQVLKHLIENGGDFLQNTNDNKNCFVISQEMRTEHSLTN
FT                   ALLESGFNAEGVPIIKLFKNPQHAKLLTFVTPWILVGLILKIMATLNTFVAITFTVLIG
FT                   WASTKILKKFVIPSYSLRQGGNAFLKTPFLAGLLFGSVIWVFYVWLTRVLPATVFDEPL
FT                   ANALFFVFLTVCLGLFGSLVLSDPGRITKEQELEPVRIAIKELLRIGKFDTRHFCVDTY
FT                   KRKPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLSLVSGVSCFFIACIE
FT                   YFDFLEDESKTDFKCGIFDDEICAGFHLDTFAFLVLSWTLIQAVWVFFLIAVQLFQTFK
FT                   GITNQELNSASRKRHARDSGNEFFTTTPTDLMDAEDLEALNQPALDSEEASQLKPRTCG
FT                   GVCFGLIGLDQIVLVVKGFFGGSRNLQLSHRPSHLSFETNYGWRTNLKDFWLLSDTTAP
FT                   LWQRLLYSQRGFKALLGGTEVDYQKLYTLPSPRFLADEMV"
FT   gene            complement(<213949..>216135)
FT                   /locus_tag="KLTH0E02442g"
FT                   /old_locus_tag="KLTH-ORF9996"
FT   CDS_pept        complement(213949..216135)
FT                   /locus_tag="KLTH0E02442g"
FT                   /gene_family="HOG000154315" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9996"
FT                   /product="KLTH0E02442p"
FT                   /note="similar to uniprot|P51534 Saccharomyces cerevisiae
FT                   YOR035C SHE4 Protein containing a UCS (UNC- 45/CRO1/SHE4)
FT                   domain binds to myosin motor domains to regulate myosin
FT                   function involved in endocytosis polarization of the actin
FT                   cytoskeleton and asymmetric mRNA localization"
FT                   /db_xref="GOA:C5DH95"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH95"
FT                   /protein_id="CAR23156.1"
FT                   /translation="MDVQKLAKRLNESCKVQIDAEDYIRGIDLIFEDSPAEKLEQGQIL
FT                   VRAFQDHSKSRQYLIEKVHSDVEKSLRVFQECDSGAISVLVDCFGNQTDSDTLVLEIKR
FT                   GLQDKRLNVVFLFTVMVQLLSKYHYNFVSLKFVIKEIILRCCEAEIRPLMLVIFAQLDK
FT                   GYKGEFEKYLLDIIGSLLIEADAEATDGSLLIVVELLTQLYPASTALCTSVFLGEEFQE
FT                   VSKRKLFKSDETLAFNLLTLLSVACVDETVRCYIADNYIDALGEGVKTEKFKAHSALVL
FT                   IKTWSFSKLKGMTVESLGRILIDALGKSEQHSEIAVEGLAYLTLKPSVKAMFLRDNDAL
FT                   LDLVSMLKSSQSAPIVSYGILVVVGNLSSKLEDLNSAEHSAHGLRAYADMKRLDQEEAE
FT                   GADAALSNEDIATFNRDIVIELNVLGISKAKLSSQSSGFRLQLVRIIHNLVSSKGLVAE
FT                   SVKQGSVTILLDALSSATTPENFKKLALRSLARTLVMINPELIFLRYSALNVLPFLFDL
FT                   IPDPEAPSAGVETTPRDSYEALLALTNLATLQDKSVCEKIISTPPYWSKIENLMLDTAV
FT                   EIQRSTLELLCNLMAGSLHLAAKFFNFENPRSVRNFNILAKLLNLEDLRSQLAVSAIFA
FT                   NVASSVPFIAQELASKKELLDNATEVLQKQCNETELRHRLIVFFDALASSSAEVRRSLS
FT                   HVSSLRNALLTARKYEANYPSDYLEALDSILGAH"
FT   gene            <216256..>217301
FT                   /locus_tag="KLTH0E02464g"
FT                   /old_locus_tag="Klth0E.mRNA.ld.289.p"
FT   CDS_pept        join(216256..216301,216358..217301)
FT                   /locus_tag="KLTH0E02464g"
FT                   /gene_family="HOG000180194" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.ld.289.p"
FT                   /product="KLTH0E02464p"
FT                   /note="similar to uniprot|Q05568 Saccharomyces cerevisiae
FT                   YDR265W PEX10 RING finger peroxisomal membrane peroxin
FT                   required for peroxisomal matrix protein import interacts
FT                   with Pex12p links ubiquitin-conjugating Pex4p to protein
FT                   import machinery mutations in human homolog cause a variety
FT                   of peroxisomal disorders"
FT                   /db_xref="GOA:C5DH96"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH96"
FT                   /protein_id="CAR23157.1"
FT                   /translation="MANSRKLEFADASAIVQSHQKDDQIESILTSKLADATRAIKGQYF
FT                   SNVYSKEISTCAKLLYLALTTLRGRRTLGEEYVDLLHVNRNGEKLPRMLQRLLFVLSHA
FT                   LIPYAYYKILGRLSRSKDAGGQNENGLQTPKSTLRKLLNTKTFQGVVNVSTDLNLLNFY
FT                   FKGAFYDISKRIFGLRYAVGHKISESEENFRSSSSKTYRLLGLVLLVQFVTRNVPPIVT
FT                   WLKKELIVSPLSDKTSSEIQNNASLVITGVPSKDIVNHVDLQDPAELSFIPSESRKCIL
FT                   CLSLMVDPSCAPCGHLFCWDCLLNWSKERPECPLCRQTCQTQSILPIR"
FT   gene            complement(<217352..>219211)
FT                   /locus_tag="KLTH0E02486g"
FT                   /old_locus_tag="KLTH-ORF9993"
FT   CDS_pept        complement(217352..219211)
FT                   /locus_tag="KLTH0E02486g"
FT                   /gene_family="HOG000248301" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9993"
FT                   /product="KLTH0E02486p"
FT                   /note="similar to uniprot|Q05580 Saccharomyces cerevisiae
FT                   YDR266C Hypothetical ORF"
FT                   /db_xref="GOA:C5DH97"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH97"
FT                   /protein_id="CAR23158.1"
FT                   /translation="MSTQPQQKRNFRRTQGAQSKPKKDLGKNGEQGWKRTFSQGREGGD
FT                   TASELDEEDICIICAEKIKYASISPCNHVTCNRCTFRQRALYNKRSCLVCRTESDLVIF
FT                   SADKKAAFGDINSQSLVDTNDKYGVSFTSKDAASATLNLLLFTCPFGDTGSTDYENFKK
FT                   YNAHLKNAHNKTICMICASHKKAFPSELRVYTPNQLRVHQSKGDSEGFKGHPMCGFCSG
FT                   QRFYSDDELNIHMRDRHERCHICDQENSASPRYFKDYDQLFEHFKFEHYICTVQSCLDS
FT                   KFVVFRDDLDLQAHILKEHGSILRNGNNNAALKGRKYQSQLSTFSRPSSRNSSTSDFGG
FT                   VSSKKEDPENSQEVKRLRMEERARHYLNYSHTDFEQFLAINESYKNKMITAQDVYSAYE
FT                   NLFKSPQANTALLLYDFSELFPKNTKFHQDLRAIYDSEQKKQDRFTNFPSLSNSSPSLL
FT                   AGNVVSGSWGRNGGTNKAARQFNFPALKKPSSPQPLLVPQKVSYSKPKSATPKVAPSLT
FT                   TRKSSSTESFYKPTYLDNKKASVAPSAAVDREKFPPLPKSQAKKFRAPLVNQPDIPDPS
FT                   QWGKTPPSSRQNSETSNRDTTDTASPIHVKKGKQKQLLFHIGI"
FT   gene            <219822..>220462
FT                   /locus_tag="KLTH0E02508g"
FT                   /old_locus_tag="Klth0E.mRNA.at.342.p"
FT   CDS_pept        join(219822..220022,220088..220462)
FT                   /locus_tag="KLTH0E02508g"
FT                   /gene_family="HOG000190506" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.at.342.p"
FT                   /product="KLTH0E02508p"
FT                   /note="similar to uniprot|P38812 Saccharomyces cerevisiae
FT                   YHR100C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR019001"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH98"
FT                   /protein_id="CAR23159.1"
FT                   /translation="MNVSATLNVLRLLQNPGLCIPQLTVGNFGQIPVPIGPSIKAVVLD
FT                   KDNCFAYPHSNEVWPDYEACKGKTWVELKKAYPGASLLIVSNSAGSSDDKDLKQARLLE
FT                   ETTGVPVLRHKVKKPGCRDEILSYFSGKKITNDPSEIAVVGDRLFTDIMMANLMGSYGV
FT                   WVRDGVKPSKNPIVHFEKLLFKWLTPGS"
FT   gene            complement(<221189..>232354)
FT                   /locus_tag="KLTH0E02530g"
FT                   /old_locus_tag="KLTH-ORF9985"
FT   CDS_pept        complement(221189..232354)
FT                   /locus_tag="KLTH0E02530g"
FT                   /gene_family="HOG000160814" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9985"
FT                   /product="KLTH0E02530p"
FT                   /note="similar to uniprot|P38811 Saccharomyces cerevisiae
FT                   YHR099W TRA1 Histone acetyltransferase component putative
FT                   ortholog of human TRRAP which is an essential cofactor of
FT                   c-Myc"
FT                   /db_xref="GOA:C5DH99"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DH99"
FT                   /protein_id="CAR23160.1"
FT                   /translation="MSYLERIEGLASRLREDNDLAKSLSTISEICEMVEPLGSSAEYEK
FT                   FLNSILPALMERLESTLYTLDVMSPQQKLRNSILEVLNRCIMNEAFEPFAVKYLDKLLV
FT                   VLQQDNEENGVLAMKIITGFFKSYKSALQERVTDFIDVIMKIYKHMPELVRQTFNDDLG
FT                   DNGALDLTGLDNTSEVLDPRGNGEAVQSSDTLAATSKPLKRSMFSFKVLSECPITMVTL
FT                   YSSYKQLTTSSLPQFMPLVIELLTMEADAQRKTREDFEAQGKRWISVSPNIKNRSAYCD
FT                   FILSQIKATSFLAYVFIRGYAAEYLQNYVGFVPDLILRLLQDCPAELSAARKELLHATR
FT                   HILSTNYKKLFLSKINLLFDEKVLIGNGFTSYETLRPLAYSTVADFVHNVRGDLQLDDI
FT                   EKTIKMYTGFLLDESLALTVQIMSAKLLLNLVERVLKLGKENPNDSVRSKKLLIVIVDA
FT                   YTTRFRNLNRQYDNLMKHHEEYEKEKMKKSATFRKELEKANEETENFIREMLRVKEPLK
FT                   QETDAEGDVKMEENVEGHTETSPNDEESEPDNEDTTIDVFDIKFKSPILLSSPPNSDPL
FT                   KDAFYLYRTLMSFLKTIIHDLKVFNPPSTEYTTMNPKVWTSLSRIFSHEEVVVFKDLFH
FT                   ECILGLQFFSSPEGKTVTDKKHFDIAAPSLPVSATKDGRELMDYFAIMFMQIDSPTFND
FT                   IVEAEIDFLYQAMLRDSALLHVAQSFLTSETTSPKFTGILLRFLKSKLSSLGNVDGNKS
FT                   NILIRLFKLSFMSVNLFPITNEIVLLPHLNDLILDSLKFSTTAEEPLVYLYLIRTLFRS
FT                   IGGGRFENLYRSIKPILQVLLQSLNRMILTARRPHERDLYVELCLTVPVRLSVLAPYLS
FT                   YLMKPLVFALQGFPELTTQGLRTLELCIDNLTAEYFDPIIEPVVEDVIRSLFKLLKPQP
FT                   FNHQISHTAVRILGKLGGRNRRFLKPHSDLRIAEELDIPVNATFRILGINDEVPLSITP
FT                   GVRSALDILQDYRGEAFYKKSAYNYLKSILQLFLKPSLAIPENYEEWIGGALKVLAQEV
FT                   VKPPVSQDTEDEKIRDKRLLNSQEMLLAKILEAVIFSASIEELKSEANDLFQNVVNHFC
FT                   FLQLNNALNKKMGETEKFSLDVKLPKVSIDTNIILDAISEGLSSYMEESRNISVSAVKQ
FT                   IFGTSERIYGSELSLKYSFIPLLVEKFIHQCYDEAYFKKSSGVLGIQTMIEEVNIPVSF
FT                   LKSYQFDLIAGLLFVLIDTPLEAPGIIRERARKLIISILASTCKNITEESLNEKGLQNT
FT                   LIDIVCELSNANEAVRSACQDALSTVSEVSGIPIVKLMSHSKNFLLSPIFAKPLRALPF
FT                   PMQIGNVDAIIYCLSLQGSFLEFNEELYRLLHEAIALVDAEDESLASAQRVTEYQTAEQ
FT                   LVQLRVVCIKLLSLALKNEEFASAQQGATRIRILAVFFKTMLKTSPKIIEATYQGLKSV
FT                   LAENSKLPKELLQNGLKPMLMNLSDHQKLTVSGLEALAKLLELLIAYFKVEIGKKLLDH
FT                   LDAWCRVEVLDMLFGKDLKEQTPTKIIYGIINIFHLLPPQADIFLNDLLLKVMLVEKKL
FT                   RLQLDSPFREPMAKYLNRFHSSVTSYFKNNLGSRDLVLLMCSIIQRPEANNLRQDFEQE
FT                   LNNFYDYYMTGISSNKVRVVSFFANVVEIFYSLERVKGDAWLVNNGSFLYKLRSMLKLT
FT                   LDIVEENDFHFDFLQLSQATGKVQDLHTRYLELNGNNPAKLFEFLEFAFTSGLKPSQSI
FT                   LSFIEKSVITTSEVETKKLYLHHALLFATSDKPFPATVFVLKNIVNSTLVYEGLTHKSL
FT                   NRLIKEDDGTQPPWLGLLCSKIWKGSSTILDSFAAGEYDTFRFELLQLSSVFTEYAADL
FT                   DPAIRKDIIRFCWNFIKLEDALVKQGAYMVTAYFIAKFEFPVKIVTQVFVALLRTSQIE
FT                   SRYMVKRSLDLLAPVMHERMASADPPNAWINWVRRVLSENNASQNSTLYQLLINHPDEF
FT                   FESRELFIASVINFVGKLTLMTNPNLENQTLVIDLAELILKWEKKAKESDGGDDSVDGN
FT                   ETKEIKQQETFGQREAFVTYLVRYVCVSNHRTSETELGFRTLKVLSEILSENYWPDVTV
FT                   KLNFFEKFLVQHDLSSSNVSFYCVNALDVLDVILRNKSASWIVSNLVLIQSLLDKCLRS
FT                   DHHDIQEALQKVLGKVLSAIKHTEESSLESDTETPSKLLLNTLISIITEDLQGTSSVAA
FT                   GVMLTWTLFMHFPQYVDSLLPSIMKTFSKLCKDHLATSQPKDPATLEESRITTKLLEKV
FT                   LYLLSMKVALLGDARRPFLSTVALLIDRSMDQNFLKKVIMIARTWVFTNEIFPTVKEKA
FT                   AILTKMLAFEVRGEPKLSRQFYEIILELFENKDFNNSEITVRMEQPFLVGTRVDDIYIR
FT                   KRLMAILDESLERDIKERLYYVIRDQNWEFIADYPWLNQALQLLYGAFDKDFSLDLRGA
FT                   YQLDQLGTALAEITIEKSDTEHEESPLHGLLERHKEFASNFSQVTCNDLVGPLIDIFYR
FT                   SPQAIHAAWINVFGAAYQSIPKNEKFGFVRSLVTLLSKDYHARQLNVRSNVVSTLLDSI
FT                   SETDSLELPPHLIKYLATSYNSWYQSIKILESLEESASLENAKIIETNEDALLELYVNL
FT                   QEEDMFYGLWRRRAKYTETNIALSFEQIGLWDKAQQLYEAAQVKARSGALPYSESEYSA
FT                   WEDNWIMCAEKLQHWDVLTELAKHEGFTDLLLECGWRVADWSADREALEQSVKSVMDVP
FT                   TPRRQIFETFLALQNFAETKKGDQEVKRLCDEGIQLSLHAWASMPERFTPAHKFLLHSF
FT                   QQYMEFLEATQVYANLASTSIQNLDTKAQEVKRVLQAWRDRLPNIWDDINMWNDLITWR
FT                   QHAFQVINNAYLPLVPALQQASNNSNVNTHAYRGYHEIAWVINRFAHVARKHNMPDVCI
FT                   SQLARIYTLPNIEIQEAFLKLREQAKCHYQNMNELTTGLDVISNTNLVYFGTVQKAEFF
FT                   TLKGMFLSKLRAHDEANQAFATAVQIDLNLAKAWAQWGFFNDRRLSEEPQNISFANNAI
FT                   SCYLQAAGLYNNSKTRKLLCRILWLIGIEDSTGTLAGAFESFRGEIPVWYWITFIPQLL
FT                   TSLSHKEANMVRQILIRIAKSYPQALHFQLRTTKEDFSVIQRQTMVAMGNSRLPNNKSP
FT                   ATASGTRQPWEYLDELNGILKTAYPLLALSLESLVDQINQKFKTTSDEDLFRLINVLLI
FT                   DATYNYNRLPFPRENPLLPASTETNLVRFSENLLPPHISVKFNADFIDSKPNFEEYIKR
FT                   LRYWRNRLENKLDRAPKIENMEKWCPHLSNFHHQKFEDIEIPGQYLLNKDSNAHFVKIS
FT                   RFLPHVEFVRGTHSSYRRLTIRGHDGSLHSFAVQYPAVRHSRREERMFQLFRLFNETLS
FT                   KNVQTRRRNVQFTLPISVPLSPQVRIMNDSSSNTTMHNLYDEYCDKKGIDRGAIQDFVC
FT                   QQLDAAYDKVLPPPEITAVKVEIFSSIQSMFLPSSVMKNYFTGLFTQFEDFWLFRKQFS
FT                   SQYAMFIFMTYMLAINNRAPHKISIDQVSGNVFTLEMLPARYPYERVKQTAKNFEADIP
FT                   PDSPVFHNNEAVPFRLTPNIQKLIGESALEGILSVNIFLVARALLEPDHELNTYLSLFI
FT                   RDEVISWYSNLHRSIVEDPQLREIVRTNVDLITRKTAQLGHLSSKPSVVTQYVLEAISA
FT                   AVSPRNLAKMDQSFMPYF"
FT   gene            complement(<233320..>234822)
FT                   /locus_tag="KLTH0E02552g"
FT                   /old_locus_tag="KLTH-ORF9981"
FT   CDS_pept        complement(233320..234822)
FT                   /locus_tag="KLTH0E02552g"
FT                   /gene_family="HOG000214987" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9981"
FT                   /product="KLTH0E02552p"
FT                   /note="similar to uniprot|P25346 YCR098C Saccharomyces
FT                   cerevisiae GIT1 Plasma membrane permease mediates uptake of
FT                   the phosphatidylinositol metabolite glycerophosphoinositol"
FT                   /db_xref="GOA:C5DHA0"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA0"
FT                   /protein_id="CAR23161.1"
FT                   /translation="MSETNRYVTYDADARKMRVNTSREKRLYNTFMIVAAGFALISDGY
FT                   QNNVMSMLNKVFPLEYGKHAYNGDVSTRVSNASLVGTILGQVTIGVACDYMGRKWAILV
FT                   ATLMLVGGSALCAASHGKTVSGMFWMLTVMRGVTGFGIGAEYPCCSVSANEAANEHSEK
FT                   KRGGIMVMVTNLPLSLGGPFANIIFLIVFSICGKNHLNALWRVMFALGCFWPLSVFYFR
FT                   WKTSTNTLFQKGQFKSQIPYWLTIKYTWKRLLGRCFVWFCYDFVAFSNSLFSGTIISLV
FT                   IKNGNDLKTIAEWNLLLGIIAVPGCFVGAWLCDRIGRKYTLMFGFSGYLVFGLIIGCAW
FT                   DKISKITALFIIFYGLMNGLANAGPGDMLGLVSSESFPTAVRGTCYGLSAAIGKVGAVV
FT                   GTECFTPIKDRLGIRWVFIIAALCGVAGIIATWLLIPHLLESDLMEQDINFHNFLVKHG
FT                   WSGTMGFDTEDRLENKNSDADETADSLNKDLNPEIITREISV"
FT   gene            complement(<235174..>235246)
FT                   /locus_tag="KLTH0E02574r"
FT                   /old_locus_tag="Klth0E.tMet.CAT.30"
FT   tRNA            complement(235174..235246)
FT                   /locus_tag="KLTH0E02574r"
FT                   /old_locus_tag="Klth0E.tMet.CAT.30"
FT                   /note="tRNA-Met (CAT) cove score=73.94"
FT   gene            <235803..>237593
FT                   /locus_tag="KLTH0E02596g"
FT                   /old_locus_tag="KLTH-ORF9978"
FT   CDS_pept        235803..237593
FT                   /locus_tag="KLTH0E02596g"
FT                   /gene_family="HOG000141723" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9978"
FT                   /product="KLTH0E02596p"
FT                   /note="weakly similar to uniprot|Q66RD4 Saccharomyces
FT                   cerevisiae YDR349C YPS7 Putative GPI-anchored aspartic
FT                   protease located in the cytoplasm and endoplasmic
FT                   reticulum"
FT                   /db_xref="GOA:C5DHA1"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA1"
FT                   /protein_id="CAR23162.1"
FT                   /translation="MLIFAVFVFAVALVRGASQSSSENSIDSFPVLTANRDRAGLYYVN
FT                   ASFGTPGQSQKLRIDLVQPYMWVFSEDMRQARQNRSARAKAETYYNASKSSTHEKLNGD
FT                   KIWSMHFMDHIAFNGTTVMDEVSFMWSSTSSSSDVATGDSNTTQDFSSANTSRISDKSF
FT                   SFLSANEVAAYIQQGALGLAGRAAQTGYDNDSSDFDSSYVLLDRLVDESLIYTSSFSMW
FT                   MGADTRDPLESPEPSNGCGKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGYPIIP
FT                   LTKVNVQSKSGETKNMTSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRW
FT                   LLACDVGRLGASIIFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPST
FT                   ASGFNVLGGAFIKNVYMAAELESNQVALAQAQKVSSVTTTSSTAELSPTPTSSKSEEGG
FT                   DDAASHLSYFNLKPAKTISAIKSGMIPFATTNNLTSFQTMMLSDKATMSTSPNTRLFNQ
FT                   FTATISSDGVIFTGRSFYNTTNDVSVSSTTSASFALSETTSKSNAARTNFPLQSVGGSG
FT                   LSMHFYSVTVLLISAAIFAL"
FT   gene            <237948..>240656
FT                   /locus_tag="KLTH0E02618g"
FT                   /old_locus_tag="KLTH-ORF9976"
FT   CDS_pept        237948..240656
FT                   /locus_tag="KLTH0E02618g"
FT                   /gene_family="HOG000141722" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9976"
FT                   /product="KLTH0E02618p"
FT                   /note="similar to uniprot|P38810 Saccharomyces cerevisiae
FT                   YHR098C SFB3 Member of the Sec24p family forms a complex
FT                   with Sec23p that is involved in sorting of Pma1p into COPII
FT                   vesicles peripheral ER membrane protein potential Cdc28p
FT                   substrate"
FT                   /db_xref="GOA:C5DHA2"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA2"
FT                   /protein_id="CAR23163.1"
FT                   /translation="MQRLNQSLSSLSLDRDSPSPIGVTRKNKRPNRAFHSFATDSYGLP
FT                   DPQASAQNNFQPLAASNLGNISGNQASNFRVPFPSPSQRVSSGGPAESITSHYVPKQRL
FT                   EDQQRYLTRSFVTSQDSVPPCVSTQYYCIDQGISDPRKLCLTMYNVPRNEQLRSATKLP
FT                   VGAIIQPFAASVPDTAIDIIDASQRNGPLRCRRCRSYSNPNYSFTFDSKAVCNFCQVST
FT                   QLSEEHYAPLNPNGLRADINERPDLTKGTVEFLVPDTYNTVPGKPNIPLHYVFLVDIST
FT                   LSNENKSSLAMVEGIRTCIEHISAKQPNCKVAIMAFDKEIRFFNLRPELNQAQEYIISD
FT                   LQDVFVPIFTGLFVRPEESMHVIQDTLCKITAYIEDGKFSHHFEACYGSALKAARLALD
FT                   TVTGGAGGKILASLSSKPTHGIGNLRLRNEDALKKTLKCENEAYVKLGQELLKNNISLD
FT                   LFCTGSAFMDMVSVAQPVKVTSGILKYYPGFQLDKDEFTFVNDLLHSVANTVGYAGQLK
FT                   VRCSSGLSVYNYYSESVENSDREPVIPVLHQDTTVNVLFKYDGRLPPAKDVHFQCALLY
FT                   TDLNGARKVRCLNASAAVSDNIHEIFKFINQDAVVGIVLHDMLTTLDDCNFVQKRKTID
FT                   DKIVDVLTQYRALVSKSSSSQLVLPDSLKTWAAYLLSFEKSELMKNNNKSANGNSRVYD
FT                   MFKYLNFTPAQLVFKLYPQILPLHELLQESDYTFYDENELLLQAAPLENLCVRASRSEL
FT                   VDGGCYLIFDGTTAYLWFNENTNTYLLRDLLDVDTDSVKHSEIALIGNAIPTLDSGINL
FT                   KARSVLRNWAQVSGRSYVPVSPLRPHVDVYYSHTMAALLVEDRSIEMIEAYDAYLVSLH
FT                   KRINEKVKREDYTKVGNPKDHEHITQKFIQF"
FT   gene            <241007..>241273
FT                   /locus_tag="KLTH0E02640g"
FT                   /old_locus_tag="KLTH-ORF9975"
FT   CDS_pept        241007..241273
FT                   /locus_tag="KLTH0E02640g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9975"
FT                   /product="KLTH0E02640p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA3"
FT                   /protein_id="CAR23164.1"
FT                   /translation="MMRRSNSEKSSARRMSSNNPFRNASVESEASQYQSDKDFQEWVSS
FT                   NTIYHPSGSRPKNSSMLSLTESIEEEPHRMASPSASLPREPYR"
FT   gene            <241639..>242844
FT                   /locus_tag="KLTH0E02662g"
FT                   /old_locus_tag="KLTH-ORF9974"
FT   CDS_pept        241639..242844
FT                   /locus_tag="KLTH0E02662g"
FT                   /gene_family="HOG000246727" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9974"
FT                   /product="KLTH0E02662p"
FT                   /note="weakly similar to uniprot|Q66RD5 Saccharomyces
FT                   cerevisiae YDR348C Protein of unknown function green
FT                   fluorescent protein (GFP)-fusion protein localizes to the
FT                   cell periphery and bud neck potential Cdc28p substrate"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA4"
FT                   /protein_id="CAR23165.1"
FT                   /translation="MTPPPRPASNNPFLDDMSPQSGSESPEEDYSPPQPTNGNGGGAGS
FT                   AYPTAQEEKNRLRRRYIEQPSISDPVVDDLPPSYDEVAAVSKKPAAPYPREKSSSRYAS
FT                   SSTRSSDRRESSERSAHRRHRDGSERTHHSSSRRHREAGTHSSDRRKSSKDKKSSSSSK
FT                   PLAKNVDTIDKLDVTGLFGGAFHHDGPFDACTPHRNRNTKVAPVMAFPADGPNSSIAGA
FT                   ANSKSPMKEVFGQEANDDDDAYLYGNKIYSRGNNSSTNTIGAIKPNMNGVTQFDVKAKN
FT                   LVHGPTTVGLGSTTFLDGAPATGAANSNNRLHPQHLSSSQMKKVPSQKSGNGDYAASGD
FT                   VYRREPLKLAKTHSGHLENDEDSPDEDVYLSTRFDPSAKKSSTSGNKFMRRVKSLKVGR
FT                   KS"
FT   gene            complement(<243196..>244116)
FT                   /locus_tag="KLTH0E02684g"
FT                   /old_locus_tag="KLTH-ORF9969"
FT   CDS_pept        complement(243196..244116)
FT                   /locus_tag="KLTH0E02684g"
FT                   /gene_family="HOG000001062" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9969"
FT                   /product="KLTH0E02684p"
FT                   /note="similar to uniprot|P10662 Saccharomyces cerevisiae
FT                   YDR347W MRP1 Mitochondrial ribosomal protein of the small
FT                   subunit MRP1 exhibits genetic interactions with PET122
FT                   encoding a COX3-specific translational activator and with
FT                   PET123 encoding a small subunit mitochondrial ribosomal
FT                   protein"
FT                   /db_xref="GOA:C5DHA5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA5"
FT                   /protein_id="CAR23166.1"
FT                   /translation="MLRYSLVPRTLARSYIAPSLEHLARGKGVRGLFSEKGLQTAWFDR
FT                   ADFYTENLNKYMGQSEEKPLENIVYENAKSASKRDIFNNASMLYNLRFALSCLRANDLP
FT                   SVTEKPGPQSLLATPSLELKFSNDPRDNGNEKLSAALASSFGSLVEFRSLLLNSNRAIS
FT                   GDGFTWLVARKVQSMHHESVISGTVEFDWLYVLNTYNAGSPFNFNRVGHMSDLKKQLSK
FT                   LQTVEETPSSNPFQMKSVEEARETESYRDITYVPLLAIDASPKAWITDYGVFGKDLYLE
FT                   RVWESIEWNVVEQRLPTRAPNYQLS"
FT   gene            <244394..>244465
FT                   /locus_tag="KLTH0E02706r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.6"
FT   tRNA            244394..244465
FT                   /locus_tag="KLTH0E02706r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.6"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            <244900..>246144
FT                   /locus_tag="KLTH0E02728g"
FT                   /old_locus_tag="KLTH-ORF9965"
FT   CDS_pept        244900..246144
FT                   /locus_tag="KLTH0E02728g"
FT                   /gene_family="HOG000176056" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9965"
FT                   /product="KLTH0E02728p"
FT                   /note="similar to uniprot|Q05515 Saccharomyces cerevisiae
FT                   YDR346C SVF1 Protein with a potential role in cell survival
FT                   pathways required for the diauxic growth shift expression
FT                   in mammalian cells increases survival under conditions
FT                   inducing apoptosis"
FT                   /db_xref="GOA:C5DHA6"
FT                   /db_xref="InterPro:IPR013931"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA6"
FT                   /protein_id="CAR23167.1"
FT                   /translation="MLKWIQGGISAVTGIAEPEYGKDFIHPVTGQVKDKQPFHVAERED
FT                   FHWLSPTHTNVETMTFYFTDLKQGYIGFAQVIHSNVVGIHTTAQFTFRLYNVKEPKLNV
FT                   WTSTKLANFRIDGPNFYADDLSIEMNEAGSQVRFQSSVNPASVVDLTFERAVPGVKVGA
FT                   NGTTYYGDNLEQPWGSMRHVFWPRNFCHGTLKVKPELDSESDTEAEKEVPVQEIVFEKG
FT                   APVFSMFVMALQGMKPHHAAKAWNFLNFQSETHSAVLMEFTTPKSYANTKICVGILCDK
FT                   KDIIAVTIDNNFEHLDTKIDSVGWPVPHKIDVSFKGVKSDVSDEEVATASPVTALASGP
FT                   LEQLVERVDVMSEIPSFVKNIVSGVAGTKPYIYQYANDFSLRVDDAAPVSGTGWCEITF
FT                   ISEAEEVTEESYSET"
FT   gene            <248224..>249927
FT                   /locus_tag="KLTH0E02750g"
FT                   /old_locus_tag="KLTH-ORF9958"
FT   CDS_pept        248224..249927
FT                   /locus_tag="KLTH0E02750g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9958"
FT                   /product="KLTH0E02750p"
FT                   /note="highly similar to uniprot|P32466 Saccharomyces
FT                   cerevisiae YDR345C HXT3 Low affinity glucose transporter of
FT                   the major facilitator superfamily expression is induced in
FT                   low or high glucose conditions"
FT                   /db_xref="GOA:C5DHA7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA7"
FT                   /protein_id="CAR23168.1"
FT                   /translation="MSSSPEIGPSKSVSDDQGSHNSNVMNAPAPKLNREESHDEIDALK
FT                   KDAEQQLASKGSSDFVFVSMCCLMVAFGGFVFGWDTGTISGFVQQTDFLRRFGQKHSDG
FT                   THYLSNVRTGLIVAIFNIGCAIGGIVLGKLGEVYGRRLGLTIVVIIYSVGIIIQIASID
FT                   KWYQYFIGRIISGLGVGAITILSPMLISEVSPKHLRGTLVSCYQFMVTGGIFLGYCTNY
FT                   GTKRYSNSVQWRVPLGLCFAWALFMIGGMVFVPESPRFLVEAGRLEEARRSLARVNKAS
FT                   LEDAVVTLELENIEASVEAEKMAGKASWAELITGKPQMFKRTLNGIIIMSLQQLTGDNY
FT                   FFYYGTTIFKAVGMTDSFETAIVFGVVNFFCTSLSLYTVDRFGRRNCLIYGAIGMVACY
FT                   VVYASVGVTRLYPEGANHPDISSKGAGNCLIVFACFYIFCFATTWAPIAYVLISETYPL
FT                   RVKGKAMSIASACNWIWGFLIAFFTPFITSAINFYYGYVFMGCMVFAIFYVFFFIPETK
FT                   GLTLEEVNDMYAEGVLPWKSASWVPASRRGADYNADDLMHDDKPWYKRFF"
FT   gene            <252118..>253833
FT                   /locus_tag="KLTH0E02772g"
FT                   /old_locus_tag="KLTH-ORF9946"
FT   CDS_pept        252118..253833
FT                   /locus_tag="KLTH0E02772g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9946"
FT                   /product="KLTH0E02772p"
FT                   /note="highly similar to uniprot|P39003 Saccharomyces
FT                   cerevisiae YDR343C HXT6 High-affinity glucose transporter
FT                   of the major facilitator superfamily nearly identical to
FT                   Hxt7p expressed at high basal levels relative to other HXTs
FT                   repression of expression by high glucose requires SNF3"
FT                   /db_xref="GOA:C5DHA8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA8"
FT                   /protein_id="CAR23169.1"
FT                   /translation="MSSAPYQQETAATATPVDLHSTVSNGSQLSTPSNKASRDELKAAN
FT                   MAEDAADQVEIPKKPASAYVTVVILCLMVAFGGFVFGWDTGTISGFVNQSDFLRRFGQK
FT                   HSDGTHYLSNVRMGLIVAIFNIGCAFGGIILSKIGDVYGRRIGLMAVVVIYVVGIIIQI
FT                   ASIDKWYQYFIGRIISGLGVGGIAVLSPMLISETAPKHLRGAMVACYQLMITAGIFLGY
FT                   CTNYGVKNYSNSVQWRVPLGLCFAWALFMITGMSFVPESPRYLIENGRIEDAKRSLAKS
FT                   NKVTVEDPAILVEVDLILAGVEAERLAGSASIKELFSTKTKVLQRLIMGIMIQSLQQLT
FT                   GDNYFFYYGTTIFKAVGLSDSFQTSIVIGIVNFASTFVSLVTVEKFGRRGCMLWGSAAM
FT                   VACFVVYASVGVTKLYPNGADHPEVTNKGAGNCMICFTCFYIFCFATTWAPIAYVVVSE
FT                   SFPLRVKSKCMAIATASNWLWGFLIAFFTPFITSAIHFYYGYVFMGCLVFAYFYVFFFV
FT                   PETKGLTLEEVQELWEEGVLPWKSTSWVPSSRRGKDYNVEELKHDDKPWYRRVV"
FT   gene            complement(<254093..>254998)
FT                   /locus_tag="KLTH0E02794g"
FT                   /old_locus_tag="KLTH-ORF9941"
FT   CDS_pept        complement(254093..254998)
FT                   /locus_tag="KLTH0E02794g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9941"
FT                   /product="KLTH0E02794p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHA9"
FT                   /protein_id="CAR23170.1"
FT                   /translation="MQAAQHPDSGSPRSEGLVDRIFDGLKHGGPPWTRHYGKSNIANGS
FT                   AAPRLSRSGNLKRSLRKAKMVLDGSRFGSSRQNRKKASSERPLNHLSFFSRGLQGSFSW
FT                   DSGSCIGSEGAAVSDADAPSTTLPTEINTKSDEDKENFQRQSAAPGGPASFHSPLQPLP
FT                   IDLKQYVTGYEIKSGNSEAFSEGPAPGPVSAPLKIAFSTLVSDVLRENRNWINELALAR
FT                   RQKPWKFSKKSKMESDAFLEFLERLESLLKFESAFIEELHLRQDTLHEENTLLRHQLVA
FT                   VRGVGLENHDIMPCVTSNSV"
FT   gene            <255428..>257365
FT                   /locus_tag="KLTH0E02816g"
FT                   /old_locus_tag="KLTH-ORF9940"
FT   CDS_pept        255428..257365
FT                   /locus_tag="KLTH0E02816g"
FT                   /gene_family="HOG000247211" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9940"
FT                   /product="KLTH0E02816p"
FT                   /note="highly similar to uniprot|Q05506 Saccharomyces
FT                   cerevisiae YDR341C Cytoplasmic arginyl-tRNA synthetase"
FT                   /db_xref="GOA:C5DHB0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015945"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB0"
FT                   /protein_id="CAR23171.1"
FT                   /translation="MLRRAVNFVAISRSFQVRLKQHRIWRLQGLRYFSHQPEIMSATSI
FT                   TSQLQKLSIQEPPALEGSFPNVNVVDLMRNFISVELSKISGVDTQLIYPALEWTNTLER
FT                   GDLLIPVPRLRIKGSNPKDLATEWAEKFPLGNFLTKVEANGPFVQFFFKPDFLFKVVLP
FT                   DILTRKEEYGSAPLVQNKKVVIEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEKMGWDVV
FT                   RLNYLGDWGKQFGVLAVGFERYGDEEALSKDPIKHLYDVYVRVNQDITAEGDSLPEDKS
FT                   TDGQARAYFKKMEDGDENALKIWKRFRELSIEKYIDTYARLNIKYDSYSGESQASRESM
FT                   QLALDMFREKGLTHEDRGALLIDLTKFNKKLGKTIVQKSDGTTLYMTRDVGTAMDRHKK
FT                   YNFDKMIYVIACQQDLYTAQLFEVLKQLGFGWAKDLQHVNFGMVQGMSTRKGTVVFLDN
FT                   ILEETKEKMHEVMKTNKAKYAQIENPDEVADLVGISAVMIQDMQAKRINNYEFKWERMT
FT                   SFEGDTGPYLQYAHSRLRSVERNASEITQEKMVNADFSLLHEPAAVLLVRLLAQYPDVL
FT                   RNAIKTHEPATVVTYLFKLTHQVSSCYDVLWVAGQTPELAAARLALYASARQVLYNGMT
FT                   LLGLTPVDRM"
FT   gene            <257955..>258058
FT                   /locus_tag="KLTH0E02838r"
FT                   /old_locus_tag="Klth0E.tSer.GCT.7"
FT   tRNA            join(257955..257991,258014..258058)
FT                   /locus_tag="KLTH0E02838r"
FT                   /old_locus_tag="Klth0E.tSer.GCT.7"
FT                   /note="tRNA-Ser (GCT) cove"
FT   gene            <258370..>258939
FT                   /locus_tag="KLTH0E02860g"
FT                   /old_locus_tag="KLTH-ORF9936"
FT   CDS_pept        258370..258939
FT                   /locus_tag="KLTH0E02860g"
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9936"
FT                   /product="KLTH0E02860p"
FT                   /note="highly similar to uniprot|Q05498 Saccharomyces
FT                   cerevisiae YDR339C Protein required for cell viability"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB1"
FT                   /protein_id="CAR23172.1"
FT                   /translation="MGKAKKTRKFALVKRTLNAKKDVRLKANQAKEAHRDDPELTKNVP
FT                   QISSALFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCIPMITDCVMA
FT                   ELEKLGPKYRIALKLARDPRIQRLTCSHKGTYADDCLVNRVLQHKCYIVATNDAGLKQR
FT                   IRKVPGIPLMSVGGHAYVIEKLPDVF"
FT   gene            complement(<258995..>259561)
FT                   /locus_tag="KLTH0E02882g"
FT                   /old_locus_tag="KLTH-ORF9933"
FT   CDS_pept        complement(258995..259561)
FT                   /locus_tag="KLTH0E02882g"
FT                   /gene_family="HOG000176500" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9933"
FT                   /product="KLTH0E02882p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB2"
FT                   /protein_id="CAR23173.1"
FT                   /translation="MNPLLFPLKYVAKKVFGEVEIGGKAEDPFFEEVEFQKRSFWSGST
FT                   KIVKKRRDKSVPEFVPEADSKILRRVRKRAYRLDMKFHLCGVRFGWIGVIGLLPVIGDL
FT                   FVLWLSLQVYREASKISGGLPPAEAARMITNICVDFGLGLVPIVGDFVSVAYKANSRNV
FT                   LVLEKYLTHKYNRVRVPAPAATQRI"
FT   gene            <259875..>260672
FT                   /locus_tag="KLTH0E02904g"
FT                   /old_locus_tag="KLTH-ORF9930"
FT   CDS_pept        259875..260672
FT                   /locus_tag="KLTH0E02904g"
FT                   /gene_family="HOG000000883" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9930"
FT                   /product="KLTH0E02904p"
FT                   /note="similar to uniprot|P38806 Saccharomyces cerevisiae
FT                   YHR090C YNG2 Yeast homolog of mammalian Ing1 NuA4 histone
FT                   acetyltransferase complex component"
FT                   /db_xref="GOA:C5DHB3"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB3"
FT                   /protein_id="CAR23174.1"
FT                   /translation="MDPSSALEQTTHDVSNLQAEFRYILDEIKNADLRVYEQRKKYVQR
FT                   DAQVQKFVKQHGSGTENPREGELSQKIERELQDCVESQRGKCVLANTALFLVSKHLSKL
FT                   EKTIRVLEGDNLLAPAEEDKETESGGDNSRESSVMSGERRRKATPTAAVVAPKRKRRAD
FT                   STPVPRQKDSTPGGGSDANFDLQDYNDDLFSGYNQAEEDDKQLYCFCQSVSYGEMVACD
FT                   GPNCKYEWFHYTCVNLKEPPKGAWYCPDCRQELANTRLKKRKA"
FT   gene            <260858..>262939
FT                   /locus_tag="KLTH0E02926g"
FT                   /old_locus_tag="KLTH-ORF9927"
FT   CDS_pept        260858..262939
FT                   /locus_tag="KLTH0E02926g"
FT                   /gene_family="HOG000177026" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9927"
FT                   /product="KLTH0E02926p"
FT                   /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
FT                   YDR338C Hypothetical ORF"
FT                   /db_xref="GOA:C5DHB4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB4"
FT                   /protein_id="CAR23175.1"
FT                   /translation="MATMFSKSLAQVHPKLLTNGIGIGNNHRRISLGFLKPSKRNPLVR
FT                   KYTRTRRRYGPDQQSFRSLGEDFGSTVARETPLDAVDEEDERHSEDGGELSRTVSLPSR
FT                   VSETPDLQPEVDWILEEHERRYSSVHASDDEEEEEAPHHEPRNMYSHPYYGNDEEQHQE
FT                   EVLEYDDFMKRVRQQLIYDVRKRQRSPSFVPVTSRGSVPNVYESTQDEEDYSHESVSYE
FT                   SEAKMLASYAFPLILTFLLEQIFPLVCSLTVGHLGKNELAAVSLASMTTNITLAVFEGI
FT                   STSLDTLCPQAFGAGNYRGVGIHLQRCIAFSMVVFIPFGFMWHFSEFFLGFVVPDKALV
FT                   ALTSKFLKIATLGAPAYIIFENLKRFLQAQGIFDAGIYVLLICAPLNVVTSYTLVWNSR
FT                   IGLGYIGAPIAMVLNFWLMLTLMLLYIIFVNGRKCWGGFNKKAFTHWKDLSHLAIPGII
FT                   MLEAEDLSYEILTLFSSYFGTTYLAAQSAVSTTAALMYMIPFAVGISSSTRIANFIGAK
FT                   RPDCARIASELGISCSFLVGIFNFTVLMTGRKVIAHVFSNDELVVKQITKLLPLVAFIE
FT                   IFDSLNAIAGSCLRGQGMQAIGSIINLVVYYLVAIPLGVLLGWTFNLKLYGLWIGIGTG
FT                   MFLIGVTEAYLVLSPNWEKILERAEMLKEADDEESDEEFEYSDSDSEPSETTGLLPVR"
FT   gene            <263206..>264675
FT                   /locus_tag="KLTH0E02948g"
FT                   /old_locus_tag="KLTH-ORF9924"
FT   CDS_pept        263206..264675
FT                   /locus_tag="KLTH0E02948g"
FT                   /gene_family="HOG000246301" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9924"
FT                   /product="KLTH0E02948p"
FT                   /note="weakly similar to uniprot|P08465 Saccharomyces
FT                   cerevisiae YNL277W MET2 L-homoserine-O-acetyltransferase"
FT                   /db_xref="GOA:C5DHB5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB5"
FT                   /protein_id="CAR23176.1"
FT                   /translation="MLLKTYPSLIRGLHRSLPRCSRSSNPAMQFPCLDKMEERSAQLKK
FT                   NTISCSSTDLTSSPNNEPVYGKVRSGFQIFKSNSPLFLDYGGVLPNFQIAYETWGTLNS
FT                   DRSNAVLVHTGLSASSHAKSSESNLQPGWWEKFIGPGNPVLDTDKLFVICTNILGGCYG
FT                   STGPSSPDPADGAPYATRFPMLSVQDIIRGQQELVKECLGIDKLYASVGSSMGGMQSLA
FT                   YAQQFPEAVEKVVTVSACARSHPSSIAMRHAQRQVLMADPHWSRGFYYPTEAEPNKILP
FT                   HVGMKLAREIATVTYRSGPEWESRFGTERLDDERTPVLCPDFLIETYLDHQGEKFSLEY
FT                   DPNSFLYLSKTMDLFDLSQSHQERSQRRRKEAFEQHRHQQVGNLTARLSDEPYEPVKRR
FT                   RTTTVEEAREDLRVGMESIRGKNVLVIGVKSDGLFPYWQQREIVDLLGGGPEVEHVELD
FT                   ESQSLYGHDTFLLDLEHVGGSIGKFLMKSFD"
FT   gene            complement(<264820..>265695)
FT                   /locus_tag="KLTH0E02970g"
FT                   /old_locus_tag="KLTH-ORF9922"
FT   CDS_pept        complement(264820..265695)
FT                   /locus_tag="KLTH0E02970g"
FT                   /gene_family="HOG000248865" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9922"
FT                   /product="KLTH0E02970p"
FT                   /note="similar to uniprot|P21771 Saccharomyces cerevisiae
FT                   YDR337W MRPS28 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="GOA:C5DHB6"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB6"
FT                   /protein_id="CAR23177.1"
FT                   /translation="MKLPLAGLQRQWVIPQVAQVRMFASSRPCGGHKAVKFLKAQRKRQ
FT                   VNQAKQLKLKTALDTIDPVFGRSSTPFIVRVMAEMKEPKVLAQGYENQEVEKLLAAVEA
FT                   AKREQIELSGFNNASLVPGASENDPEGLASKRESIMRILSMRNASNKDAMKLVVRQARE
FT                   EFQRFEGDTGSSEVQAAIMTVRIQNLAKHIQENKNDHKNTRILRMLVQQRQNILRYLKR
FT                   DKPERYFWTIQKLGLSDNAVVSEFNMDRRYMQDYKFFGDRILIKDSKKVADQKRRDLRK
FT                   QKRSARRAQL"
FT   gene            complement(<267098..>270199)
FT                   /locus_tag="KLTH0E02992g"
FT                   /old_locus_tag="KLTH-ORF9919"
FT   CDS_pept        complement(267098..270199)
FT                   /locus_tag="KLTH0E02992g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9919"
FT                   /product="KLTH0E02992p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB7"
FT                   /protein_id="CAR23178.1"
FT                   /translation="MLNESLMDVFGILNDRSGPTDEARVYKQLWELLKRDPTSIHALLS
FT                   HEFMNRPIEELAGCVAQECLEKRLVCLCVLDFRLRSGCVLPSPSDALSSIFSTVSMVQA
FT                   DPQATNACFRILSTVLAFAESTQTVGLRQCDVDCISSEHLVSENAAVLMDYVYLALTHP
FT                   WISESEAQQWLSELYRSGVFWWLRQKLQSTAKLDFLETLFEDTMKRAYNSFIQTMQTFL
FT                   RAQGIAKEWQFCGASKFSELFDPMVLKNCVEDALAALKIQPRTRDAGTAPRLLAHLSKR
FT                   PIQSRDFWQGIMLDRPALDLMWISPSRDMFTHASKTYMHEFAKLQCDIKNFILRINSRY
FT                   SISHGKLTGNSKYATSAYELGQDPVTKSWFIKVAKTFAPEAQVEKWGNIQGKRLCLSRL
FT                   DGAFFVVQVASVHKVGDMLQLFIGTENVSGLQNCQLLSVLSTELEFQVKAVDDLLKFNL
FT                   ENERLQAMTPMTNLVRSSCPSKTVILSNLFSDEQQIKNFLHENTESVKQKPSKRRLVPV
FT                   KEAISLDLEKGKWAIEKAVKNSPKHDFTLEQIESVIHGVCESASCVNGDVGTGKATIIA
FT                   AIIDNLHLNSFYKRFPQMCSRFLIVCDTDETCQKIASYLSIIQPQSVVHYSNDTSSLIE
FT                   KKKKGVKEALSRVQEIASILRIPGDHSSSVPAALSFLQHFLEPMLHDYRASIKTNDEIS
FT                   KRAFPLLEDGVLTSPSSEMAERIIETSYQVAVMYDQLQKWQFLFLNGDLEKTLTEACDL
FT                   LLISKDRFQKCLVDKKLSFNSFESLVICNADFFEPSEIWRALSLNTHWQRTIFSGDFTN
FT                   SPLPYVARQLFSSKSLQFRLTTSYNTNREVLRIRFPYEEQPDPVPVLYSPVQVIKTPGK
FT                   IVNNINWDEAEYCVLLYAYLRLAGYPAKVISIIALNPYQKYAIDTELEDWLQLEPSHKD
FT                   IKKPSSISSLENNRSHRNDIVIISTAGIQPNVPFLSRYARRGLLVLSAAGDDLQIVAGE
FT                   SFPSVKSDKREARRIQNLDQLKGLVDSLLCSKRPRKQSRKTHNE"
FT   gene            <270908..>271543
FT                   /locus_tag="KLTH0E03014g"
FT                   /old_locus_tag="KLTH-ORF9916"
FT   CDS_pept        270908..271543
FT                   /locus_tag="KLTH0E03014g"
FT                   /gene_family="HOG000280804" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9916"
FT                   /product="KLTH0E03014p"
FT                   /note="some similarities with uniprot|P28007 Saccharomyces
FT                   cerevisiae YHR089C GAR1 Protein component of the H/ACA
FT                   snoRNP pseudouridylase complex involved in the modification
FT                   and cleavage of the 18S pre-rRNA"
FT                   /db_xref="GOA:C5DHB8"
FT                   /db_xref="InterPro:IPR007504"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR021154"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB8"
FT                   /protein_id="CAR23179.1"
FT                   /translation="MSFRGGNRGGRGGFGGRGGFGGRGGRGGFGGRPMQQGPPDSVLEM
FT                   GSFLHPCEDEIVCRSINTKIPYFNAPIYLQNKTQVGKVDEILGPLNEVFFTIKCSEGVQ
FT                   ATSFKDGDKFYIAPDKLLPIERFLPKPKVAGPPKPKKKRAPGAPGGRGGRGGARGGFSR
FT                   GGSRGGFGGGRGGSRGGFGGPRGGSRGGFSRGGGRGGFSRGGGRGGRF"
FT   gene            complement(<271665..>272726)
FT                   /locus_tag="KLTH0E03036g"
FT                   /old_locus_tag="KLTH-ORF9913"
FT   CDS_pept        complement(271665..272726)
FT                   /locus_tag="KLTH0E03036g"
FT                   /gene_family="HOG000065937" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9913"
FT                   /product="KLTH0E03036p"
FT                   /note="similar to uniprot|Q05473 Saccharomyces cerevisiae
FT                   YDR336W Hypothetical ORF"
FT                   /db_xref="GOA:C5DHB9"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHB9"
FT                   /protein_id="CAR23180.1"
FT                   /translation="MLKVHRVSQLLRGYRIKAGTRNTANTQWRNKNLENNDTDSNPNKS
FT                   SLDGGEQQISRDIKDRGAFITALHEKYNSDYKRPSKSDLSSVNHFFNSARVRYEWSAST
FT                   FLDIPGERLKQEAEKNVLTQASHEVEIGPTSDDTKGDKRIKKRFGKTDGIPFELLNGLP
FT                   EVAFLGRCNAGKSTLLNNITTQFSHVKLNEYAKASKKAGFTKTVNCFNIGGRFRIIDTP
FT                   GYGGKSTQEQGDVTMRYLRERQELKRCFLLVSAEQGFATTDSQVVDFLTKFGIPFEVIF
FT                   TKMDKIKDVSQLENVIEDSGVLELPTLPQMIFLNSETNKRYPKRYGIDALRSLILESCG
FT                   LEPNAKPSKTREK"
FT   gene            complement(<272968..>276630)
FT                   /locus_tag="KLTH0E03058g"
FT                   /old_locus_tag="KLTH-ORF9911"
FT   CDS_pept        complement(272968..276630)
FT                   /locus_tag="KLTH0E03058g"
FT                   /gene_family="HOG000248154" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9911"
FT                   /product="KLTH0E03058p"
FT                   /note="highly similar to uniprot|P52918 Saccharomyces
FT                   cerevisiae YDR335W MSN5 Karyopherin involved in nuclear
FT                   import and export shown to be responsible for nuclear
FT                   import of replication protein A and for export of several
FT                   proteins including Swi6p Far1p and Pho4p cargo dissociation
FT                   involves binding to RanGTP"
FT                   /db_xref="GOA:C5DHC0"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC0"
FT                   /protein_id="CAR23181.1"
FT                   /translation="MDENGASQVVGALEAIYSPKSDNARRLEAQKFLDEVKMHEESPLW
FT                   GYEIALNNPGNSILKHYGLGLLAFAIKRRWADYDQNRRIALRKWVVELNYRVQESDPRY
FT                   IKEKLAFLWVEVAKCVWGEALKDDDPTDQQLEESWVGMDNDLSALWQLSEASRELTLII
FT                   FRTLFEDVFLVEDLTVLKRISVIQPLCVMVISPMDVFTARYRFTDKWTLFKSNGNGWFE
FT                   HWVSELRAALTVGNSVYVVRLLETLKTCLNWPLSEIMIRNDVCGLLLECLLSNIPKAQS
FT                   MALDSLHILLTRPYNDESHYQTVINRVFSSMDLLDKVYDNLQFDPNEIDEQKYPIVKKF
FT                   VDMVSCLYTCVFKTDEDEATIQKYLRLVLRTTFNPSLIVSGLTLDLWCSCLRNDDFLPA
FT                   LEGSIIPELLQFSADALIYYEQIENHVSKKFADIDFQSKSEFQSFCSTYRKRIRDIIRL
FT                   ISCVQLDFAYDWLNARLNSYFSSPFGQQVLSSQFLDHKTEPYLSSLSQLMVVECFINGC
FT                   IRWKIWFPDTSSYNTKLNEILVKIETLSDQLIALNLKEPLLLKKQIQNFALFLTMLKDN
FT                   VLLKLLEKIITSATLDYPNVDLDEKNEHSDAVRDLRYACGIELNRMAILMPDSLGKIYD
FT                   DLQNVVAGIMPKLSYHEKISFKSFLLTIVLKSSLGEKEERFTLIVDPELSAWSDKSTVV
FT                   GLTDLPWFMERLGIVQISEYFQKRGISENVDLLSIPIDEEGKQLKTQLSKRWQTLFPVR
FT                   ATRMFVHYSMQSIKNDEEFEVLQALWKPRVIPILPYIMRLLYQLQSYHDPENWRDLPVI
FT                   VQSFVKCSTIERFWEAGASNKSKDEFIDEHMKAMQTLRDFADSVGHIVRYTREYVLLVI
FT                   SAISSLGSVFYEIEELPQMLMDSIAIYKPATGEISPGVSTHGWKHIINVAIRPLLKNCP
FT                   PRSAKKFMTTFLPKLFDTLDALLCKKWSVYMNDIDVNPSPRDDDEMTEEILEENLLRQL
FT                   TTVVVRLLIDCVGQVGTNSQASKMKLNSHQIEMRKIIFGNSEVMASFLKLLNHLMSFRD
FT                   SKCSFNSILVMKSCLVDTLIKNESVDQFFTTEIMPNLLLNVLTQNAFKDSLYEGLYVFT
FT                   VIFLTLCKEYKSSIQYLCQLSNGFDVESLYESVRSVENYKSQRALMVEFIDWIKTVNGN
FT                   NMEDQDDDDKRRQEKRQILLERANERLIKKNKEQKDILDDPNTEDGAFGSLFTS"
FT   gene            complement(<277387..>278463)
FT                   /locus_tag="KLTH0E03080g"
FT                   /old_locus_tag="KLTH-ORF9908"
FT   CDS_pept        complement(277387..278463)
FT                   /locus_tag="KLTH0E03080g"
FT                   /gene_family="HOG000152322" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9908"
FT                   /product="KLTH0E03080p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC1"
FT                   /protein_id="CAR23182.1"
FT                   /translation="MSIYRTVLNDDYSWPGPLSQLPLKIDPSMIEKLDPEYVEFFNEVL
FT                   CERPDILETHKYPVAQTKAGGNVIPGQSPPKEMAKIYEIEIPRKYTSADTSIPARVFVP
FT                   KGNKPASGWPCTIWYHGGGWVLGSISTENSYCTHLADLAKCVVITVDYRLAPEFPFPAC
FT                   VDDAFEALLFVMENAAKLDVDNTKVCPAGSSAGGNLAAVMTHKYASSELSGGLPPLKFQ
FT                   MMVVPVTDNTATGETQLSWKENEKTPQLPATKMLWYRKIYLPEAGHTLSHPESSPLFHK
FT                   GDSFRNVPPAFIAAAECDVLRSEAEAYHAKLREHGIESKLVIYRGVPHTAMVMDNRLSQ
FT                   GAKLVRDTILSIRDALYS"
FT   gene            <278921..>280168
FT                   /locus_tag="KLTH0E03102g"
FT                   /old_locus_tag="KLTH-ORF9907"
FT   CDS_pept        278921..280168
FT                   /locus_tag="KLTH0E03102g"
FT                   /gene_family="HOG000171043" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9907"
FT                   /product="KLTH0E03102p"
FT                   /note="similar to uniprot|P53095 Saccharomyces cerevisiae
FT                   YGL196W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC2"
FT                   /protein_id="CAR23183.1"
FT                   /translation="MSYPYQFTSRSSKQELLSAYYGKDLSDLPTPSLVVDRSVFKKNCE
FT                   KMLMNAEHLHADFRAHVKTHKTVEGTLLQLGSDERRTDKIVVSTLMEAWGLLPLIEKGL
FT                   INDVLFSLPVVKSRLSELAALSERVPNLRLMLDNREQLQVLSEFSESFTFQKKWSVFIK
FT                   INMGTDRAGFSDDFTLKETLCDLLKSPLKDYVSLYGFYCHAGHSYASSTEEQAKSYLLN
FT                   EITSGNAACKKALEVDPSLKLQLSVGATPTAHASEMLKVSSLGKLYGRLELHAGNYPFC
FT                   DLQQISTNCINSKQVSCKVLAEVVSSYPGRGLKAPGEQLVNAGVIALAREFGPLPGYGR
FT                   LSCPEEYENWIVGRLSQEHGILTPLKERETAMIPLGTKVQIIPQHSCITAASYPWYFII
FT                   DNGDSVVDIWVPWRGW"
FT   gene            complement(<280411..>283056)
FT                   /locus_tag="KLTH0E03124g"
FT                   /old_locus_tag="KLTH-ORF9906"
FT   CDS_pept        complement(280411..283056)
FT                   /locus_tag="KLTH0E03124g"
FT                   /gene_family="HOG000247841" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9906"
FT                   /product="KLTH0E03124p"
FT                   /note="weakly similar to uniprot|Q12139 Saccharomyces
FT                   cerevisiae YPR022C Hypothetical ORF"
FT                   /db_xref="GOA:C5DHC3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC3"
FT                   /protein_id="CAR23184.1"
FT                   /translation="MTEKKRKRGSGPFYCPFPGCFKSFSRSDHLGRHRANHSSQKFKCE
FT                   WPACEREFSRLDVKKKHFARHLKNSNEGFDRTSFLYDNERNPNTDDKNDKLDLTIMQGS
FT                   SSEQKMNGKKPRGSSILPPKSNGVGSVLENTDTTHTESNASSGPVTGNKKISPEELEEN
FT                   LAFTNDSAGEGGVVDNFSSTPTHSESLGLPTTLKNQKNCSTYIPQTNEAFQEVEGSNLP
FT                   GFFKPPGMGSSSTFQGIQWLLGHSPKTTSATGRHSNHPENGAFHGHYESPLELSSLSVL
FT                   EEIFSFSPEFPNAESQTSVDDEMLIEMAKCIPSVKNHPDFVAQKLEWFLEVYWLLYHSQ
FT                   YPILHRPSFSAHDTPPLLLTSMIMMGASLSKRTIEAVHIQLVDPDGLSGMIAGPLRWLI
FT                   FSSEQAKPPCKSWVIQSLIILETYEITSSSRCLHERACIYNGAKVQLLRRSPILGGDPL
FT                   KEVGSDTSRSQNLWSTWIESESMKRVALMSFYIDSVHAIIFGHPLNLLANQIKLSLPCP
FT                   DDLWEYNNIDRNKAPLSVAQTPLFCDAIKKLLQREEIEVGPFSMQILLAGLINLFLQIE
FT                   QNLSQWSSFGWKSIQDSWRSTICSAIDFWKTQIPSKNCCSTFSSVYHLNCTSAVNRPLP
FT                   PLLSSEDTRCSCPIYHAAQISTRMTHYDYIVFAGAPGRMNVAILDEDYEVVEQRIGKWA
FT                   ESQVGRLCVINSLILLCEVLLSPENSLEAVSYLYEPDKDPFLYRPNIVVSAVLSLWAYA
FT                   YYVLGSESSFRSANSTFQIQEGCTPAMEDAPTYLSRIRGELKSLTDKPFYTLNQMDTSE
FT                   YSDTITVYAQELPNVKNLNYMVGLLTSLRNGYNKCQWQVGREYAKLLDNCIQRSLGSEN
FT                   VFCQDMYDVK"
FT   gene            <283871..>285379
FT                   /locus_tag="KLTH0E03146g"
FT                   /old_locus_tag="KLTH-ORF9904"
FT   CDS_pept        283871..285379
FT                   /locus_tag="KLTH0E03146g"
FT                   /gene_family="HOG000185732" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9904"
FT                   /product="KLTH0E03146p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DHC4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC4"
FT                   /protein_id="CAR23185.1"
FT                   /translation="MSVKLQENYEETPLDVKGSACLRGSISERETFSSEHNVLFDASLE
FT                   KSVCWKFDVRILPMIAVMYLFNALDKGNISNAKTDHIDKDLSIEGQQWNNMLSIFYIPF
FT                   VLFAFPLSLVIKKYNAANVIPILMFIFGSISLLSATAFNYGSLMAARWFLGICESAFFS
FT                   GIIYYLSTFYRRHELARRLSIFYAAANIANAFSGLLSFGVFQIKNSKLKGWQILFLIEG
FT                   SLTVTFAVVAFLYLPRSPEKSHFLTGDEKECAKWRIEVDSSAKSEERISFTDAVKVFKH
FT                   PIAIAWMVQEILIGVPLNSINNWFPQIVQSLGKGTVQTNLYTVAPNVWGAIALIILSFS
FT                   SDYARIRSVFIMIGVSVTLIGFVVFGCVDTKSHLGAAYFSCFLMTTGSSVSSVLTSTWY
FT                   NNNTPNENRRVVISAVGVPLANAAGLISTNIFRPKDAPKYLPALGITAGFGGAAILLVA
FT                   GILCYMIFDNHRRNKRQGIKLTYKDVPTSELAEGPSNPNYRWMY"
FT   gene            complement(<285658..>286104)
FT                   /locus_tag="KLTH0E03168g"
FT                   /old_locus_tag="KLTH-ORF9902"
FT   CDS_pept        complement(285658..286104)
FT                   /locus_tag="KLTH0E03168g"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9902"
FT                   /product="KLTH0E03168p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC5"
FT                   /protein_id="CAR23186.1"
FT                   /translation="MAQFILQVPTFIYQLHDLGTSIMVAKKITWESIEGKEHPTLSPAF
FT                   VSNGHVFTSGIIGSKYGTGEVSQQIEDQVHLAIQNLENVLAVAGSSLEQVFKVTMFISH
FT                   AEYSKVVNEIYGQYFPQKPARSCVVVAFMDAAIKYELEAVATLE"
FT   mobile_element  287262..290045
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLTH0E03190t"
FT                   /old_locus_tag="dnatranposon.6"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            complement(<290159..>291568)
FT                   /locus_tag="KLTH0E03212g"
FT                   /old_locus_tag="KLTH-ORF9895"
FT   CDS_pept        complement(290159..291568)
FT                   /locus_tag="KLTH0E03212g"
FT                   /gene_family="HOG000241290" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9895"
FT                   /product="KLTH0E03212p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DHC6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC6"
FT                   /protein_id="CAR23187.1"
FT                   /translation="MYKAPSRLLSKRCVCVKLDLKNITRSFNNTCVAASCEDMTVESPL
FT                   KIQSGRLNQTILESGDRFGAAFRWGEKFHEFGMKRLAGTKEDGAARDWFIEECKYLGCK
FT                   IKVDKIGNIFATYPGKNGGKPTAAGSHLDTQPEAGKYDGILGVLAGLEVLRTFKENKFV
FT                   PNYDICVVCWFNEEGARYAHSCMGSTVWAQNMPIQEAYEMKSINEEKPESVYESLKNIG
FT                   YIGDAAASYKENELDAHFELHIEQGPVLEGEKKEIGIVTGVQAYHWERITVGGVSAHAG
FT                   TTPWRLRRDALLMASKMILAAADVAKRHGGLFTCGVIDVKPYSINIIPSEAIFTIDFRH
FT                   HLDEKMSEIINETKVEFDKLVKEGKTAYKDEVLLTSKAVKFHDVCIDCVTKSALAQFDE
FT                   SKVMQLYSGAGHDSCQTSSRIPTSMIFIPSKDGLSHNYYEYSSPEEVENGFKVLLQAIV
FT                   NYDELRLRRGY"
FT   gene            complement(<293162..>294727)
FT                   /locus_tag="KLTH0E03234g"
FT                   /old_locus_tag="KLTH-ORF9893"
FT   CDS_pept        complement(293162..294727)
FT                   /locus_tag="KLTH0E03234g"
FT                   /gene_family="HOG000171758" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9893"
FT                   /product="KLTH0E03234p"
FT                   /note="similar to uniprot|P15365 Saccharomyces cerevisiae
FT                   YJR152W DAL5 Allantoin permease;ureidosuccinate permease;
FT                   expression is constitutive but sensitive to nitrogen
FT                   catabolite repression"
FT                   /db_xref="GOA:C5DHC7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC7"
FT                   /protein_id="CAR23188.1"
FT                   /translation="MLSQFKPNSPVFEMEKSCEKQHKVMTSSEEVALGEFEEGPLCSKA
FT                   GVDLGMEAAQESMGLQVDEVTNKRLLRKADCYICTMMSVVYAVQYMDKQTNSYASIMGL
FT                   RKDLKMHGNQYSWVGTCFYLGYMIFEIPSSLALQRFPIAKVSAVFIVLWGFVLCMTSLP
FT                   KNYASFIATRTVLGILESAVTPAFMLLTSQWYRREEQFLRTSIWSASAGLGAILGSLIA
FT                   YGLAVRDPSSLPIASWRLLYVVLGVVTIVLGVAFFFVPDTPASAWFLTKEERLLTVERI
FT                   RSNKQGFGNRHFKKNQLREVFMDIRTYIYFATMVAAEIPNGGIGNFGSIMLTDMGYNSK
FT                   RALLMGTPFGAVEFGGIILVGYIAQKKQKRMAAAFFSYCLNIVSGCLLAFPSNTNAQLA
FT                   GYYLQGMAVIGWICFISCVSSNTAGHTKKVVTSAICMIGYCVGNLIGPQTFKSAEAPHY
FT                   KSAKIAIVVCFVICLFLTVLLYCINVRANKIRDEKNEKLDSSFVNSEFADLTDFENPEF
FT                   RYSL"
FT   gene            complement(<294997..>297021)
FT                   /locus_tag="KLTH0E03256g"
FT                   /old_locus_tag="KLTH-ORF9892"
FT   CDS_pept        complement(294997..297021)
FT                   /locus_tag="KLTH0E03256g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9892"
FT                   /product="KLTH0E03256p"
FT                   /note="weakly similar to uniprot|P39529 Saccharomyces
FT                   cerevisiae YJL206C Hypothetical ORF"
FT                   /db_xref="GOA:C5DHC8"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC8"
FT                   /protein_id="CAR23189.1"
FT                   /translation="MPPEKVAKERKRSKKACQRCSAQKVKCLGEKPPCRACVLSKNQDN
FT                   CIFPVKPRKITVLDTDVYQMEQKLQKLQSECSRLKGLAAAATCEPSEEAEDLDPLYHGP
FT                   TICTDSPGKSSGSNVAGSPSCQIFIGNLQWRILGDATKQKFDERATNNNTSMAAEEGRN
FT                   CLKRIHLNDRVINTKEAFEAPVLPLKAYALEMVHTVFNFFAREYGLFSKAGFEARLNET
FT                   YKHPNSQDSDWLAYLMITFAVGEQYMNEAGLKNQIPGMCYYISALKYFHEPIEEPNLDS
FT                   VRTLILIAFYSQGLNRMNSVYAYTGLALSTAVAQGIHRQANNHQFPRAEQEARKKIWWT
FT                   AFLMDTLWASRLGLPPHFNSCDIDIELPDESMSTEDGFDPKYLIANTHLALLVRSVMRE
FT                   VYGATRESFVENVFCNLKRLEIFMASLKPELKTYTTVAKDNRSTANLHLRYNQLIILTV
FT                   RPLYLSLLKDPKKRTEEIDRAIIKCTEAAAANVGILCTLFESKCFSAFGFLEAQCCFSS
FT                   ILILIMAVLDGHSFSELPVAVSLNSFMSNIGNITAIDNHCRLRTLIEVLPRSQNHSTTA
FT                   TAKSSVQSSAKPNSKTTPPAETNSRIKSTVTEFSNKFHVQDTCSTATCQSGKWPLDPEL
FT                   EFLGNLDECSNGFEQLTPETASNISSNLGKWDSFISKRS"
FT   gene            complement(<297218..>298024)
FT                   /locus_tag="KLTH0E03278g"
FT                   /old_locus_tag="KLTH-ORF9889"
FT   CDS_pept        complement(297218..298024)
FT                   /locus_tag="KLTH0E03278g"
FT                   /gene_family="HOG000180646" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9889"
FT                   /product="KLTH0E03278p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DHC9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHC9"
FT                   /protein_id="CAR23190.1"
FT                   /translation="MPSGNPVLDSATRKSLKAPVFNNLYEKRAWMLEHMAGVLRIFGRK
FT                   GYNEGCAGHVTIVDPVDPTSYWINPVGVHFSMITVRDLVHVNAKGEAIGGSEAPFSLPG
FT                   FKIHSQMHKARPEISSICHAHTFYARTFSVFGKKLEMMSQDSCLVHNNYALMADYSGVG
FT                   LDEVEGDKVSKALGDKMAILLQNHGLMTVGKTVDEAGYLLILLENMCKAQLLADAAAGN
FT                   SAALKHIIPDNVAKSAFDVISGPDSLYAALQPDYELEVYLSKGDFL"
FT   LTR             299273..299419
FT                   /locus_tag="KLTH0E03300t"
FT                   /old_locus_tag="Klth0E.LTR.1"
FT   LTR             complement(300008..300424)
FT                   /locus_tag="KLTH0E03322t"
FT                   /old_locus_tag="Klth0E.LTR.2"
FT   gene            complement(<300629..>301930)
FT                   /locus_tag="KLTH0E03344g"
FT                   /old_locus_tag="KLTH-ORF9887"
FT   CDS_pept        complement(300629..301930)
FT                   /locus_tag="KLTH0E03344g"
FT                   /gene_family="HOG000241290" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9887"
FT                   /product="KLTH0E03344p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DHD0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD0"
FT                   /protein_id="CAR23191.1"
FT                   /translation="MRNQSKCHSLKIKKGRLNQTIIDTGERFGGVERWGNKPHEFGMRR
FT                   LAGTSADGAMRNWFVRECRSLGCDIKVDQIGNIFAIFRGREKGKPTAIGSHLDTQPQAG
FT                   KYDGILGVLAGLEVLRTFKENDFVPHYDVCVIVWFNEEGARFTRYCMGSSVWAGTLDLE
FT                   EAYGMLSVTDVKRESVRDSLLNIGYLGDAPASYLENGIDAHYELHIEQGPVLEDEEKKI
FT                   GVVTGVQACYWEKFTVFGIGAHAGTTPWRLRKDALNVALRMIIKAEEVARKFGGLFTCG
FT                   MIDVRPYSANIIPSEASFTLDYRHDFDETLFKMLEEAKASFSQLVESEEMSYKSERLAY
FT                   TPVVNFNPACVKCVSKSALSLFREIAVKNMQSGAGHDSCQVSTRVPTSMIFVPSKDGLS
FT                   HNYREHTSPEDVESGLEVLLGAVINHDTLRAERL"
FT   gene            <302895..>303683
FT                   /locus_tag="KLTH0E03366g"
FT                   /old_locus_tag="KLTH-ORF9884"
FT   CDS_pept        302895..303683
FT                   /locus_tag="KLTH0E03366g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9884"
FT                   /product="KLTH0E03366p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD1"
FT                   /protein_id="CAR23192.1"
FT                   /translation="MSIEFENHVISTEGQLKSRFKYLLECAYLKFFKVTTGDERNPFAF
FT                   TGDDKVDNMLESLARLKNDAETRRSEIQKLEVERQRNRKNIGQAVCDYSMPIVEENLDA
FT                   SESESSLSAIDDVNKPNRRTIKRKRVLEPPWNLPLLNHIRNSLPDTSLMADQLNLGLTN
FT                   SIAQAAEDRKRKDRELDTQQERLELDTQQERLELELQRQKMDMKRQEVDLKLQEMKLKS
FT                   QEAQKLIQLLELAGKSDGVERLCPRLTFLLQEKLDSLFKS"
FT   gene            <304078..>305088
FT                   /pseudo
FT                   /locus_tag="KLTH0E03388g"
FT                   /old_locus_tag="pseudo-Klth0E-304078-305088"
FT   gene            complement(<305592..>306473)
FT                   /locus_tag="KLTH0E03410g"
FT                   /old_locus_tag="KLTH-ORF9878"
FT   CDS_pept        complement(305592..306473)
FT                   /locus_tag="KLTH0E03410g"
FT                   /gene_family="HOG000172062" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9878"
FT                   /product="KLTH0E03410p"
FT                   /note="highly similar to uniprot|P38805 Saccharomyces
FT                   cerevisiae YHR088W RPF1 Nucleolar protein involved in the
FT                   assembly of the large ribosomal subunit contains a
FT                   sigma(70)-like motif which is thought to bind RNA"
FT                   /db_xref="GOA:C5DHD2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD2"
FT                   /protein_id="CAR23193.1"
FT                   /translation="MAPDELRIRNKMKRQELFAEVKDQKNKERHKMRKQRAKEERENPE
FT                   LKEKRLKENVTNTIDSLRVYDETIHQEVEGDEADFAQFFNNGTEPPKILLTTNVNAKKK
FT                   AYEFANVLIEILPNVTFVKRKFGYKLKEIVEFCSNRNYTDLVIINEDKKKVTGLTFIHL
FT                   PEGPSFYFKISSYVDVQKIVGHGRATSHIPELILNNFQTRLGNTVGRLFQSIFPKNPDF
FT                   EGRQVITLHNQRDYIFFRRHRYVFRNEEKVGLQELGPQFTMKLLRLQHGIKEETEWEHT
FT                   ADMDKEKKKFYL"
FT   gene            <308140..>310341
FT                   /locus_tag="KLTH0E03432g"
FT                   /old_locus_tag="KLTH-ORF9872"
FT   CDS_pept        308140..310341
FT                   /locus_tag="KLTH0E03432g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9872"
FT                   /product="KLTH0E03432p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DHD3"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD3"
FT                   /protein_id="CAR23194.1"
FT                   /translation="MATQMESPLLDPLSGVDRESQSSNMASPVQFIKEYIERTLNTPPG
FT                   FPVSVAAEHYKRQRLVEEIVESETEYVQMLKILRNCFLDVLSINDYIPMKVLNNVVGQI
FT                   LAHHEELCRCLQAVVDGSVKRFDETTELNWSDLSLTSWDHLEVCQQVAEILSTHAVQAK
FT                   QYCSYLYYYNQISHLLARMGRESEDGLLFAILFRIELCLPKYYSHTSHQGYKRDFSFRA
FT                   MIQMPINRIAKYRLFLESLVYLTETPSITDLRRLDETKCQALIHSIKTSLGSMYSNLQK
FT                   VDEANCEKLPDPALVLVYNRLTFSSPDERIPVEAMGNCYTRGCLAVAWTCMDEAAHSAG
FT                   SHRKSSARYFNNFHRAKRSLRIESEQLGVFLFKSYLIFAEIPSFKLGTASYEWPIKFAI
FT                   RLASCRLMDARPAVQRALQGGMKDCGIYSEYENAIKLQFEYDFKLWEILLLCWDSQELE
FT                   AWRKELSLFINEINGPHTFGVDPLRETVSQSALESTLHFSDSTTFPDQMLPFMVYNENL
FT                   SGRFDRTRAFKRGLSTRAGQCYEGQTVEVAVEFRNADVDMSPSSTWFLRGSSSRVNCTT
FT                   LASSSTCAFVEASTGVSSTPDAEAISINERCREQRDSSAPCAVLSRWRRGEIERAMRDV
FT                   WSSHLNLQAADIITTVAGASTGTSIYDDTLGSLRALLRTASDNCVAVTGTQSTPVKSSC
FT                   AQPPAPPARAATRWSIKRVFSRRRRGSQSVVRHQNALKR"
FT   gene            complement(<310411..>310737)
FT                   /locus_tag="KLTH0E03454g"
FT                   /old_locus_tag="KLTH-ORF9869"
FT   CDS_pept        complement(310411..310737)
FT                   /locus_tag="KLTH0E03454g"
FT                   /gene_family="HOG000216667" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9869"
FT                   /product="KLTH0E03454p"
FT                   /note="similar to uniprot|P38804 Saccharomyces cerevisiae
FT                   YHR087W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD4"
FT                   /protein_id="CAR23195.1"
FT                   /translation="MAATKYFYKGEETDLVIFVESQELADQYLKDPTIGKLTEAVGVFK
FT                   IFTNQQGEGAEGELGEASKAQIENEFGKGIKIEEAIARILQEGSPNARGDVNKDKFQSR
FT                   NDSK"
FT   gene            complement(<311391..>315815)
FT                   /locus_tag="KLTH0E03476g"
FT                   /old_locus_tag="KLTH-ORF9867"
FT   CDS_pept        complement(311391..315815)
FT                   /locus_tag="KLTH0E03476g"
FT                   /gene_family="HOG000186095" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9867"
FT                   /product="KLTH0E03476p"
FT                   /note="some similarities with uniprot|Q05471 Saccharomyces
FT                   cerevisiae YDR334W SWR1 Swi2/Snf2-related ATPase component
FT                   of the SWR1 complex required for the incorporation of Htz1p
FT                   into chromatin"
FT                   /db_xref="GOA:C5DHD5"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD5"
FT                   /protein_id="CAR23196.1"
FT                   /translation="MTVAPNIDEQIADLKFNYEVLINELFHLKEFTSLVEYDPCFRNSS
FT                   ESFEHFVKTSGLGLSKPAIEAVEDASASRRVRRRQSRRETIPEASCSESVEGLIDERFH
FT                   ELECQMTNKKYKRQSPAIRELSAPKKRKAAVKVEAPPKESIKKEEEKIAPPSPPKLHHK
FT                   SSSIDNEQVSDKGYNSMCYTTSSSEDEAENRRTKRKRPRVNLIVNIPKQTVTNPLHVTK
FT                   PEFGSLSEFLQSYKSLDEDMSIEEFNKFIEEQRRLFANIRKGLESGVLKYDPATDSIEP
FT                   ITLKDAAGVHAHRPEPITYFYKEQQQYTFQDHLINQGIVMSRAFQETKKARISRIRKIT
FT                   QMIEQHFRHIAGAEERRQKEEEKRLKTMARTAVQAVKRRWVTAEKAYKVLKKDEEDQLK
FT                   KIQGKEHLSKMLEQSTQLLGAQLKRPNQDDTEKDLNTSASHSDVDQSDSNSDSFTSSDE
FT                   EDSASGNEDDARLSVEQLQMKYANLDSSPKSEDEESKTEREDSMDAAPVNLLSEKERLE
FT                   LKKDLEDKSLGLLDESDDEDTDSMSEHSSEPDSGEDEQGSEATSESVPKSDDGLASIFN
FT                   NIEEGESEVESDYASSTSAEEDDAFDSEESADDNSQEDLDHSANVGYEKKPEPQGGQLV
FT                   PEKDSLTVVDVPIPSLLRGTLRIYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISL
FT                   LAYLACEKQNWGPHLIIVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKDKRKGWNRP
FT                   DAFHICITSYQLVVHDQHSFKRKKWQYMILDEAHNIKNFRSTRWQALLNFNTERRLLLT
FT                   GTPLQNNLAELWSLLYFLMPQTAVGNNGGIQGFADLEAFQQWFGRPVDKIIQIGEGYAQ
FT                   DEETRKTVTKLHQVLRPYLLRRLKADVEKQMPAKHEHIVYCRLSKRQRFLYDDFMSRAQ
FT                   TKETLASGNFMSIINCLMQLRKVCNHPDLFEVRPILTSLCVEKSVAHDYVYLNNLVSQK
FT                   LHAMDHEREIDLEVLNLKFTSNDWSLSTHHAASINKSQCVEQFVKEVSKLRAETEEQLK
FT                   MGASESALNFQDINQFYRTFAAKKTDDMMGRLEHLQYLNNMRCTRKPVYGNNLIKLLSI
FT                   NKPVREGPLKELCRPLQTRILDSDALIDKFAVITPTVVSLDSRNMALGLNDESEFHSNL
FT                   REDLKQVLRRTDNPLHKLQTKLAIAFPDKSLLQYDCGKLQKLATLLRDLKDGGHRALIF
FT                   TQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQILTERFNTDNRITAFILSSRSGGLG
FT                   INLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQK
FT                   RQLDNVVIQRGDFTTDYFTKLSVKDLVGAEVPEIEANNRPLLMDADAATKDPRKLEKLL
FT                   AQAEDADDVKAAKLAMKEVEVDNEDFQEVKNGPQGPKEDDASEEDDPDDEYQGTRHVEE
FT                   YMIRFIANGWYWE"
FT   gene            <316845..>316916
FT                   /locus_tag="KLTH0E03498r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.8"
FT   tRNA            316845..316916
FT                   /locus_tag="KLTH0E03498r"
FT                   /old_locus_tag="Klth0E.tAsp.GTC.8"
FT                   /note="tRNA-Asp (GTC) cove score=69.96"
FT   gene            complement(<317318..>318868)
FT                   /locus_tag="KLTH0E03520g"
FT                   /old_locus_tag="KLTH-ORF9860"
FT   CDS_pept        complement(317318..318868)
FT                   /locus_tag="KLTH0E03520g"
FT                   /gene_family="HOG000066109" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9860"
FT                   /product="KLTH0E03520p"
FT                   /note="similar to uniprot|Q00539 Saccharomyces cerevisiae
FT                   YHR086W NAM8 RNA binding protein component of the U1 snRNP
FT                   protein mutants are defective in meiotic recombination and
FT                   in formation of viable spores involved in the formation of
FT                   DSBs through meiosis-specific splicing of MER2 pre-mRNA"
FT                   /db_xref="GOA:C5DHD6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD6"
FT                   /protein_id="CAR23197.1"
FT                   /translation="MSFGSSLNSFNYGSSRGDYAPQQSIHHTQSHSSPAEQSASRSNSL
FT                   YMGDLDPSWDENAIRAVWANLGEPNVQVKLIRNSGSTGGSSGYCFVEFPSHLNASNALL
FT                   KNGLLIPNARNRYLKLNWASFATAPGNEHSVFVGDIAPNVSEAQLFELFISRYASTLNA
FT                   KIVFDQMTGVSKGYGFVKFGQESEQQRALLEMQGVFLNGRAVRVSTTSKNRSKFQQPLQ
FT                   QQQQPYMQQQQPYVQQQARAPAFNNGNVQSQFIYPVQQQPTLTQYTDPNNTTVFIGGLS
FT                   SLVSEDELRAYFQPFGSIVYVKIPVGKGCGFVQYVDRISAETAIAKMQGYPIGNSRIRL
FT                   SWGRSAKQAAVMQQAFASSAQHRQQLSNQNALSTTNLPYNRQPAMPVSYGYSGNWDLLN
FT                   GGCSYKPSSPAHYANSVHDATGGSSTVLLPGVSNLEYVGAPSNSSSTSTFSYSPSYSAS
FT                   QSTTYSTSSQATDPVSAALGYGAQVHPQFLVQGNDAFDKSKSETIDRLERGSNGFIFA"
FT   gene            complement(<319728..>320810)
FT                   /locus_tag="KLTH0E03542g"
FT                   /old_locus_tag="KLTH-ORF9856"
FT   CDS_pept        complement(319728..320810)
FT                   /locus_tag="KLTH0E03542g"
FT                   /gene_family="HOG000094409" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9856"
FT                   /product="KLTH0E03542p"
FT                   /note="similar to uniprot|P38803 Saccharomyces cerevisiae
FT                   YHR085W IPI1 Protein of unknown function essential for
FT                   viability may be involved in rRNA processing"
FT                   /db_xref="GOA:C5DHD7"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD7"
FT                   /protein_id="CAR23198.1"
FT                   /translation="MAKKKTLKQQDFQKKKLKVGKPKQQASNVTSTAFTARTISLPNQQ
FT                   KLKSAGNREDSGDERLEADILRRLSLCKHHSAVTRKETLVHFKHMVPRIITAKCMTPLL
FT                   NSCYPLICDQDIQVRSALLELLEEIGQYDQNVLRLHSRALVLFINSSMTHIVPAVQRDS
FT                   GKFLQCAVRYCGDELVRNSWVKMLKGMFSVLGWSLEAPGSKKSSKSVSMGVKTSSVVSM
FT                   NSTKAKRSLQANLETLLEFVKCGCLEPKPDPSSGELPHGPSAYDKYLIPALPQPYQHLK
FT                   LFVKELKNEKTASHSKLEELNNTSFQDYATRREVLLEHFYDRVLENVENVIADGGECGR
FT                   VAKSLKGTMGDIKSLQDACA"
FT   gene            <320984..>323116
FT                   /locus_tag="KLTH0E03564g"
FT                   /old_locus_tag="KLTH-ORF9854"
FT   CDS_pept        320984..323116
FT                   /locus_tag="KLTH0E03564g"
FT                   /gene_family="HOG000248670" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9854"
FT                   /product="KLTH0E03564p"
FT                   /note="similar to uniprot|Q05468 Saccharomyces cerevisiae
FT                   YDR333C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD8"
FT                   /protein_id="CAR23199.1"
FT                   /translation="MSSRALRRLEENDLEKTLAKLAPSTQKQEPSAKTSSVKAPKQINL
FT                   FALMGQDEGDDSEDSEASNAEDRPIPASINDKPAQKPVQVLTKSQRKKNKKNKKSKQKP
FT                   KPAADLSETENGNGESDEELDRMILQFQKKDLEQRRSVDPGLTASDESDYDTAFEDEDA
FT                   SHLKGPADVKTDPGFTNFTSFSEIIKIFGDIDMKNLNPDNEYKLLFGDLSPESLADVDS
FT                   MTSTHVSPQVMKQIERLKHMVRNWGGRDHKTVPNGSTTRRLAFTKIREDWIPTPRGEYT
FT                   ITQLSQDEVVEWQSWLRSQDWMDEVRKTAHKWKDAGMNFYKFEPSNTETNRKAMTEFYM
FT                   SVVLHPDHEALIHLISSKFPYHVPALLQVALILVRQGDKANSNGLVERALFVFDRALRS
FT                   HISFNGLSCQLPYIYFFNRQFYFAIFRYVQILSQRGVVSTASEWCKVLWSLSPLEDPLG
FT                   CRYFIDHYLLLNKEYSYMANLASSPLVNTYMQWYTLGLSLGFVLSFLKLDMVEKAKTEL
FT                   RKAFTYHAASLSTIFKEVALGDANLLNGLDFPEPCSEIELESKAYLIRMKAIWGGVEIK
FT                   FLHDEILNILSEYKAGKIQLECTAPIETQNELFLGDIPINLLRFAVLSQESPLMACIPQ
FT                   EIWSERDVYEFDVLPPLPHDRESEDLVETVKTFVSESDLSMSQMEVMQDENMLNQIRQL
FT                   SLEQFLQENPNADLGD"
FT   gene            complement(<323231..>325336)
FT                   /locus_tag="KLTH0E03586g"
FT                   /old_locus_tag="KLTH-ORF9851"
FT   CDS_pept        complement(323231..325336)
FT                   /locus_tag="KLTH0E03586g"
FT                   /gene_family="HOG000000882" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9851"
FT                   /product="KLTH0E03586p"
FT                   /note="similar to uniprot|P13574 Saccharomyces cerevisiae
FT                   YHR084W STE12 Transcription factor that is activated by a
FT                   MAP kinase signaling cascade activates genes involved in
FT                   mating or pseudohyphal/invasive growth pathways cooperates
FT                   with Tec1p transcription factor to regulate genes specific
FT                   for invasive growth"
FT                   /db_xref="GOA:C5DHD9"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHD9"
FT                   /protein_id="CAR23200.1"
FT                   /translation="MLRGQPNAQEIVKTKAEGDSEESTPEQVEESLRLIEDLKFFLATA
FT                   PANWQENQIIRRYYLNNDQGFVSCVFWNNLYYITGTDIVKCCVYRMQKFGREVLDRKKF
FT                   EEGIFSDLRNLKCGIDATLEMPKSEFLSFLFKNMCLKTQKKQKVFFWFSVPHDKFFAYA
FT                   LERDMKRQSAGQLSTTRAVSEPALSFTYDDKSGLSLYDQLLQHMESQRIKVNASSSVDS
FT                   TTANPQLTSYSPAESDDPDSDAVIKTEFVGSSQESLAQISKYAPQELVVDPIEEGADEQ
FT                   PFELDSGAQAPFLLKDASQEEDDFPLDYFPVEVEYPNQQQLQPGGGQVYYDNDFEVEYV
FT                   PLSAVPPASAGFYDNSHFTEETAFAAPAVTSAARLAFQIPPPPMSASRSHFMTNGEYYA
FT                   SYVKDQEDRGCNRASDADVALDRSDAEEVVANGGDGTMNSKQGGMLHKPNIDFRAQNGG
FT                   YPVGSFYQGKHAYPVELQQGGADPHLTRSYAMEDYLCDNSALYEGFPGGAYLPPAANPF
FT                   TPSFLMTPVAPTSPYIGVTQYGAKQVVPASAKNYPINPYYQSSPGFQRWGNVHGYVRGF
FT                   PSIQATSAPPGAPLQMHNPQSASKLYFNKPGMIHKPPSRSQNQRHRARKTAFSSRPPMN
FT                   SSHTSNRSTSDGGNSVAFLVPSSESSMVLPDGSKKKLSTSASANEPSSTDDKEIIKKHE
FT                   DDNQFHD"
FT   gene            complement(<325715..>326689)
FT                   /locus_tag="KLTH0E03608g"
FT                   /old_locus_tag="KLTH-ORF9848"
FT   CDS_pept        complement(325715..326689)
FT                   /locus_tag="KLTH0E03608g"
FT                   /gene_family="HOG000000881" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9848"
FT                   /product="KLTH0E03608p"
FT                   /note="similar to uniprot|P14693 Saccharomyces cerevisiae
FT                   YHR083W SAM35 Essential component of the sorting and
FT                   assembly machinery (SAM complex aka TOB complex) of the
FT                   mitochondrial outer membrane which binds precursors of
FT                   beta-barrel proteins and facilitates their insertion into
FT                   the outer membrane"
FT                   /db_xref="InterPro:IPR021211"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE0"
FT                   /protein_id="CAR23201.1"
FT                   /translation="MRSILQVPGPVKAFFDQFPLQTYPAVSKKDDASVYEYNAQSYGFR
FT                   EQEAAQRSANDVFKLGVYNVVEDPESGCVLATDPWCLYAQLSLCKKNGLKLAHKKGAQQ
FT                   QQQRQQQRQQPALLVVSRLAASDKSLPILIEGCSKRNVRSTAGINEILSSRLRDAEELM
FT                   YVSLLDSVVYDCWTTQALCELSVAKFLELYDCAPIDVALLQRAFYQTLREDLLERNDFS
FT                   LRHLEISRHVRYMHLYQSRNAHQLTAPLFESCKAALDRFAALLGSRTFFSGEMEPGYLD
FT                   LKLASYVLCFLSLDDQESSLARYLRQEVHALAIHSRAVIAHFK"
FT   gene            complement(<327367..>329385)
FT                   /locus_tag="KLTH0E03630g"
FT                   /old_locus_tag="KLTH-ORF9846"
FT   CDS_pept        complement(327367..329385)
FT                   /locus_tag="KLTH0E03630g"
FT                   /gene_family="HOG000180925" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9846"
FT                   /product="KLTH0E03630p"
FT                   /note="similar to uniprot|Q06683 Saccharomyces cerevisiae
FT                   YDR332W Hypothetical ORF"
FT                   /db_xref="GOA:C5DHE1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE1"
FT                   /protein_id="CAR23202.1"
FT                   /translation="MTSCTRFVGAAGALAKAGNSLCLASRPYSSLALRDYQHECIDRCL
FT                   ESISQGRRRIGVSLATGGGKTVIFSNLIDRLRRESGKSGYRTLILVHRRELAQQACRVL
FT                   QAFFPGLNFQIEMGNYKCDINSADVVVASVQSLIRRLERYDPSCIDLIIIDEAHHAAAK
FT                   SYLRILEHFKANHKDSILPVVGFSATFERADNKALSAVIDEIVYHRGILEMIDDKWLCE
FT                   GRFTTVSVSLDLSDVAVTGSDFNIDGLSKVVNTKEVNKVVLQTYLQKRDLHKLRSTLLF
FT                   GCDIKHIETLHSLFVKHGVNAQYVTGKTRQSERDAIVEDFKRGRIEVLMNCGVFTEGTD
FT                   IPNVDSILLCRPTKSRSLLVQMIGRGLRLHHSKKHCHIIDFVGASTVGVVSFPTLAGVE
FT                   AVSTGLDEATLQDLKAIKDEIVAKQLEAERKVLAEKEAESLLKRQFRDLMKSANAFDLT
FT                   LTTYKDFKSFYQQMAATNGSQEQDWGSEKGKEIRLFRDSSYPWVQFAKDAWGMPLDAGH
FT                   HLRIYRESREASRPSTYVLKLYKELPYKVRSELGIRYKPLTVKSSTDLSAVVASVENIV
FT                   QELTEGTSPRPKNFTKYASWRHTPATPKQTALLKSKILGHISKSGSKSEQLQATDIDKF
FT                   LGSVTKGDVSNVLFATSLAPVYPIKSLCKIISLRTKS"
FT   gene            <330227..>332671
FT                   /locus_tag="KLTH0E03652g"
FT                   /old_locus_tag="KLTH-ORF9842"
FT   CDS_pept        330227..332671
FT                   /locus_tag="KLTH0E03652g"
FT                   /gene_family="HOG000000880" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9842"
FT                   /product="KLTH0E03652p"
FT                   /note="similar to uniprot|P38691 Saccharomyces cerevisiae
FT                   YHR082C KSP1 Nonessential putative serine/threonine protein
FT                   kinase of unknown cellular role overproduction causes
FT                   allele-specific suppression of the prp20-10 mutation"
FT                   /db_xref="GOA:C5DHE2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE2"
FT                   /protein_id="CAR23203.1"
FT                   /translation="MTEDYEVYKEGGLLRERYKKVDDISEGSYGYVSLANDTQTKKLVA
FT                   VKYIFKNEELEHGSSFEGDTDMGSHNSSNQKKNEMIKHQKSLISDKVRSRLSKNICFEA
FT                   LYEVDIHTKVGKHKNITELYDFFDSFIIMEYCSGGDLYEAIRADLVPKKTKLITHIASQ
FT                   MMEAIDFVHKKGIYHRDIKPENILIEGSDWTIKLTDWGLATTETTSMDRSVGSERYMAP
FT                   ELFEENLDREERAEPYDCSKVDLWAIGIVLLNVVFHKNPFSVANQSDKSFCYFAANREA
FT                   LFDIFSTMSFDFFQVLRHSLTIDPTNRDLDSMKKELAQLGEYTLDDEYYNNLTDDGYTP
FT                   PKLEEESATPVSTSTTPITIEDGIGGKIPRISVETITPTASIKTKSKEKDPIPRFKFTK
FT                   RSHPNTRDGNNKPAKPIRIDNSKIIKNSRKPLAIPTPNTHINNFFHDYQSKEKESFNTR
FT                   DFFTPPSVHNRYMEGIFNKSSKHRGHRNRRPSSNGNLKFTPKQGANNLSTSFGRRGSTY
FT                   SQHSPSGKYVPPHSRPSSLYSGSPHIPTINSVLDGAESGPPVLTKSTYHEQHPAVVDNN
FT                   ENDLDDVLFTLEENDIDSFTNDIGGLAIEDTTIKSAPDTVEDIGASSANTGELPDLLKS
FT                   PTLANKELEPATRNPFFNQLQEQNPNKDTVYKHKPGVYIPPHHRKSSGGNSISNQPLSP
FT                   YGGEATLSVGQNSVSYGGLNTRRKSSGNSRAVKNTPKGRPFMSRNHGRATTEVQQSDIF
FT                   ADSNAVVFEEDDNELPSFSPSSFYQSGTFRTGRKSSSVQDELIGSLEQYKNNWLMLQQQ
FT                   QD"
FT   gene            complement(<333386..>334588)
FT                   /locus_tag="KLTH0E03674g"
FT                   /old_locus_tag="KLTH-ORF9837"
FT   CDS_pept        complement(333386..334588)
FT                   /locus_tag="KLTH0E03674g"
FT                   /gene_family="HOG000204398" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9837"
FT                   /product="KLTH0E03674p"
FT                   /note="similar to uniprot|P49018 Saccharomyces cerevisiae
FT                   YDR331W GPI8 ER membrane glycoprotein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex that adds
FT                   glycosylphosphatidylinositol (GPI) anchors to newly
FT                   synthesized proteins"
FT                   /db_xref="GOA:C5DHE3"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE3"
FT                   /protein_id="CAR23204.1"
FT                   /translation="MKCLWFIPTLFILLTSTLVGASHEHTNNWAVLVCTSRFWFNYRHM
FT                   ANVLSMYRTVKRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNADRALDLYGESVEVDY
FT                   KGYEVTVENFIRLLTDRWSEEQPKSKRLLTDENSNIFIYMTGHGGADFLKFQDAEEISS
FT                   HDIADAFAQMHEKKRYNEIFFMIDTCQANTMYSKFYSPNVLAVGSSELDESSYSHHSDV
FT                   ELGVAVIDRFTYYTLDFMESINKNSSTTLQDLFDSYTFEKVHSHVGVRTDLFDRNLSEV
FT                   LVTDFFGSVKHIIKDENEQDESLETLSSGGEEDSIDNIVNLAISKNKENPLLRNTTLLR
FT                   VTQAQLMNTKDGLFNFDKKTKKSWSQTCLLSAFSVILVLVFRSLSEGRNNSGTAMLYNI
FT                   K"
FT   gene            complement(<335419..>336852)
FT                   /locus_tag="KLTH0E03696g"
FT                   /old_locus_tag="KLTH-ORF9836"
FT   CDS_pept        complement(335419..336852)
FT                   /locus_tag="KLTH0E03696g"
FT                   /gene_family="HOG000180231" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9836"
FT                   /product="KLTH0E03696p"
FT                   /note="similar to uniprot|Q06682 Saccharomyces cerevisiae
FT                   YDR330W UBX5 UBX (ubiquitin regulatory X) domain-
FT                   containing protein that interacts with Cdc48p"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE4"
FT                   /protein_id="CAR23205.1"
FT                   /translation="MSQEDIDTFTAITSADNSELASQFLEMAGGNMEVAISLFYEHGGN
FT                   AQLTRSSGINDAEVAGNMQRDLYQQGQDNYRPPDEARHETLVDTHVFPSTYRGIGGQYG
FT                   PLRSVRGMFDGSRPQGIFNQHLDDDDDDDSEFSEEEDLRQSYEYVEESVVELDEDGNVH
FT                   EYTKLVKKPREMTKEQKLAMLFRPPFDMMAKVDLEGARLRGRERQKWIMINIQTVDIFQ
FT                   CQALNRDLWANKDVKRLVKDNFVFLQYQFDSQNAAPYIQFYGPHDKDELPHIAILDPIT
FT                   GERVKQWNRDVPSPNNFIQEIEDFLQIFSLNPASTNPTVKEPTPELDPTTLTEEQQLEY
FT                   AIRESIGRDSATETGAATTTLETDQEPAVDLPEADSHQMLFDSISPAHHDEPPNQPGVT
FT                   TRIQIRIGDGRRLVRRFNAKEDTVRTIYEVVKSEIEGFETVHFTLSDHKREDLLEKLDL
FT                   TINGAGLENSSLLLEVTQA"
FT   gene            complement(<337034..>337585)
FT                   /locus_tag="KLTH0E03718g"
FT                   /old_locus_tag="KLTH-ORF9832"
FT   CDS_pept        complement(337034..337585)
FT                   /locus_tag="KLTH0E03718g"
FT                   /gene_family="HOG000000879" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9832"
FT                   /product="KLTH0E03718p"
FT                   /note="similar to uniprot|P38801 Saccharomyces cerevisiae
FT                   YHR081W LRP1 Substrate-specific nuclear cofactor for
FT                   exosome activity in the processing of stable RNAs homolog
FT                   of mammalian nuclear matrix protein C1D which is involved
FT                   in regulation of DNA repair and recombination"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE5"
FT                   /protein_id="CAR23206.1"
FT                   /translation="MDDSSKIKPYIAHLDGELKKLAKGIEQFTSKSLDEQLLEKKSERE
FT                   KLDLTNRYAYVLSSLLFAYMKLLGVKDITPIKQELDRVKRYMNLAKQLDQKNEGKTQHK
FT                   KDEQERAKKLINSALDGRASTPAISKVNFEGKHTRFEDQPVVSPEDREKLSQERQKQVP
FT                   ENKRSKGGSPRGRVSKKGRK"
FT   gene            <337770..>338270
FT                   /locus_tag="KLTH0E03740g"
FT                   /old_locus_tag="KLTH-ORF9830"
FT   CDS_pept        337770..338270
FT                   /locus_tag="KLTH0E03740g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9830"
FT                   /product="KLTH0E03740p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE6"
FT                   /protein_id="CAR23207.1"
FT                   /translation="MMEEAFLRDSKTLKRVAAVLKEKSHILQDADKVELTRLEHVICDT
FT                   LRAIERILEPKSSSMEISRMLNDPECAATPLGSFIPKNLRPGFKRTFFYSPEAPYARAR
FT                   DKSGSFRIAPPTPTQDRVFAKRSVHSASKDSQIQRSVSINFLLQNLALIENLRNLQRLG
FT                   QGP"
FT   gene            <338481..>339875
FT                   /locus_tag="KLTH0E03762g"
FT                   /old_locus_tag="KLTH-ORF9828"
FT   CDS_pept        338481..339875
FT                   /locus_tag="KLTH0E03762g"
FT                   /gene_family="HOG000001061" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9828"
FT                   /product="KLTH0E03762p"
FT                   /note="similar to uniprot|P28795 Saccharomyces cerevisiae
FT                   YDR329C PEX3 peroxisomal membrane protein"
FT                   /db_xref="GOA:C5DHE7"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE7"
FT                   /protein_id="CAR23208.1"
FT                   /translation="MSGRRSIWQRHRSKLYFSSAILATLLTTGAVSLYLIKKWLLRQQL
FT                   KISEQQFVKEQIKRRFTQTQQDALYTIYELMPVLSLVLAKDLDVDEIVGELKGKKLSRH
FT                   LSQRSASVKEDGEQDGLSSGMSTSLTDAQAPRASFAGQDPTAKTKAELWNELKLKSLTK
FT                   LCTVIYSTSSLLLLTRLQLNILARREYIETAVKVAVDKESSQSSIAGWLANWWHAETWA
FT                   AVQEDEKEPEGPELSEKAQQARRSSYINEQAFLSFSWWLLNRGWLQFKSLAENLVERHF
FT                   GDLNPRDMLTVEEFGGRLSSVLHAINQELLVKTDAEQALQMILLPDPNLEQFVLQQTLD
FT                   SEALKLLYEDNTVLRQLLNETTKCIESTASLIVLESLVNDAYQFAMSLIADNVSKKSKQ
FT                   KIDQDNSEASEPKFQMALFSITSKHCCDEMLKSGIVSMNNLFLQRLDSITELDDLSASV
FT                   YSNFGF"
FT   gene            <340081..>340638
FT                   /locus_tag="KLTH0E03784g"
FT                   /old_locus_tag="KLTH-ORF9827"
FT   CDS_pept        340081..340638
FT                   /locus_tag="KLTH0E03784g"
FT                   /gene_family="HOG000172184" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9827"
FT                   /product="KLTH0E03784p"
FT                   /note="similar to uniprot|P52286 Saccharomyces cerevisiae
FT                   YDR328C SKP1 evolutionarily conserved kinetochore protein
FT                   that is part of multiple protein complexes"
FT                   /db_xref="GOA:C5DHE8"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE8"
FT                   /protein_id="CAR23209.1"
FT                   /translation="MGKDKAQNVVLVSVEGERFTVERKIAERSLLLKNYLNDMQDNGLQ
FT                   SDGSDSEEEEDADDEDGDDEIVMPVPNVRSSVLQKVIEWAEHHKDSNFPDENDDDARKT
FT                   APADPWDREFLKVDQEMLYEIMQAANYLNIKPLLDAGCKVVAEMIRGRTPEEIRRTFNI
FT                   VNDFTPEEEAAIRRENEWAEDR"
FT   gene            <341138..>345013
FT                   /locus_tag="KLTH0E03806g"
FT                   /old_locus_tag="KLTH-ORF9825"
FT   CDS_pept        341138..345013
FT                   /locus_tag="KLTH0E03806g"
FT                   /gene_family="HOG000184671" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9825"
FT                   /product="KLTH0E03806p"
FT                   /note="weakly similar to uniprot|P38800 Saccharomyces
FT                   cerevisiae YHR080C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHE9"
FT                   /protein_id="CAR23210.1"
FT                   /translation="MGLFSKKRKGSTKKGNKHEAPKRAPSTSAENNGRHTVARRSIRDS
FT                   VTSNLTSDQGSSVAPGSATDTHFGSVKRRRSSPSPKRPKRRPSEIVKSKIGNLNHSKHL
FT                   HPPDELRSPQSATESSHTSPKLSTKISVLSNTKPWNANTNTNSDTAEGGNPDNKSDYEA
FT                   RNSSGIFSTIVSACHNAANHLLTKTSDKSFSADSQPWMPKEKARTSDTQPQEPQNSAFL
FT                   KHLDFLLSPSSMAQPNSQQTLLSSAPSQTGTNPSLASSRELRDSEISSQPSGHVDSIDG
FT                   HASAAETEIMSLTDGIRFYPRKGESHIATFGKGNLTLDALSKTSSSDEPLDAGSFHERE
FT                   LHTLSVTNAAKNPTRQRGKSLHSFDAKTRVQNLEENGSTISPVKSDPGTKVSSPLNEKD
FT                   DAADLSGKDVSKDVSKDASKLTEPNSEEKSRKRSSTFRIMCPRPSSPSLSALKVIPTRS
FT                   QRNSMQRARSSSITESGLHSPSGLSSDEEEHSLVEGTDKKIHKPHISEKKNNEFHALFK
FT                   DSGISPDEQLLADYSCAFSRDILLQGRIYISREHICFNSSILGWVTSFVIPFKEVVQIE
FT                   KKSTAGIFPNGIVFQTLHSRYIFASFMSRDSAFDYITHVWNHVVVGTDGSGSPNGTSGS
FT                   VGSNSRKRTMNSNFELETEGAGRLLSDGYSSGDETSDDEYEDETDMTTSDGEMSHTVRS
FT                   ASASSSQYDFETTNKSSVWTLGPSKHAPTSYDLDDADNRVVAETVFEAPLGKIVNILYG
FT                   DDVSYTEQILKAQKNYNISNIPTILGTKERKYSYTKPLAGAIGPSKTSCEITESLEHYD
FT                   LEDYVKAVQLSKTPDVPSGNLFVVKTSLYLSWAPRNSTKLTVVVSIEWSGKSWLKAAVE
FT                   KGTYDGVTNTTKTLIEEVNKIIQITDKKSVKTPPSEGEAEVPNLPTAGPSEHASTSSHY
FT                   TKEDGDVTIDDTIVIPAPLGTVYQLLFGSDTSYAQRIIEKQGNYDLTSVPKFKNDVREY
FT                   QYMKPLSGPVGPKKTKCLIEEKIEHKDFEDYVVARQITKTPDVPSGSSFSVHTKFHIYW
FT                   GPDNSTRILVVSKVVWTAKSWIKGAIEKGSLEGQKSSIKVLEQELKDIVSNAGKIKKTP
FT                   AKRSPRPRGKRQRTSEKAPIVDSSASSKGNTSFTSILKQFFNVSLSSYQMLGVIFVLFL
FT                   VFGATVRAFMGGNSNSFRVVKPGRIVIDGNSYNYAPTLNTLYGAYEQEVRSRKSVSRSP
FT                   NIVTSSEGEIWEWIKDRGNILPEDHSKKSARKRLTIHKRQELEEAVRLAEDKLKELKIQ
FT                   LNDSRLP"
FT   gene            <345775..>349131
FT                   /locus_tag="KLTH0E03828g"
FT                   /old_locus_tag="KLTH-ORF9819"
FT   CDS_pept        345775..349131
FT                   /locus_tag="KLTH0E03828g"
FT                   /gene_family="HOG000213215" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9819"
FT                   /product="KLTH0E03828p"
FT                   /note="similar to uniprot|P32361 Saccharomyces cerevisiae
FT                   YHR079C IRE1 Serine-threonine kinase and endoribonuclease
FT                   transmembrane protein that initiates the unfolded protein
FT                   response signal by regulating synthesis of Hac1p through
FT                   HAC1 mRNA splicing"
FT                   /db_xref="GOA:C5DHF0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR006567"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010513"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF0"
FT                   /protein_id="CAR23211.1"
FT                   /translation="MRRPRGIDLLAIFVWGLLLLIPAVSGSWLRWRGRREHTKESLAPL
FT                   ISEAQDAPISSLHNEVHRAKPTVFKKSLSVDTSSPAPAQLGERRPTDDSSKTKFTSNSL
FT                   LRNVHGFQDSPPPKNGVSVPFNHRNSEGLKILDYIIVTDLEGGLHAVHRKTGEILWSNT
FT                   NVSAPSIYVSEPTDSSNETLIVEPYGDGNIYYFNIYQGLQKLPISIKHLVNASPLDLKT
FT                   RIVVDENGTTIDDEKIYTGSRHSAVFNINIKTGQVLSAYGPGTENKAYDDLGTNCTEQS
FT                   FSTGACEDVFVLGRTTYELSIYSKLGTVYNVTYGAWQQNSADNSLANQYDRSADGILIA
FT                   PFGEKSLLAVDSELNFAKWISSQFSGTINNVFDVFLDGKTSEKIILPHPMNPRTVSNHQ
FT                   SRVLLGRTSEGCWYAMSDEFYPSLVDSSSISIYNHRREWKMPQTLKDVQSLQDAMVGVH
FT                   DLQSLQFEQIIEHEPRPSPKSLPASSMLLIDSPRPPRSDNRGLIVEEDSTKALEKYISK
FT                   EEMLALKLQAKEKMAKDLLSAHQKSFAYRFANFVYRIVEGGLMLLFSFFILGLLSRFKV
FT                   LAPLHVFLERSGLISGQNLETGSIKIEDKEDTSNTQDEPHEKHVQILNPTSDNEQNSKE
FT                   EGSSERRKRKRGSRGKKKNKKVHEFSQTDATGSSEADVEADLKHLTVSKKVLGYGSSGT
FT                   VVFQGTFQHRPVAVKRMLIDFYDIATQEIKLLTESDHHPNVVRYYCSEITGRFLYIALE
FT                   LCTSTLEDVVEGKKESSKIIEAREHLDPINVLFQIAQGVAHLHSMKIVHRDLKPQNILV
FT                   APTRKYMQHLDSSLAPMRVLISDFGLCKRLEPDQSSFHTKQGNASGTSGWRAPELLDGC
FT                   ATSDTENDGSYGSAESSISYVYDPFYHKRLTRAIDIFSMGCVFYYVLSKGSHPFGDKYS
FT                   RDSNILKESWCLDDINKSLKDRCSVIEAKDLIRQMISNNPSQRPAASQVIKHPLFWPIS
FT                   KKLEFLLKVSDRFEVERRVPPSPLLLKLEEASPRVIPNRDWTVKFDGVFMENLGKYRKY
FT                   SGEKLMDLLRAFRNKYHHFMDLPPELAEVMGPIPDGFFLYFARRFPNLLLEIYFVVQRN
FT                   LKHDQILGDYL"
FT   gene            complement(<349243..>352308)
FT                   /locus_tag="KLTH0E03850g"
FT                   /old_locus_tag="KLTH-ORF9816"
FT   CDS_pept        complement(349243..352308)
FT                   /locus_tag="KLTH0E03850g"
FT                   /gene_family="HOG000001059" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9816"
FT                   /product="KLTH0E03850p"
FT                   /note="similar to uniprot|Q06680 Saccharomyces cerevisiae
FT                   YDR325W YCG1 Yeast Condensin G"
FT                   /db_xref="GOA:C5DHF1"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF1"
FT                   /protein_id="CAR23212.1"
FT                   /translation="MKHKQTASGAKQAALPSTMPSDTEPTFENPGESHSTNSKIFRAVA
FT                   DVFQNAQSTYAGHRRHIAVLKRIQAKAVEQGYEEVFNYWFDKMVTLVLPLKRTEPVGDR
FT                   IVRLVGGFISSIEHELEATDDEYDRKEREEVFARFVDQFVRHMLRGIESRDKNARYRVT
FT                   QLLAVIMDNIGEIDEELYNLLMWSLQKRVYDKESFVRIQSIFCLTKFQDDESVSEAVDD
FT                   ATSKLMHAIQNDPSAEVRRAAMLNLVNTPNTKKLIMERARDVNPINRRLVYSRVLRGMG
FT                   SSVFEELNTESLDKLISWGLEDREETVRVACARLVSFDWLNLMDGDIIKLLTRLNVTTS
FT                   KVCEKAMDAIFKYRNDTVTKIKLPENVWGNLTAETSFLIKAFHFHCTKNHLDDVIDSNF
FT                   PEASKLSEIIQKYIDLRFVQSGLSAIDEECLDFIIQQLLSVAFNFDYSDEIGRRAMLIV
FT                   IRNTLASHKLKPSQVEICLKVLEVLSINERDFITMTVEIITDIRDEDIEKQEAEEAKKM
FT                   PSTNFNGTDEDEDDVESFHSAVDDLVNGNETPEGNSQLLVQEKEVSPEALLACLTMSQY
FT                   MLELVNSPLNENIMITTLIDTLITPAVRNTQPEVRELGVRTLGLCCLLDVDLAAESLYL
FT                   LGMCVSKGDASLKNTALKVIVDIFSIHGTKVVDGEGKVDSISLHKIFYKTLKNCELPNC
FT                   QATVAEGLCKLFLGDVFMDDDLFETLVLSYFSPANSKNEALVQAFAFCLPVYCFSHVRH
FT                   QRRMVRVAGDVLLRLSVLWDDIQTNEDESLPASSMLKPSVIFQELIEWTDSTKLVNKSS
FT                   ELDQKEDTQLDFLLSVLKVYYKLERKDLKKMILTNIGRFNFEDDNVSKWREAHDILEDI
FT                   LDNDDIDSATRNAVGKFTSLIKDFLATREESEQDITKNEASEDDEETSNILHTGASTHS
FT                   DGNPQAAESTDIIDGNQLSDLHLPGEKTDNTEEHLSLSNRKRKRLEERGCSERPSDPER
FT                   SSRMVSFVLPEDHSMSSGSSDDCKSDDEYNGE"
FT   gene            <353271..>355511
FT                   /locus_tag="KLTH0E03872g"
FT                   /old_locus_tag="KLTH-ORF9813"
FT   CDS_pept        353271..355511
FT                   /locus_tag="KLTH0E03872g"
FT                   /gene_family="HOG000246731" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9813"
FT                   /product="KLTH0E03872p"
FT                   /note="similar to uniprot|Q06679 Saccharomyces cerevisiae
FT                   YDR324C UTP4 Nucleolar protein component of the small
FT                   subunit (SSU) processome containing the U3 snoRNA that is
FT                   involved in processing of pre-18S rRNA"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF2"
FT                   /protein_id="CAR23213.1"
FT                   /translation="MTQTAQNLLVHRARFVDYNGANITALSFSHGSRLDKRTPSDLRLA
FT                   LGRSNGDIEIWNPRNGWCQELVIQGGEGRTIEGLVWSNISGEPLRLFSIGGSTVVTEWN
FT                   LETGLPLKNYDCNAGVIWSMAMNESQNKLAVGCDNGCVVVIDISGGSGVMEHEAVLQRQ
FT                   DSRILSVAWRMDEHVIGGCADGRIRVWSALKGAEMRGRILQTMKVDKSKKESTLVWCVT
FT                   YLPKIDQIVSGDSTGSVKFWDFQYSTLAQSFKVHDADVLCLTADETNTKVFSAGIDRKI
FT                   YNFSLAPSSSNKKAARWVVSSNRLLHSNDVRTMASYQSKGADFLVSGGVEKSLVISSMG
FT                   SFSEGSYRKIPFVVPFHKNVLVNQQQRLCVMWQQSTVKIWAMGDEADSSNNYKLVCKLS
FT                   LKDEQNISTCALSPDGQVLIVGRATTTKMFHLLPSNDKLKVTKLDNDFLLKNGTSHVKF
FT                   VDNSRIVIVSPRNDFLLLNLEDEDSDEKPVKIELPDLKETNTGIKLPHINSINHLDVRG
FT                   SFAVISRICGAVDLVNLESTSAVPVARLMNLITAIHISTRRTIALTTADNKVLEFLLHE
FT                   EDGVNVGTISPWCKKNKDYLPKEFEQQKDKCLGIFSGSPDDDSIWFWSSNYLARFDMSQ
FT                   DLPLNTRKRPRKHKIDENTVTDKSTFIDEGEEEDDEDEDLMDETSDLLKSDLGKEDSTN
FT                   RVAKNNKPFFITDKYRSLLFADLLARDQIVVVERPSSTSSSAAAFDLPKIVF"
FT   gene            complement(<355551..>357152)
FT                   /locus_tag="KLTH0E03894g"
FT                   /old_locus_tag="KLTH-ORF9811"
FT   CDS_pept        complement(355551..357152)
FT                   /locus_tag="KLTH0E03894g"
FT                   /gene_family="HOG000074713" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9811"
FT                   /product="KLTH0E03894p"
FT                   /note="similar to uniprot|P38799 Saccharomyces cerevisiae
FT                   YHR078W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR015672"
FT                   /db_xref="InterPro:IPR022535"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF3"
FT                   /protein_id="CAR23214.1"
FT                   /translation="MLTSDVLLFILLSGSFFVAFKASNRVLWYKVQHIFDLDSAASRVG
FT                   GLDLNLLEAQTDGFLSKFHSQFALSSKKAMKGVRVLFSSTFALCLIAMEMTLCQIMAVN
FT                   DEVSAQSNLVTISWLITSVGLALNLILVQPYLILLSVLDKFYGDKIKVDYLALVASGLI
FT                   LGWVFTLNFFGWGPFFYSTNMLTKLSIMGVSVMAFLSGVASVSTPYYVFQLIRYKRRKP
FT                   DSSFSERIPVAWMDDVVLREQKGECERRIQEGLDTLKSINSQPNGANPVLRQRHIEEIA
FT                   KFQLELARLEPRTKESKHVRDLKKYSQLGFLVYCVYKLLNTFFWKIPVLAWHSFHYPFD
FT                   HSYERLGYSEGGSSSSDPLAVTVANVLSFFLFRFKDQQGKESLAKQISLVLSVSLFACS
FT                   VSTVTTTISYLTTLLPTRLQILALKTMQRDSSTNVLPTSSKPRYEYKQRPSVIKNLLVS
FT                   ELTGVYILATILMIRSNLPLDVASRLNQMLGEEFGVPDIVIEVWFDKVFAMSSILSFVG
FT                   IKVAGKTGAGQHNRTL"
FT   gene            <357296..>358855
FT                   /locus_tag="KLTH0E03916g"
FT                   /old_locus_tag="KLTH-ORF9809"
FT   CDS_pept        357296..358855
FT                   /locus_tag="KLTH0E03916g"
FT                   /gene_family="HOG000001058" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9809"
FT                   /product="KLTH0E03916p"
FT                   /note="similar to uniprot|P32609 Saccharomyces cerevisiae
FT                   YDR323C PEP7 Multivalent adaptor protein that facilitates
FT                   vesicle-mediated vacuolar protein sorting by ensuring high-
FT                   fidelity vesicle docking and fusion which are essential for
FT                   targeting of vesicles to the endosome required for vacuole
FT                   inheritance"
FT                   /db_xref="GOA:C5DHF4"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF4"
FT                   /protein_id="CAR23215.1"
FT                   /translation="MNAVDGPGYLDEPQKSGSELNCPVCAQTLHDLAKLNEHLDRIHGF
FT                   GEVSNEDADSVNTQLTRSRNVVENSSKAAKANRFELKRDHWIKPVMGKSRCRTCSKSLT
FT                   QARQAINCRRCGEVYCKNHCNLIIKLNSNAEYNPLTGEWCKCCINCFGNRAGYNEFGAV
FT                   CNKTSMFKELRGSKVEDKQLRKLQLENRFIRLANGIQQINNQSSKSMLASIRKYTEINK
FT                   LERSVVPWTPDEAAFACSLCSKPFTLALRKHHCRLCGKVVCNESQTNCSNQLPLMSLIR
FT                   AASDLPISTEFVDNNAEDVQIRICSACVRILFIKRKFTRELSLPEPSILRIYENMRTTA
FT                   DVILSILPQVLNQAEEFSATPNAPDVALLTKMRRKLLDSFALYDRLTKQMLKIKPKNPA
FT                   EERIQRAIVFRASMLIQEHMLPLRSLTNAASTQNSSHETTPESERSMNQGYGNNLSIKE
FT                   VKEYRDQLMVLKEQKFLVENMIASASKQRKFDEAETLSGNLRELNEQVEMIARALGEEG
FT                   FS"
FT   gene            <359015..>362291
FT                   /locus_tag="KLTH0E03938g"
FT                   /old_locus_tag="Klth0E.mRNA.gf.334.p"
FT   CDS_pept        join(359015..359020,359091..362291)
FT                   /locus_tag="KLTH0E03938g"
FT                   /gene_family="HOG000141895" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.gf.334.p"
FT                   /product="KLTH0E03938p"
FT                   /note="similar to uniprot|P38798 Saccharomyces cerevisiae
FT                   YHR077C NMD2 Protein involved in the nonsense- mediated
FT                   mRNA decay (NMD) pathway interacts with Nam7p and Upf3p"
FT                   /db_xref="GOA:C5DHF5"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR007193"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF5"
FT                   /protein_id="CAR23216.1"
FT                   /translation="MNNERQLELFNLNSKAWAGESPLFEGGKKLDSSLKKNTAFIRKLK
FT                   LGISKDSKQNFLKDIRELSLEKYLSELVSTSSEGLSKVSGKAEDVDAAVEVMSALHQRF
FT                   SCKFTPVLMESFLNNFSLTQSSHESEKEELARILRLRSHVRIFTELYLVGLFRNTDYLN
FT                   KENVPAFIAKKLSKKEPIIFTILKEVLNYRFRTGLTTTIATSFITKFPILFEGNAFNEE
FT                   LELESGTRKLLQSLIKVYTEACIGQAVELNKTLNKLKREHSKAQIRTGKNTDEYIEEYN
FT                   DLLPVFERFEGAVNVLTDALQIEAPKLDKGIDSEANTTGPASIITNQLKPNSEKVWENE
FT                   EVRKFYEVLPDLSSVHHDIEDRDAPDSTKLSDFFAGLEFADTREAIDELSVKYWSDSLN
FT                   KKATRRRLLKFFIETQDWSKLRIYARFIASNAEYLSDTKDELIEYLDNGFRSQLRSNRI
FT                   NVKNIIFFSELVKFMLIPSYLVFHKIRTLAMNIQVPNNIEILTILFENFGKFLINHPTY
FT                   KDQMEKMVDLIQQKRKDHDLTVSNKCALDNLIVLIYPPSLSKLNSAVKELNPEQQFYQI
FT                   IIRRELHTISAEKTVKLLRKAHWKDEKIYKTMFSLFTKPEKVSYQSLDVLSSVLCGLYP
FT                   YYRNFVIEVIDTLLEKIERGLEISEFNLNMVRMAQIKYLTSLFNKKLVRLEVLIEIFCK
FT                   IMKFGYPGGRPNPYFLNEFDLPDNYFRVQLITTSLLSIEELPASKSDKMLLFMRLFEFY
FT                   TFVKEQPLPRETQFKVSSAFQKLTSTDNFKRSCDVAESAKELANALNIPQATSLGSSPH
FT                   QQTKKEGAYEEGEEDDDDDDEDDDAEIEEEVDNEEDDDEEDEDDDTEEGREPVKIIQED
FT                   EEGNLAALDSSDESASSDDSDDSGTSSNSDSDEEDGDDDEDDEDDEDDEDDDSIDLDGE
FT                   LERKRIHEEHLNRLRTEEELRAEEELEKQFQQLMQESMESRKNEKVSGNSIPIISAGYS
FT                   TSLGKESGGEALRALNKSHDGKSKKVAFTFLTKSGKKTQAKTLGLPRNVKFVSGVLEEE
FT                   QKLKAEREKIKNIVLNQKFD"
FT   gene            complement(<362321..>363349)
FT                   /locus_tag="KLTH0E03960g"
FT                   /old_locus_tag="KLTH-ORF9802"
FT   CDS_pept        complement(362321..363349)
FT                   /locus_tag="KLTH0E03960g"
FT                   /gene_family="HOG000248058" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9802"
FT                   /product="KLTH0E03960p"
FT                   /note="similar to uniprot|P38797 Saccharomyces cerevisiae
FT                   YHR076W PTC7 Mitochondrially localized type 2C protein
FT                   phosphatase expression induced by growth on ethanol and by
FT                   sustained osmotic stress possible role in carbon source
FT                   utilization in low oxygen environments"
FT                   /db_xref="GOA:C5DHF6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR010822"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF6"
FT                   /protein_id="CAR23217.1"
FT                   /translation="MFASSRTAGMRGFSASRSMCLWAALAVLLAMVLTAWPGAYRFKRW
FT                   QYRSFFSGPSGQGQSGGSAGFNYKYAVAYQAKDRSDSLYAGLDVDSPTGEDNYFLSARS
FT                   TSDLYAGVADGVGGWVEHGHDSSAISRELCAAMSEFAMLTKDNRSFTPKQLIDMAYSKI
FT                   KQEGQVKAGGTTAIVAHFPPSGKLELANLGDSWCGVFRDSKLVFQTKFQTVGFNAPYQL
FT                   AIIPKDLAKEAAGRGSSYIQNKPSDADEYQFQLKSNDVIVLATDGVTDNIATGDMELFL
FT                   GNNANATDLQQVTQKFVNQVVNLSKDSSFPSVFAQEISKLTGKQYLGGKEDDITVVVVR
FT                   VD"
FT   gene            <363598..>363876
FT                   /locus_tag="KLTH0E03982g"
FT                   /old_locus_tag="KLTH.mRNA.184ET.p"
FT   CDS_pept        363598..363876
FT                   /locus_tag="KLTH0E03982g"
FT                   /gene_family="HOG000157483" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.184ET.p"
FT                   /product="KLTH0E03982p"
FT                   /note="similar to uniprot|P81449 Saccharomyces cerevisiae
FT                   YDR322C-A TIM11 Subunit e of mitochondrial F1F0- ATPase,
FT                   which is a large, evolutionarily conserved enzyme complex
FT                   required for ATP synthesis; essential for the dimeric state
FT                   of ATP synthase"
FT                   /db_xref="GOA:C5DHF7"
FT                   /db_xref="InterPro:IPR008386"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF7"
FT                   /protein_id="CAR23218.1"
FT                   /translation="MSTVNVLRYSALALGAIIGLKTDLSLKSEAAKSSQQKEYAEKLKL
FT                   IEQAKAEYARLHAPKQVEKQADTKLDLEDPNLDYGKVILSAVESLKQ"
FT   gene            complement(<364090..>365163)
FT                   /locus_tag="KLTH0E04004g"
FT                   /old_locus_tag="KLTH-ORF9797"
FT   CDS_pept        complement(364090..365163)
FT                   /locus_tag="KLTH0E04004g"
FT                   /gene_family="HOG000001057" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9797"
FT                   /product="KLTH0E04004p"
FT                   /note="similar to uniprot|Q06678 Saccharomyces cerevisiae
FT                   YDR322W MRPL35 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF8"
FT                   /protein_id="CAR23219.1"
FT                   /translation="MLRRSLHSSVVKRSGSKIWSEFTSRPEALSIGSERIKKCVLEGTP
FT                   SQGPPSIKRRSNRVKYSSPEKIDEVFKTCYDFLESRSAVKYAELEREEDPAKRTKLLVE
FT                   AEVNNPEVLYNFQYGDKVENNPRFIDYNVPVYRHLGRQHWESYGQMLLMQRLETLAAIP
FT                   DTLPTLVPRAEVHLRFPFSTGLNKWVEPGELLSSNATTLPPAIKIQEYDDVDTESQEYT
FT                   VLILNPDEPDIASDSFKTTLQYGLTNLKISYNDNVVDSRKFTADNIIAGYLPPVPEKNA
FT                   GVQRFVVWVFRQSKHLAAGEAASARDNFNVRDFVHAHKLQPIGAHLWRSEWDSNVTNVR
FT                   AKYGLPEGRVFHRVRKA"
FT   gene            <366407..>369019
FT                   /locus_tag="KLTH0E04026g"
FT                   /old_locus_tag="KLTH-ORF9792"
FT   CDS_pept        366407..369019
FT                   /locus_tag="KLTH0E04026g"
FT                   /gene_family="HOG000106482" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9792"
FT                   /product="KLTH0E04026p"
FT                   /note="weakly similar to uniprot|P32454 Saccharomyces
FT                   cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
FT                   yscII and to YHR047C uniprot|P37898 Saccharomyces
FT                   cerevisiae YHR047C AAP1' Arginine/alanine aminopeptidase"
FT                   /db_xref="GOA:C5DHF9"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHF9"
FT                   /protein_id="CAR23220.1"
FT                   /translation="MTEKQTLPTHFQPLHYSIELDCLEANAKKFNGRVSIDFKVRQACN
FT                   KVYLNTRDLEIDSASIVKRTREFIGLMAQDYDPVNEVTVLTFAMELRDDFTLVLNYRGL
FT                   IQTNMTGFYQSEYSDATTGETKTMLSTQFEATDARRAFPCLDEPLLKATFDVSITASSE
FT                   LVVLSNMPSRHTEVSSDGKTTKHNFHRTPKMSTYLVAWALGEFEYIEGHTENRIYPANP
FT                   GCGAERQKLPIRVYTSQGKSHQGAFALGVASKVIDYYSRLFDIPYPLPKLDLLCVEAYS
FT                   HNAMENFSLITFRPTALLLEGDVASADPLALQKIAYVVSHEIAHQWFGNLVTMKWWDEL
FT                   WLNEGFATWVGYHAISEFFPEWDVPSLVMLDSHEVALQLDSLAESHPVKVHVKNAKDID
FT                   QVFDAISYLKGCSILEMISEYVGVEKFVGGVSLYLKRNVFSNATMEDLLGSIGEVCGCD
FT                   ILARLQNWILNIGFPLLKVQTADAGEVELCQERFLSTAVHSEDSTVWWIPLMTQGNLQN
FT                   RKLELWEKSSSFKVPEEGLLHFNAAGFGFYRVSYEDKRHLYRICDNLEFIPSRGKIGLL
FT                   SDVQTTESASVLLEVLSYFSRALKREDGYVWVMVYNVCASLLLLSYKSSSLEAFNKIKT
FT                   FVLSLLEPLIDDALAYLCDPSSVSSNQSDAHRSSRTRFYDQALLVAGALSHEKVVQNCQ
FT                   EIFRRNLVTPATRKVVLSTILSQPKAPECLFDEVAAELDTATLAHKETVIAALGKVQNP
FT                   ALFQKSLQLIFRLQSMDVQFLTAAWATNPFIWEYVWPFVRNNYDSIHKHISANPTVIER
FT                   FVRNVLNCLVGPSLKKDVERFFEGKDVAAFDRALHQGLEIIEKNTLYVKKNFESSASA"
FT   gene            complement(<369100..>370464)
FT                   /locus_tag="KLTH0E04048g"
FT                   /old_locus_tag="KLTH-ORF9788"
FT   CDS_pept        complement(369100..370464)
FT                   /locus_tag="KLTH0E04048g"
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9788"
FT                   /product="KLTH0E04048p"
FT                   /note="similar to uniprot|Q05031 Saccharomyces cerevisiae
FT                   YMR238W DFG5 Mannosidase essential
FT                   glycosylphosphatidylinositol (GPI)-anchored membrane
FT                   protein required for cell wall biogenesis involved in
FT                   filamentous growth homologous to Dcw1p"
FT                   /db_xref="GOA:C5DHG0"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG0"
FT                   /protein_id="CAR23221.1"
FT                   /translation="MLAQSFALCALLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYA
FT                   GTRIGGTVGMFQQPYYWWEAGEVFGGMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMP
FT                   SNQSMVEGNDDQGVWGLTVMSAAERNFTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCG
FT                   GGVRWQIFTWNSGYNYKNTVSNACMFQLAARLGRYTGNDTYLTKAETVWDWLVDVGFVV
FT                   LNENGNANVYDGANIDDNCTDIVKNEWSYNQGIVLGGAAYMYNATQNDTSVWKSRLDQI
FT                   VGGSTEFFFKDKVMYESTCQDSKTCNQDQRSFKSIFSRMLSLTRSLAPYTAETIDPLME
FT                   ASAEGAAKSCTGGTDGHTCGLNWQLGYHDGYYGLGEQACALEGIQSLMYSKRPAPYTSD
FT                   NGGSSVGDTEAALNSTSTNVLQSDIKITHKDKVGASIITAVILAVLVGGSIWMIF"
FT   gene            complement(<370706..>372865)
FT                   /locus_tag="KLTH0E04070g"
FT                   /old_locus_tag="KLTH-ORF9783"
FT   CDS_pept        complement(370706..372865)
FT                   /locus_tag="KLTH0E04070g"
FT                   /gene_family="HOG000198711" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9783"
FT                   /product="KLTH0E04070p"
FT                   /note="similar to uniprot|Q08754 Saccharomyces cerevisiae
FT                   YOR299W BUD7 Protein involved in bud-site selection diploid
FT                   mutants display an axial-like budding pattern"
FT                   /db_xref="GOA:C5DHG1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG1"
FT                   /protein_id="CAR23222.1"
FT                   /translation="MCPRAAAAPPPLSPAALAAPRTNIEPPRRVREDEIGSAIEERRAK
FT                   LPQFQDLGPPDLVSIVKYTPSGSANAHNNKRSSMQLEPSTSSPAAGSAVAAAGDLHVND
FT                   KHKGEVGTFLYCVGADTSDPTSIAVFLKGMADAIAEKPQVWFGRHKPYRVARITFATWN
FT                   AFRQCDVEVVVHIPGAVQSYFLDTRGEVLAVAPDERELVWAETFASGVVRAIAMMADNR
FT                   EDGEVNNVVETRILNPLLSGEIGDVADHFIDVFPLLYARGVALGAPCDVACASRTNNYL
FT                   CETLLHVTRLTRNFRRCRAMLEGMLGDHPEAVVLLARVLFAADLEVDAVRLIHDDLAAH
FT                   GGVVTAHRSELLCVQAAFLLDAKRDYAAAQRLAQAAVDCAPSEFRPWHLLVQSYVGLND
FT                   IENALLALNGCPVAPHRDRYIFKRVISVAQDSANLHLPLPMDVVLDEVTGLNSRDIINE
FT                   HKSVSPALLNLPAATLKANARTRYHLLTEIARKTGWESLLRYRSKLFVMEEEYQVAATP
FT                   PAEEGDPLKPDGIRTKRLCERWLDNLFMVLYEDLKAYTLWQAEQLHFEAQNTHYSKTTT
FT                   EWELLGLCALRLGHREEAAAAFEAGLQHRFSAESCRKLLQIYLHERSRLKKDSDLSSSQ
FT                   VTAAVLDYDNKIIDLCVKICCWNHRWYSEFSILLLDSLSVVVDDMGITKLSNEISSRFP
FT                   ETVVQLANDNLLAFYADYTDGGYDK"
FT   gene            complement(<373159..>373599)
FT                   /locus_tag="KLTH0E04092g"
FT                   /old_locus_tag="KLTH-ORF9773"
FT   CDS_pept        complement(373159..373599)
FT                   /locus_tag="KLTH0E04092g"
FT                   /gene_family="HOG000204913" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9773"
FT                   /product="KLTH0E04092p"
FT                   /note="similar to uniprot|Q05027 Saccharomyces cerevisiae
FT                   YMR236W TAF9"
FT                   /db_xref="GOA:C5DHG2"
FT                   /db_xref="InterPro:IPR003162"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG2"
FT                   /protein_id="CAR23223.1"
FT                   /translation="MTDDAQEEVPRDVRLLHLLLASQAIQHYEDQVPLQLMDFAHRYTR
FT                   GVLKDAMVYGDYAAGDAAAELSVEDIRLAIAARTQYQFKPTAPKELLLQLAAERNKKAL
FT                   PQVVNMWGTRLPPEKYCLTSREWRLEEERDEQGHAVGDGAAR"
FT   gene            <374102..>374557
FT                   /locus_tag="KLTH0E04114g"
FT                   /old_locus_tag="KLTH-ORF9770"
FT   CDS_pept        374102..374557
FT                   /locus_tag="KLTH0E04114g"
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9770"
FT                   /product="KLTH0E04114p"
FT                   /note="highly similar to uniprot|Q86ZS7 Saccharomyces
FT                   cerevisiae YOR298C-A MBF1 Transcriptional coactivator that
FT                   bridges the DNA-binding region of Gcn4p and TATA-binding
FT                   protein Spt15p; suppressor of frameshift mutations"
FT                   /db_xref="GOA:C5DHG3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG3"
FT                   /protein_id="CAR23224.1"
FT                   /translation="MSDWDSTTVIGSRARAGGSGPRAQVARTQGQINAARRSGNVLSVD
FT                   KKYSSSNAKGDPEGQRLTKIDRETDIVVPKKLDLSVGKAISRARGEKKLTQKDLATKVN
FT                   EKPTVINDYEAGRAIPNQQILAKLERALGVKLRGKNIGEPLGPKKKA"
FT   gene            <374713..>375945
FT                   /locus_tag="KLTH0E04136g"
FT                   /old_locus_tag="KLTH-ORF9766"
FT   CDS_pept        374713..375945
FT                   /locus_tag="KLTH0E04136g"
FT                   /gene_family="HOG000195026" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9766"
FT                   /product="KLTH0E04136p"
FT                   /note="similar to uniprot|P11745 Saccharomyces cerevisiae
FT                   YMR235C RNA1 GTPase activating protein (GAP) for Gsp1p
FT                   involved in nuclear transport"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG4"
FT                   /protein_id="CAR23225.1"
FT                   /translation="MASLAFTPAHEQSHVFSVANRALKLTSSTDIAPLLEDLAKLPQCT
FT                   KIDFSGNTLGIEASRALAACIADNASVRDHLVELNFADLYTSRLVDEVVESLEIFVPVW
FT                   LACPRLSIVNLSDNAFGLRTIDSLEHYIRSAVQLEHLILSNNGMGPFAGERIGKALYQL
FT                   AQRKKAAGSPLLETFICGRNRLENGSAAHLALGLKAHGAGLKVVKLYQNGIRPRGVATL
FT                   IRHGLRHNTALQVLDLQDNTFTTVASAALAETLPVWRDSLVELNVNDCLLKGSGSDLVA
FT                   KALQAYEFPQLHALRLQYNELTQDTLESSLLPALQANKLPALKFLELNGNRLEEDSDTL
FT                   TELEQAFDGELDDLDDLEELDSEDEEDEEDEEEEDADASEETDIEALEKSLADLEINVD
FT                   ELAQDLQKTSI"
FT   gene            complement(<375986..>377395)
FT                   /locus_tag="KLTH0E04158g"
FT                   /old_locus_tag="KLTH-ORF9760"
FT   CDS_pept        complement(375986..377395)
FT                   /locus_tag="KLTH0E04158g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9760"
FT                   /product="KLTH0E04158p"
FT                   /note="weakly similar to uniprot|Q08750 Saccharomyces
FT                   cerevisiae YOR298W MUM3 Protein of unknown function
FT                   involved in the organization of the outer spore wall
FT                   layers"
FT                   /db_xref="GOA:C5DHG5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG5"
FT                   /protein_id="CAR23226.1"
FT                   /translation="MSILDTLRTHFVGSGLQLRADNVPAALSLVLQLVLLVQYVAAYNV
FT                   WSFKTWIVEQSVDSRPSKWAIGTVSKTLIWIPLVGERLTENLEHVVCSIKLRVLPPMKR
FT                   VEERLELCYQVALADLTFRHGNVRLLVTGDTEGFPTAVTNKRSSLVIANHRSVMDYSLI
FT                   NYLAQGEERVAARQNFWRLFESKETDTMLGLKFVTWGRVCNMPSLRLLSSILAGDENCA
FT                   VDAARLQEFLEDRGNQILAVFPEVNVLTPELRLVQRKLAKDNYLPMLNNVLYPRFKNFK
FT                   AAIRCLSHVRGVGIARRGRRLRNAVTKADSMVCKIRHPGSRISDTQIAQVSMFLGRVED
FT                   DEALAKNKKKLKPTQRALLSVDPFVWDLTIVYYRAKISKGKDHAHLHEQEQKRLEDGAH
FT                   YQLEQVTPSFLQMASSSFQDSPLLIRIHTCKHPMSKLLALSDRKLEKWLERRWMQKDEM
FT                   IDSIQKNVKIS"
FT   gene            <377813..>378382
FT                   /locus_tag="KLTH0E04180g"
FT                   /old_locus_tag="KLTH-ORF9758"
FT   CDS_pept        377813..378382
FT                   /locus_tag="KLTH0E04180g"
FT                   /gene_family="HOG000204209" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9758"
FT                   /product="KLTH0E04180p"
FT                   /note="weakly similar to uniprot|Q08749 Saccharomyces
FT                   cerevisiae YOR297C TIM18 mitochondrial inner membrane
FT                   translocase"
FT                   /db_xref="GOA:C5DHG6"
FT                   /db_xref="InterPro:IPR007992"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG6"
FT                   /protein_id="CAR23227.1"
FT                   /translation="MLKRCFESNLRSGTRSVLTRAKLSQHRPSIGLRPMSLKPNFSKLK
FT                   IVPPPPGGVEGGVNDPLKPVEIDYFHGSYHWDYERITAVMLVPLTLVPMYGALSSGTLY
FT                   PLLDAMLCSVLLIHSQLGITSCIIDYIPKRKFGIWHKLAMGMLYTGSAVGLYGVYELET
FT                   SNNGLVDLIGRLWKEDESGLTIFSRF"
FT   gene            complement(<378494..>379639)
FT                   /locus_tag="KLTH0E04202g"
FT                   /old_locus_tag="KLTH-ORF9757"
FT   CDS_pept        complement(378494..379639)
FT                   /locus_tag="KLTH0E04202g"
FT                   /gene_family="HOG000066052" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9757"
FT                   /product="KLTH0E04202p"
FT                   /note="similar to uniprot|Q04740 Saccharomyces cerevisiae
FT                   YMR234W RNH1 Ribonuclease H1 removes RNA primers during
FT                   Okazaki fragment synthesis degrades RNA attached to the 5'-
FT                   end of a DNA strand"
FT                   /db_xref="GOA:C5DHG7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG7"
FT                   /protein_id="CAR23228.1"
FT                   /translation="MAKNSFYAVQNGRSTGVFNNWDTCKSLVSGFPGARYKKFDTMAEA
FT                   QSFAEQGKSFSKPSSSLRVPQSRQAYRESQSSQIGYGPHTMKSERSSGERNGPRDSRSL
FT                   ASKVKAGRTREMSPTRSSILRNNQESRKRGQKASQRFYGVKSSNPNYESKIFESWPECQ
FT                   RYVSRKSGISFKKLDSLEEAQNFINGTSSKDFEFIGQDQEQFLSQYSRVPEEGAVVQDC
FT                   NVYCDGSALSNGTRSSRAGYGVYFEQDGGNNISEPLLEGAQTNNRAEIQAVSSALDQIW
FT                   TNLTANKKNLRYQIKTDSEYVAKLLNDRYMGYSVQKLEQLPNSDLIAPLVQKFVKVKKF
FT                   YEINEEVFGSSKFHIEWVRGHAGEAGNEKADELARLGASKS"
FT   gene            complement(<380176..>384102)
FT                   /locus_tag="KLTH0E04224g"
FT                   /old_locus_tag="KLTH-ORF9755"
FT   CDS_pept        complement(380176..384102)
FT                   /locus_tag="KLTH0E04224g"
FT                   /gene_family="HOG000142353" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9755"
FT                   /product="KLTH0E04224p"
FT                   /note="similar to uniprot|Q08748 Saccharomyces cerevisiae
FT                   YOR296W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008528"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR014770"
FT                   /db_xref="InterPro:IPR014772"
FT                   /db_xref="InterPro:IPR019558"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG8"
FT                   /protein_id="CAR23229.1"
FT                   /translation="MAARHVSASSTISSGSTSNLLMSGAPVPSMTQPELDAILHYTLKV
FT                   ILIEYINEPRFKIRAVKPRGPVRTASKSTKEKRNKRSSWLFSDDGARKDQAEAKQLQKL
FT                   TPTLENYLRMVAIDKIKVKQTQLRRSLLKLYNDAFLDPHASRSLLSLTRLEELVMLFTK
FT                   AANGELAKVGNTSKTKEELYSQVCCFLDTITQLATQQESSKSRLVTRIHEYKKQFSNPK
FT                   SMEPLFSSLPSNGSNTELSEPAVKPTFKLSDVAHSAYLMELFNMSEIELQQILIKNVNE
FT                   TNNSIFGRSMRALKAKVALQDNTESAYAFPITKSFEEWKTSEMQELDALIAKFGRHGAS
FT                   EYEATDLSRSIPEKARDLYTGLARLILEKELSAGPATSILPKDAVFLLTKCAYYWRVDL
FT                   SSTKATLLYTAANAGPLSGETNASEKFEMLFKIISTKALSKEEDLGSLPTWRIIDQQEW
FT                   MSNLTITFEQCMNSINLCLSAIYQKLMPKFSPILSIYYTYIEPGFELLGHNIAETNLFK
FT                   KHSRRLHRVLFRTSEQYYVSLVKGLPRDGSLEIHNVKHIADQILKNLQDIQKKYKNPLL
FT                   DQINLASECAKVLIEAFGVDCSAMLAQVERFSKAENQNKIPLYDATETYKTLRELRDVY
FT                   AQVQPSKKFPFKLEKHFLKYLSELCDDCCSGTLAVVKTALEKEDWEPADMSETYSTSVI
FT                   DIFKMIHESFDLFLKLGWADQYQISKICTFLLKSVADGLSYYANTVANLVESEMNISQS
FT                   EEGEFAETENERKVLDVISQTAAAKMKNTWLYSEMRSALKSSDVVIPKPYEFQSKTCTC
FT                   LNNLNQMMQMISDLEERINPEEMSSVVNQHERLDAKRRMMTDRQNKGLKHLYTVKIIRA
FT                   ENVQVTSHNAGLLSTVSIVDAKNKREVAKTREVLKASRPVWNEEFEIEIPVNDTRPFSF
FT                   ILWHHKPKSDSTSSRMSGRSFLYLDPHKFKNDGYPQDVCLNLDTHGQLFLQISVETERV
FT                   DALFAMGRAFRSLSRARDRSIELMVSKFQVFVHFAFSRTTLKTICGANGQIRPSNTEIY
FT                   DSIVPLFDYLNANLNILASRLSRELLHKIMLEAWEEILNEADALLLPFLSDAPRAYQRS
FT                   VKNKSIWENAVDVAKLGMSASSGSERPLTQIEIDTVFEWLRALCIDFFHNNGEGPPLTD
FT                   LKNMHYQALLLIPVFYDKNVSELKNEADALNRDYRKSMFGVNNNDADGPRRANSNLRRA
FT                   NTLARKRTIIANSSRKRRLEVDKEIKASEENPAENIVSTQDVILRILIAKGEAEFVLES
FT                   LSLRERVSKALRTEQIVKAAKKSY"
FT   gene            complement(<384279..>384973)
FT                   /locus_tag="KLTH0E04246g"
FT                   /old_locus_tag="Klth0E.mRNA.3332.m"
FT   CDS_pept        complement(join(384279..384872,384938..384973))
FT                   /locus_tag="KLTH0E04246g"
FT                   /gene_family="HOG000000765" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.3332.m"
FT                   /product="KLTH0E04246p"
FT                   /note="similar to uniprot|Q05024 Saccharomyces cerevisiae
FT                   YMR233W and to uniprot|Q08747 Saccharomyces cerevisiae
FT                   YOR295W UAF30"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHG9"
FT                   /protein_id="CAR23230.1"
FT                   /translation="MAELDTYISMIDAILGVSDPDEVSAKRIRRAIQELFAVDLEPERK
FT                   KVNALIIERFNRLQDARAEVSQDELVEDDAKVARTLAKKVNGKAKKDSRNTKVKKKRKV
FT                   SESSNSLNQKKMQLSDELQKLVGEPEMARTQVVKKVWEHIKEQDLQNPQDRREILCDEL
FT                   MKPIFGDKTTMFALNKSLSKHIYSRDKKVQATEPAGSPFTTEVSTA"
FT   gene            complement(<385182..>385799)
FT                   /locus_tag="KLTH0E04268g"
FT                   /old_locus_tag="KLTH-ORF9750"
FT   CDS_pept        complement(385182..385799)
FT                   /locus_tag="KLTH0E04268g"
FT                   /gene_family="HOG000180297" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9750"
FT                   /product="KLTH0E04268p"
FT                   /note="highly similar to uniprot|Q08746 Saccharomyces
FT                   cerevisiae YOR294W RRS1 Essential protein that binds
FT                   ribosomal protein L11 and is required for nuclear export of
FT                   the 60S pre-ribosomal subunit during ribosome biogenesis
FT                   mouse homolog shows altered expression in Huntington's
FT                   disease model mice"
FT                   /db_xref="GOA:C5DHH0"
FT                   /db_xref="InterPro:IPR007023"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH0"
FT                   /protein_id="CAR23231.1"
FT                   /translation="MSSFAEEKKNLPVTVEKPIPVTYDLGNLAVFDSNTLDRNDLDSSN
FT                   AQREENIKKISRDNVQLMINQILSLPIKSTTESANGTSGQSASMTLVQLPEPTSELPRE
FT                   KPLPKPKAPSKWEQFAAKKGIKPKERSGKMVYDEDAGQWVPKWGFNGANKKLDKQWLVE
FT                   VDDEPKKAGDDLIDPRSLSRAERKKLIKKNELQHKRNMKGAN"
FT   gene            complement(<386032..>388005)
FT                   /locus_tag="KLTH0E04290g"
FT                   /old_locus_tag="KLTH-ORF9749"
FT   CDS_pept        complement(386032..388005)
FT                   /locus_tag="KLTH0E04290g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9749"
FT                   /product="KLTH0E04290p"
FT                   /note="similar to uniprot|Q05670 Saccharomyces cerevisiae
FT                   YMR232W FUS2 Cytoplasmic protein localized to the shmoo tip
FT                   required for the alignment of parental nuclei before
FT                   nuclear fusion during mating"
FT                   /db_xref="GOA:C5DHH1"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH1"
FT                   /protein_id="CAR23232.1"
FT                   /translation="MIKSTNSIYQLDYPAKSTLTPIRDSREAFFPNRGSSAYKNGSQLR
FT                   ETLPFNPYAKSMWTSECHYKASAKYPVAAKTHSIHTKPPKSRGFQRSASILISSTEPLN
FT                   LDFEKAPTKPASTSEFVGKKFFDAFYDFLGREEDYAYMTDMLNMIYRKELHHKKASGKL
FT                   MAQSSNEEILLFGNMDTISQLSRILVKSLRNYVSSCCKSGTACARWSGPDASFEIPESF
FT                   AEHFDPAEFFESHLSKIRSTYSTYFLSHRRQLELLEHLKKTKSTLFYRWYESCLDKADL
FT                   VKIEDIIAAPVKRLGEFYKDILNIIREGEDFLSGSALEKLRMFADKFHSFLSTAETLLD
FT                   EGAVAKEQAPFDSRSSNISNHLTVPLEGNSCRSSETHLSLSSSRYSDHLSVGDMDAAVI
FT                   SSHVKLNEAENEDPTLADYISRFKQVGKHMEKLEKELSDLDIAAILDQNMRQAEEWRKI
FT                   FEFEPLSQLLTEQPNVESIYTIYINKLHQQRQEVMLTKLGDLQEKVIAPLTLAKQSSKM
FT                   IQSKIQDLKELKKDYMSFLGSKDARSIKFKLIANHFQSTQRELLDGIPKYLDLISQFTI
FT                   LLMRSYNQIMMKYMEILSGGKRLLTRELQMLEKGEREQGDNFDILQSFASSRFYTKQLI
FT                   HENWNCHGRAVESRVVRKLFEI"
FT   gene            complement(<388173..>391268)
FT                   /locus_tag="KLTH0E04312g"
FT                   /old_locus_tag="KLTH-ORF9748"
FT   CDS_pept        complement(388173..391268)
FT                   /locus_tag="KLTH0E04312g"
FT                   /gene_family="HOG000074719" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9748"
FT                   /product="KLTH0E04312p"
FT                   /note="similar to uniprot|P12868 Saccharomyces cerevisiae
FT                   YMR231W PEP5 Peripheral vacuolar membrane protein required
FT                   for protein trafficking and vacuole biogenesis forms
FT                   complex with Pep3p that promotes vesicular docking/fusion
FT                   reactions in conjunction with SNARE proteins also interacts
FT                   with Pep7p"
FT                   /db_xref="GOA:C5DHH2"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016528"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH2"
FT                   /protein_id="CAR23233.1"
FT                   /translation="MSFQSWRQFQFFENTPVRDPKIGSDSPLFSDPTLSAACPALEDKL
FT                   FIVVQSRILKLVNLKSLEVELEFEAYSEGFQVTYLRFVADNYIVSAAEQLGRPCSIKIW
FT                   KLDKQPKNEFDYHSLIEVKNGKNTFPLSAISIWHDLTCLAIGFVNGRIVLIRGDIIHDR
FT                   GSRQRVIYDDPNKEPITGLMFDRDCRTCFASTTSGIFLFNTTGRNNGKPDTILNGSAGL
FT                   DLNCSCLSCDGQEFICCSAKSLDFYKSNGEKRSLVMELPLIKRIYAVDQHHILILLGVQ
FT                   TSNNTALNVANITTTNNRVIVLDIQNKLIAMNTLISGSVLDIFSNVFSGDPSVLLLTSD
FT                   GTMHKINEKPIKEKLQIVEQKELFPVALDLAQQCNLSAIEIEKIRKKFAEHLYKINLKT
FT                   EAIEQYLQCLNVTETSEVIAKFGINSTSDNSSVSDLSYYLLSMMKKGMSSSDHVTLYLI
FT                   ALIKLKNEEGIEQFVTHFSRSGQYLEEEEPEEDWKQDDESYYFSDTELFDLDLILRLLQ
FT                   DFGFFLQSFKLARKFSKDPAIVVEILIDGLKDPHSALRYIKSLPVDDTLRVLVAFSKKL
FT                   LELLPNDTNALLIELFTGKYQPLKYESVSDPVVSRREKFDKNVFYSYNSFIEYMKNVST
FT                   SKEQDITSSVPTYQPPKPTLIFTSFINQPFEFVVFLEACLGSYNEFHGFDHDKQLILTT
FT                   LYDIYLTLAKDDEKGRQQEWRDKAHTVYKESTKLATTSTASVDSSSAGRLNKAVDNSLM
FT                   MLISQVNNFEAALEGDDLQDELEFAKFGKLDLTYKFRSISLTNDAKTSLKFIEKFGEQE
FT                   PALYSMGLSHFISSKSMMKEIGGEAVFREKILNKVLEKDLMPLLDILQVLGSSNVASFG
FT                   LVQQILIEHIKSESQEIKNNKKLIQSYESELEEKESKLQSLTDDKSPAQIKLKNQTCNI
FT                   CQTALSAPLVFFKCDHIYHQRCLNEEESSESNNRFFRCPQCVVDFEASENMKRAQSETQ
FT                   IDTELLNLAMNDKDNKDRFKIVTDFIGRGGVESSFIRVQELD"
FT   gene            complement(<391495..>393723)
FT                   /locus_tag="KLTH0E04334g"
FT                   /old_locus_tag="KLTH-ORF9746"
FT   CDS_pept        complement(391495..393723)
FT                   /locus_tag="KLTH0E04334g"
FT                   /gene_family="HOG000172453" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9746"
FT                   /product="KLTH0E04334p"
FT                   /note="similar to uniprot|P23561 Saccharomyces cerevisiae
FT                   YLR362W STE11 Signal transducing MEK kinase involved in
FT                   pheromone response and pseudohyphal/invasive growth
FT                   pathways where it phosphorylates Ste7p and the high
FT                   osmolarity response pathway via phosphorylation of Pbs2p
FT                   regulated by Ste20p and Ste50p"
FT                   /db_xref="GOA:C5DHH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH3"
FT                   /protein_id="CAR23234.1"
FT                   /translation="MDDSETYVSHFLQELNCHQYLDSFKNWNLTSQDALAHIDKEILVE
FT                   VGVKKIGDRIRILKKCQSLRGSRTRPSHEVRELLQKFQALSVAQLTTTEELVTDKHSAI
FT                   FILNDGSAKKVNVNGCFNADSIKKKLIKKLPSEFIACTPQGEETRNSQDYDVFVVDYVK
FT                   NVLHLLYDVELVTICHSVDRVEKNRLIFVSKDQTPSDRATLTSKKLYLKTLSVIHQLGS
FT                   LSALAGTTSSARAKIHAVNELAAPGTAAGAPNSLRIENNKDTIRQIFNQRPPSELISTN
FT                   LSEYFPHTDAKSLRKTIGNSVRQSIRLSSINGSATPVGGNNVGDIWVNNSNAVGKALLQ
FT                   SLDGNHHVPTGSSLSKRRTQIEEDTLNFKAPESAHGESEVSKNSEGTTERRTGPTKRPG
FT                   LISHAEYLRQGPRKQKSSERIELLRVADSDNDEEDEDMISLPTKIATPKNWLKGARIGA
FT                   GSFGSVYLGMNAQTGELMAVKQVELQPTAVTAGVVSVSDEIKKQYNQNANASAVKNSSQ
FT                   VHRKMIDALQHEMGLLKELHHENIVTYYGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPF
FT                   EEPLIKNFTRQILIGLSYLHRKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQQ
FT                   QNKRASLQGSVYWMAPEVVKQVVTTKKADIWSVGCVIIEMFTGKHPFPDFSQMQAIFKI
FT                   GTNTHPESPSWASDEAKNFLLKAFELDYRQRPDSIELLQHAWLDTSIM"
FT   gene            complement(<394583..>395877)
FT                   /locus_tag="KLTH0E04356g"
FT                   /old_locus_tag="Klth0E.mRNA.at.341.m"
FT   CDS_pept        complement(join(394583..395791,395863..395877))
FT                   /locus_tag="KLTH0E04356g"
FT                   /gene_family="HOG000154825" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.at.341.m"
FT                   /product="KLTH0E04356p"
FT                   /note="similar to uniprot|Q6B1J7 Saccharomyces cerevisiae
FT                   YLR360W VPS38 involved in vacuolar protein targeting"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH4"
FT                   /protein_id="CAR23235.1"
FT                   /translation="MYLLRRRLRHLKTISIFNVSLIKEQGNHAIEVKAVPSVFVVIEDL
FT                   KGRCLYVSEVQAGTQLHAQFNELPQLSYTISKVRLKVIGRVPGDLLADDSEEAWVVLAD
FT                   HVLSFNQLHHVPDNDLPLNFFKGVNVPVLHFSDGIFTLNGAIKSIVDSRDKASTSCTST
FT                   RAKSFNFNSLLKLNKLLEYSTQLHSELCELSNSISSEVPDQGECYSKNLLIDARKNLEE
FT                   TIRLRQERIKYLQDAVHGRPSAPRNSAEDAKVNEEYGSTFFEYSDTKHHLKTLKARRMQ
FT                   QLFQAMQETDLFTSNGLVIPDSEQSVFYAQLRKLNATSLARDSNRISTNTLLGHYLLFL
FT                   HILSEKILFVRLPHRLSYYGSTSVINNQLPLYLTSSPTQQHVADFERAVDLFNLDIMQV
FT                   RQFLERHR"
FT   gene            <396019..>397332
FT                   /locus_tag="KLTH0E04378g"
FT                   /old_locus_tag="KLTH-ORF9741"
FT   CDS_pept        396019..397332
FT                   /locus_tag="KLTH0E04378g"
FT                   /gene_family="HOG000185308" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9741"
FT                   /product="KLTH0E04378p"
FT                   /note="some similarities with uniprot|P40544 Saccharomyces
FT                   cerevisiae YIL023C Hypothetical ORF"
FT                   /db_xref="GOA:C5DHH5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH5"
FT                   /protein_id="CAR23236.1"
FT                   /translation="MMYAALLSLLPKVMAHPGHHHGTSVMHGEVKDSVIAQFLFPYSAR
FT                   VNALLATVYISAAPCLIVTAIPELRKAKRGSLLSLLMSFAFGTLMGDIILHLLPEIFSE
FT                   AIDVNEEAQWLKFLDGLPLQDSTNGHVKDLLVTLKPSLTSHNSPSKMRTMALGFLVFCG
FT                   FVIFMVIDKGLKIANSGGEHEEGHHHGHSHIFSVQHEKEAEEGVEAVSSGKVVTSDEGM
FT                   NVVRRSKGNKTEGSDVDDDIGHERAPPQSSSLKASAYLSLVSAFAHNITDGVALASAFY
FT                   KSKHTGIVTTLAVLMHEIPHELGDFAILLASGINFNQALLLQLVGAFGALIGTLCGCIA
FT                   NEMAAGTADTGIASRIIPEIGFPTFVAHASSKWPISAGELMLPITTGGLLFISTVGVVP
FT                   ELLKVTGSSKKNELTNSLRHLGSVFAGFVLMAWMGLNE"
FT   gene            <397784..>399256
FT                   /locus_tag="KLTH0E04400g"
FT                   /old_locus_tag="KLTH-ORF9738"
FT   CDS_pept        397784..399256
FT                   /locus_tag="KLTH0E04400g"
FT                   /gene_family="HOG000162199" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9738"
FT                   /product="KLTH0E04400p"
FT                   /note="weakly similar to uniprot|Q08777 Saccharomyces
FT                   cerevisiae YOR306C MCH5"
FT                   /db_xref="GOA:C5DHH6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH6"
FT                   /protein_id="CAR23237.1"
FT                   /translation="MSLPGQQEAPGLTESSKVLANISTSQGKKREEVVEDYSVPDEFEY
FT                   AEGGWKAWMAILGSFLGFFPTWGFFYTAGVMQNYIAKNQLATASTSTISWVFSVYNFCL
FT                   LGSFVFSGLYFDLNGARRPLILGNVMFLTGMFALGNCTKVWHFIVCLGILVGMGSGISS
FT                   SPLIGVVCHHFNRRRGIATALAMNGGSIGGVVIPLMLRSLFEKSGYPWAMRSLGFLSTG
FT                   FLVCSVFLAREDPAKLHKPQPGTLLRNTSGPSFVSSFLSYLSGSFDYKALKEPKYLFCT
FT                   LGCCMAELSTGATLTYITSYCEVVGYRDEDAFYIITVLNALSIVGGYICSLLADVLFGR
FT                   FNVMILINLLLGIIGFVMWLPFGSKGSGIMYAYGAIYGALYGSMLNLAPVCCGEISRVD
FT                   EFGRRYSTMYALVGFTFLAGIPISGAIIGEGTLESYDNVIIFFSAVSIAAGVFYLLSKC
FT                   FALQNPLKKSDSKESDFPGTLALLVKSSLRRF"
FT   gene            <399577..>400280
FT                   /locus_tag="KLTH0E04422g"
FT                   /old_locus_tag="Klth0E.mRNA.at.340.p"
FT   CDS_pept        join(399577..399762,399861..400280)
FT                   /locus_tag="KLTH0E04422g"
FT                   /gene_family="HOG000155582" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.at.340.p"
FT                   /product="KLTH0E04422p"
FT                   /note="similar to uniprot|P40543 Saccharomyces cerevisiae
FT                   YIL024C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH7"
FT                   /protein_id="CAR23238.1"
FT                   /translation="MTLKQLRIPNYALGDISQKDKVIVTGNFDNWEHTKFVLKRNSEDD
FT                   SFEVEVPAVSSGVLTFKFVINDRDWVTLPYFDTEKDGNGFLNNVLKWQDADDERLEDIT
FT                   ISSTIHSQNNSPQDQCVHVTTAGCENLADHDYIQVSSQDELSSTENVDLVVHCSSSSVG
FT                   HENNREPSHEQSPDGDASQRRLQSLVSVVKRVKMYWSG"
FT   gene            <400548..>403871
FT                   /locus_tag="KLTH0E04444g"
FT   CDS_pept        400548..403871
FT                   /locus_tag="KLTH0E04444g"
FT                   /gene_family="HOG000141696" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0E04444p"
FT                   /note="similar to uniprot|P40541 Saccharomyces cerevisiae
FT                   YIL026C IRR1 Subunit of the cohesin complex which is
FT                   required for sister chromatid cohesion during mitosis and
FT                   meiosis and interacts with centromeres and chromosome arms
FT                   essential for viability"
FT                   /db_xref="GOA:C5DHH8"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013721"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR020839"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH8"
FT                   /protein_id="CAR23239.1"
FT                   /translation="MFTRLNVTTAFLGRRICIKRLVAESMSEVRRSIRIRDKSSRTDAE
FT                   DEDADSLGLVHADDRIDLGSESEEDDDEDANERDDEDYQDTAIKKRKRSASEAGTDSRR
FT                   GAKKSRLPSASRGSKRSREAFQQLQQDFEPTQLFQALAESEDISVEETANEWLDLYSES
FT                   RERALQEFINFILNSCGSLVQVQEHDVTSNETANETVAEIQLMFQKQGLHENHLRMSKT
FT                   NKKRAKFKPLYQNFTEFMHKVMELSNERGLLYEESPRESGESNSLILDILTWLSSFSVS
FT                   KLRCLRHAATLCMYSFQDYLTESSVILENNYLVKLRRQLSMEQKKKRANKKTAEKLEST
FT                   IAEIQETKSAVENSIDNIIKLAFVHRFKDVDEAIRADSISHLATWLENYPEYFMKVTFL
FT                   KYFGWLLSDSSAMVRLQVMKVLSEVVKFDIRRSKHKVGSSALRQFFERFKQRILEICIK
FT                   DVDMQVRLTAIQVLTQINSFGYLEDTEISKISSLIFDYQEINIASSAKHAKFLASVAKF
FT                   FATVQKDKIDQALEAHSFPRKLRGLEPEDVVRVGFFMRSLITSLSAYLKYSQDDTSVQE
FT                   RTHLLFQASEFLQPFFGDSISSMCKLLLYDGDLSEFAEISENDDSNEKLLLLPGDENST
FT                   IQFMIVLNGLCHGGVNNKSAKKSDVISAVLPHLEQLFATLPLHSAVITHHLFGIYMLFS
FT                   FEDWGSAGLEGDFQKITEVIVKNFDRMQFSNDKDDIKRLSYAKLLQFHQQLDLPNLNEV
FT                   WKDQVGHVRIPLQVFLETRGDDFEGQGLNELYRTVFESYVNKLVLLGKVVPLDFSKELM
FT                   QLFFSKVVGKLPQALEFLEMETLKSVDFKFVALVVLWNLQRWYEILQNTSDASPISRGV
FT                   LDMVIAMVKELSAILVTLATTQSSTLQARLHVEWRICDALADILTAFKMFELNLPEKDY
FT                   EWKHVVSREYAVAVKRDLAEVFLEVFLYLEGLWAKELDVQLDRFENEDVDLNNISDHTF
FT                   EGAEQELLVYVVKLKSLLKLGLIEDPALEKRISLNKSILGQDFQSIIDEDAFSTEPGPK
FT                   RSLASANHERQIFENRELNSPEELDPIQESSDPPEVPRLADPHTAQEDTEPHGYSSEFL
FT                   "
FT   gene            <404040..>404477
FT                   /locus_tag="KLTH0E04466g"
FT                   /old_locus_tag="KLTH-ORF9731"
FT   CDS_pept        404040..404477
FT                   /locus_tag="KLTH0E04466g"
FT                   /gene_family="HOG000248321" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9731"
FT                   /product="KLTH0E04466p"
FT                   /note="similar to uniprot|P40540 Saccharomyces cerevisiae
FT                   YIL027C KRE27 Protein of unknown function null mutant shows
FT                   K1 killer toxin resistance"
FT                   /db_xref="InterPro:IPR018937"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHH9"
FT                   /protein_id="CAR23240.1"
FT                   /translation="MPLVSKALLVLAIFQLLHSGFSSHEFLTIKKRLVTQSNLDVAHLQ
FT                   LPKDVQLEAMSGVILLILSVFMSFSKLCYLSLGGKLKVLRVNEYLKEINMNKATSDKNL
FT                   AGCNPYGEMCYTPNLVDVHAKREQVAQWNKIRDPELFAKKD"
FT   gene            complement(<404527..>404832)
FT                   /locus_tag="KLTH0E04488g"
FT                   /old_locus_tag="KLTH-ORF9730"
FT   CDS_pept        complement(404527..404832)
FT                   /locus_tag="KLTH0E04488g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9730"
FT                   /product="KLTH0E04488p"
FT                   /note="some similarities with uniprot|P14724 Saccharomyces
FT                   cerevisiae YFR036W CDC26 Subunit of the Anaphase-Promoting
FT                   Complex/Cyclosome (APC/C)"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI0"
FT                   /protein_id="CAR23241.1"
FT                   /translation="MIRREPTVIGLSPEDLAELEEELEEFKLQREIKAQQRNLQRSATV
FT                   LAEADLLESEAPVRDDTTHESPLQKPLGQQAPHRPPSQSVNAGPHAPRSNPFFSQQ"
FT   gene            <405275..>409048
FT                   /locus_tag="KLTH0E04510g"
FT                   /old_locus_tag="KLTH-ORF9728"
FT   CDS_pept        405275..409048
FT                   /locus_tag="KLTH0E04510g"
FT                   /gene_family="HOG000142338" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9728"
FT                   /product="KLTH0E04510p"
FT                   /note="weakly similar to uniprot|P40318 Saccharomyces
FT                   cerevisiae YIL030C SSM4 Protein involved in mRNA turnover
FT                   integral nuclear membrane protein"
FT                   /db_xref="GOA:C5DHI1"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI1"
FT                   /protein_id="CAR23242.1"
FT                   /translation="MGVAAEESSGENEHSAALNASCRICRGENTSDSPLFHPCKCRGSI
FT                   KYIHESCLLEWVASKNVDLARPGANIKCDICHYSIQFKTLYDENMPDRIPVGLVIRTTL
FT                   GSVFKEAQAVIRIVMATTLLVVGIPLAWNTLGKLIAMLLFGGSLPIQGDFWKSLLYGFE
FT                   ATVPENPSKLNIALQLLKNYRFSLTQIVFLTVIHIALYFQYDMVVREPIFREMVYHNIG
FT                   PRFNGEELATSLHNAMQFIRANEERLRAQRAVPLQEDLLRGQDLGFGNEGIQAGNDEHN
FT                   DDRHNSTHRNRGSEDGIFYNGEDDEDDDDYEPNEAVASEESIASSSSSDHEIDDEERQQ
FT                   LDENNGVFNFTMNHGRDNDLEFMVQNAQQNAEREQHEEPAVGPGRNDGAADPEEAWNQE
FT                   RPAIFGVQLRFRNLPFYFLAATAFLAIYLYLTYAIPTFLGNLLLTIYSKVFVWAFRGFI
FT                   KLVEISRTPTLYKELSRRFPRISSLNLWLNTKAMQIFSFISYVYTNYVDYNNKTSTVAQ
FT                   SIPALATYSTLLGILCASTGIMSRGYGPKNGMKNSNLRFVFHLFFAIRCSLKVFLLFGI
FT                   ELVGFPVLAGLMIDFSLISPCLTSHNKFLLIGGLDIWSPAKWVLYWVIGTFYMCWFAKY
FT                   VAMIRKYIIRPGVLFFIRSSDDPNIRILHDSLIHPMRVQISRLLLSIMLYALFIVIGFG
FT                   FHTRILFPLILKSKLLPFETAQDELFFYGIAAILHQPMRITEANKSFNLYVRQYWTKAF
FT                   DLSCKKLRLSSFILNKDISTERGYIVYRNLFYRFFFSEKAKWSNPDLYVDPKTPAQADE
FT                   LFKANLEIHAYFVPDGTLMRVPANDLISRNYVQTLFVPVTKENKLLKPLDVESIKERNK
FT                   ENAGDYSYLDDQSTEFDAYTVVYTPPNFRSRFSTLLLLIWVFASVLCMTLALFFNFVGR
FT                   LMLVAVLSPFSGNEKARGYLLAYRKFSSVSLWPIAIGAWITMRGTELFHKFKMTRVVHD
FT                   EYAVHPEAGDGAENDGGVREPENLEPAADFEENEEGANAPLPQDRLQWQGRLLFILLGK
FT                   MQAIKYCIVLYYNFAFVSLFVEIFILRIEKPWKIDTFFTPNSWAEFGTVVSERLVTFGL
FT                   FFTWFVLASIIDARKSIQRMLQLGQDERLKSLKILVIDLVKECVLTAGLSFALQMALCT
FT                   YEYLLKGPPSYESVLSAYSFLRTVRPSLSSSEVPWTIPHKLFFVIPPVLSGTFYLPKIF
FT                   KSVSDFIKKSVVNTREQVYGRGKTLTNLPEGL"
FT   gene            complement(<409294..>412407)
FT                   /locus_tag="KLTH0E04532g"
FT                   /old_locus_tag="KLTH-ORF9724"
FT   CDS_pept        complement(409294..412407)
FT                   /locus_tag="KLTH0E04532g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9724"
FT                   /product="KLTH0E04532p"
FT                   /note="weakly similar to uniprot|P40537 Saccharomyces
FT                   cerevisiae YIL031W ULP2 Peptidase that deconjugates
FT                   Smt3/SUMO-1 peptides from proteins plays a role in
FT                   chromosome cohesion at centromeric regions and recovery
FT                   from checkpoint arrest induced by DNA damage or DNA
FT                   replication defects potential Cdc28p substrate"
FT                   /db_xref="GOA:C5DHI2"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI2"
FT                   /protein_id="CAR23243.1"
FT                   /translation="MGRRPGRLGGMAPIDTLSSSMSRRDPVPTRYTSHRKDPKVIQELN
FT                   RASVRDFMPDVSANSSLRASQAHESGDRSPIESPVTIESDAPVHTTPARKRQKISASLI
FT                   LSSPEISSDAAPGAQVCKSSGMVRVVIRTGKEIVKSNSVLKIVNDDEGVRFSIRWKGAD
FT                   IEGSQVDFLRDCEKVYFDALKSHMGVLLKHSRCVDLDDTCKTEKTKILLWSSNVGADVN
FT                   LIRLKEVIKNSMIDSAVLSNRLAILGTMKQAVARQELEAFSKRRFWEKPEFQSLGKRHS
FT                   KSSKSSSGSSGFKITVPHETEPDKDDKASHNTIPSTQFYTDGNTGSPPQSSNSLREHTL
FT                   SSLRRSTRTTKASSPDGTSFDDSCTVYEKPEVFKPSLFYKFDDNTTLSVTNQDFKCLYN
FT                   HDWINDSILDFFVKYWTEDSIRRGTIVREKVHVLSSFFYTKLISNADNYYNNVKKWVNH
FT                   TGLFKKQYLVMPININYHWFGCIIENLPSLFSFLKREREFKEKHQKSADGDDIENSDDL
FT                   SVTSPIVTILVYDSLRQTHSREVEPIKEFLIAYAADKYGLEVSRNQIKMKSCLVPQQPN
FT                   MSDCGVHVILNTRKFFENPTKTFELWKSAKSKNKTASKVINEYFEKKERINARPDLRSV
FT                   LWKLQEKQIEFNKLNGVTETSEDDGIKSDGEHSDIEIIENYEQPATRPEQTSGQINEEL
FT                   SKPNEGQYSTPEIPESKDQLCASSKKDAPTLNSELPKTDMITGPETSAGGVEGESKAYK
FT                   SQDRRFLESSPELLPAKLSEASSEHPAQDKGSVSKYFAKAKSKHGTQETRDDIEASALG
FT                   LDSTSGASYNVILKHKDAPDPDKITCGTGTLENDEDRDLRAPSQGSKVLGSPSSTNGIA
FT                   ILGSQAYEENKGNGGLTSSPDCNSDDDVRLVSTNSAGSLDLSGQHSSQGSFIKQLSPVR
FT                   KFQAAMSKYSGAADEEVSDRTDSIHQSPHLKALDAPLSRRSVIQDQVQDIDDGLSTKKF
FT                   AIDVDRSGSEESCDGEQESSTRRSGVHKFRNSLGCSPKLEHLGKPGKG"
FT   gene            <412896..>414335
FT                   /locus_tag="KLTH0E04554g"
FT                   /old_locus_tag="KLTH-ORF9721"
FT   CDS_pept        412896..414335
FT                   /locus_tag="KLTH0E04554g"
FT                   /gene_family="HOG000208172" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9721"
FT                   /product="KLTH0E04554p"
FT                   /note="similar to uniprot|Q01852 Saccharomyces cerevisiae
FT                   YIL022W TIM44 48.8 kDa protein involved in mitochondrial
FT                   protein import"
FT                   /db_xref="GOA:C5DHI3"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI3"
FT                   /protein_id="CAR23244.1"
FT                   /translation="MVFNIAMSISETLLVVSINASDPNVLIGAVILVSLDTVILTVKKF
FT                   DILISYVLNSINQKGVARGKFRMLRPGRPLKSVVIRRNLAQTFKACQGNPRSPLQIFRE
FT                   TFKQEWKKSQELQDNIKALQDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDS
FT                   VEKIAAKAWESEIGKSTRQAVNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGF
FT                   ISKEQRRLKLEQDIASGKRPKAVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGR
FT                   KLQDVKQKLWDESENPLIVLMRTIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSH
FT                   LREYIIPEVLEAYVKGEEQVLKQWFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDI
FT                   VSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENID
FT                   DKETEGWKILEFVRGGSRQFT"
FT   gene            complement(<414398..>414745)
FT                   /locus_tag="KLTH0E04576g"
FT                   /old_locus_tag="KLTH-ORF9718"
FT   CDS_pept        complement(414398..414745)
FT                   /locus_tag="KLTH0E04576g"
FT                   /gene_family="HOG000141889" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9718"
FT                   /product="KLTH0E04576p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI4"
FT                   /protein_id="CAR23245.1"
FT                   /translation="MNGLKPMTGAQKVAVPDLRFEQTFQRALRREASKNQKATSQGHST
FT                   TDADATISASVICKVVLRDVLLMPFLQGILWTSALIALKPWLHMVRIRGQLVGHRIYEM
FT                   VLGKGLVRKRA"
FT   gene            <415348..>416334
FT                   /locus_tag="KLTH0E04598g"
FT                   /old_locus_tag="KLTH-ORF9717"
FT   CDS_pept        415348..416334
FT                   /locus_tag="KLTH0E04598g"
FT                   /gene_family="HOG000230844" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9717"
FT                   /product="KLTH0E04598p"
FT                   /note="similar to uniprot|P16370 Saccharomyces cerevisiae
FT                   YIL021W"
FT                   /db_xref="GOA:C5DHI5"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI5"
FT                   /protein_id="CAR23246.1"
FT                   /translation="MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLA
FT                   IDSVEVETNTSVLADEFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAV
FT                   GESESTTNVYAKDLVIVSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGI
FT                   SKEHAKWSPAAAIEFEYDPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYN
FT                   AKPTTFYMNVETVGSLTVDQVVIRGMKTLQDKVADILFSLKKMDQDKVNFGGTAGMVDQ
FT                   DGGAMPVEPDSGFAYGSGGPSSGSGMGGGPGAPFGHTGPSSGFDDAW"
FT   gene            complement(<416419..>417219)
FT                   /locus_tag="KLTH0E04620g"
FT   CDS_pept        complement(416419..417219)
FT                   /locus_tag="KLTH0E04620g"
FT                   /gene_family="HOG000172261" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0E04620p"
FT                   /note="highly similar to uniprot|P40545 Saccharomyces
FT                   cerevisiae YIL020C HIS6 Phosphoribosyl-5-amino-1-
FT                   phosphoribosyl-4- imidazolecarboxiamide isomerase catalyzes
FT                   the fourth step in histidine biosynthesis mutations cause
FT                   histidine auxotrophy and sensitivity to Cu Co and Ni salts"
FT                   /db_xref="GOA:C5DHI6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI6"
FT                   /protein_id="CAR23247.1"
FT                   /translation="MTRFVGCIDLHNGQVKQIVGGTLKEDQKEDLKTNFVSQHSSSYYA
FT                   KLYRDNEVSGCHVIKLGPNNDEAARLALASVPGFLQVGGGINYDNCQEWLEIASKVIVT
FT                   SWLFNSNGEFQLANLEKISSRCGKDRLVVDLSCRKVEDGTSHKWVVAMNKWQKLTDLEL
FT                   NHDTFSRLSQYADEFLIHAADVEGLCRGVDEALVAKLYEWTEHLPHLKIVYAGGAKSIQ
FT                   DLALMNRLSHGKVDLTYGSSLDIFGGNLVAFKECCEWNHRDHAQ"
FT   gene            <417387..>418391
FT                   /locus_tag="KLTH0E04642g"
FT                   /old_locus_tag="KLTH-ORF9714"
FT   CDS_pept        417387..418391
FT                   /locus_tag="KLTH0E04642g"
FT                   /gene_family="HOG000066124" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9714"
FT                   /product="KLTH0E04642p"
FT                   /note="similar to uniprot|P40546 Saccharomyces cerevisiae
FT                   YIL019W FAF1 Protein required for pre-rRNA processing and
FT                   40S ribosomal subunit assembly"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI7"
FT                   /protein_id="CAR23248.1"
FT                   /translation="MSDDDYAKQLEIQRKAFEAQFGSLEAMGFEDKTKNETQENSSSVE
FT                   SQESEQEDGDNSSDEAESDASFHGFSDDESSAKQKAAHGASRAPRVIKFGGVTDAYVPP
FT                   SKKEQKLLRLGKAPVRKESESEEDGRSGARHGGSDGEGNVEAENLHNDLELQRFLKESH
FT                   LLSAFGSTPSGADLTLQTMDNVEYKDDAVFGKARARTLEMRLQNLSSANGRSRKLEKVP
FT                   MNIRKGMVQKHTKRIQQHEREARDAGVVLSKVKKGEFRKIDRTYRNDIERRIGSGQSAV
FT                   DPQRIKHRQRGLQVNSVGRSTRNGLIISSQEIKAITGSSGPKRAGGSKHKRRR"
FT   gene            <419041..>420441
FT                   /locus_tag="KLTH0E04664g"
FT                   /old_locus_tag="KLTH-ORF9709"
FT   CDS_pept        419041..420441
FT                   /locus_tag="KLTH0E04664g"
FT                   /gene_family="HOG000184666" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9709"
FT                   /product="KLTH0E04664p"
FT                   /note="some similarities with uniprot|P07270 Saccharomyces
FT                   cerevisiae YFR034C PHO4 Basic helix-loop- helix (bHLH)
FT                   transcription factor binds cooperatively with Pho2p to the
FT                   PHO5 promoter function is regulated by phosphorylation at
FT                   multiple sites and by phosphate availability"
FT                   /db_xref="GOA:C5DHI8"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI8"
FT                   /protein_id="CAR23249.1"
FT                   /translation="MNEAESFDSKSILDQVDQYLSDQSVRQGEQPGAAPFQELSFHALP
FT                   HGHEHNQDAEHGSEKGREHGHSFSQGDHSAHLGHGFQLELEVATHSHVRPDMVFSPVIS
FT                   PVVAPQHPSHTPFLRSQASGMSGGASTKPSFSPLSSPAIDAQFPEYPGAKRGSSSSSSR
FT                   GKKTPLSTPALTATTFSNSSGSKVAKNSPQLSSRRSALSKRKSAATNWDDMFKLPDSSI
FT                   PPPSVPLFGSAQQQQQQQQQQQQQQPQNTSHLHTHSLSESADDTVSGSCSSASSVRARA
FT                   SGTPALPSRDPDGAGHNDFNVTPATLMNYPKIILPSNSRDVGSHAQSPVRDQSTYAHSG
FT                   NGHVIMATDSPVIQAKNPNLPLSRHASNTSIPTRSTPELRPVRKSSKSSLVDSGPDPDE
FT                   DEQAKKEVHKAAEQGRRNRLNTALAELHTLVPAEMKEAVLIPSKATTVEMACTYIRQLI
FT                   QRVEELQR"
FT   gene            <420873..>421382
FT                   /locus_tag="KLTH0E04686g"
FT                   /old_locus_tag="KLTH-ORF9704"
FT   CDS_pept        420873..421382
FT                   /locus_tag="KLTH0E04686g"
FT                   /gene_family="HOG000001146" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9704"
FT                   /product="KLTH0E04686p"
FT                   /note="weakly similar to uniprot|P00127 Saccharomyces
FT                   cerevisiae YFR033C QCR6 ubiquinol-cytochrome c
FT                   oxidoreductase subunit 6 (17 kDa)"
FT                   /db_xref="GOA:C5DHI9"
FT                   /db_xref="InterPro:IPR003422"
FT                   /db_xref="InterPro:IPR023184"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHI9"
FT                   /protein_id="CAR23250.1"
FT                   /translation="MISSITEFLEEVKDAFVPTVAKAEEQAEESTDDDKSENDDKPEDD
FT                   GEAAEGEAADAESADADAEAEGESDGDEGEDEDEDEDEDEDEDEDEDEEEQVDQMDALR
FT                   EECKNKEEAKPLVHHYMECVERVHKAQEDPGYADSEHKEDCVEEFFHLQHYIDGCVSPT
FT                   LFDRLK"
FT   gene            <422806..>422994
FT                   /locus_tag="KLTH0E04708g"
FT                   /old_locus_tag="KLTH.mRNA.196VL.p"
FT   CDS_pept        422806..422994
FT                   /locus_tag="KLTH0E04708g"
FT                   /gene_family="HOG000212220" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.196VL.p"
FT                   /product="KLTH0E04708p"
FT                   /note="highly similar to uniprot|P05747 Saccharomyces
FT                   cerevisiae YFR032C-A RPL29 Protein component of the large
FT                   (60S) ribosomal subunit"
FT                   /db_xref="GOA:C5DHJ0"
FT                   /db_xref="InterPro:IPR002673"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ0"
FT                   /protein_id="CAR23251.1"
FT                   /translation="MSKSKNHTAHNQSRKAHRNGIKKPKTYKYPSLKGVDAKFRRNHKH
FT                   ALHGTAKALAAKRAEKK"
FT   gene            <423242..>424117
FT                   /locus_tag="KLTH0E04730g"
FT                   /old_locus_tag="KLTH-ORF9698"
FT   CDS_pept        423242..424117
FT                   /locus_tag="KLTH0E04730g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9698"
FT                   /product="KLTH0E04730p"
FT                   /note="weakly similar to uniprot|P43607 Saccharomyces
FT                   cerevisiae YFR032C Hypothetical ORF"
FT                   /db_xref="GOA:C5DHJ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ1"
FT                   /protein_id="CAR23252.1"
FT                   /translation="MSPTQPNPAAALSGSAEPQTKRIYISNLDFSTTEEELEQFLQEFR
FT                   VVSVLIPSQTVRGFRNSTVRPLGIGYADFASAADALQAVENLNGKQLRERTLKIKMYVP
FT                   YSPRARAERRKEKRKVPAPQAEENPDAAPQDAQQPQPPAPAEEPTSKDTVYCAYLPSKV
FT                   TDVELREFFADYQPQDIYVYRTNGSRRKVYFHRRFTAALVTLGGEAELANAIETLGTRR
FT                   LMGKKITLRPARLSKVEEVQHAAARKLELEQIQQQTRQIAEHAMAMEEHRQQEAEIPAA
FT                   ETPDDVAATA"
FT   gene            <425094..>426160
FT                   /locus_tag="KLTH0E04752g"
FT                   /old_locus_tag="Klth0E.mRNA.366.p"
FT   CDS_pept        join(425094..425097,425400..426160)
FT                   /locus_tag="KLTH0E04752g"
FT                   /gene_family="HOG000232983" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.366.p"
FT                   /product="KLTH0E04752p"
FT                   /note="highly similar to uniprot|P05736 Saccharomyces
FT                   cerevisiae YIL018w RPL5A and highly similar to
FT                   uniprot|P05736 Saccharomyces cerevisiae YFR031ca RPL5B
FT                   Protein component of the large (60S) ribosomal subunit"
FT                   /db_xref="GOA:C5DHJ2"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ2"
FT                   /protein_id="CAR23253.1"
FT                   /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDFAERHGYIRGVV
FT                   KQIVHDAGRGAPLAKVVFRDPYKYKLREETFIANEGVHTGQFIYAGAKASLNVGNILPL
FT                   GSVPEGTIVSNVEEKPGDRGALARASGNYVIVIGHNPDENKTRVRLPSGAKKIINSSAR
FT                   GVIGVVAGGGRVDKPLLKAGRAFHKYRVKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKA
FT                   STISRGAVPGQKVGLIAARRTGLLRGSQKTQD"
FT   gene            <426535..>430047
FT                   /locus_tag="KLTH0E04774g"
FT                   /old_locus_tag="KLTH-ORF9690"
FT   CDS_pept        426535..430047
FT                   /locus_tag="KLTH0E04774g"
FT                   /gene_family="HOG000163792" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9690"
FT                   /product="KLTH0E04774p"
FT                   /note="similar to uniprot|P38989 Saccharomyces cerevisiae
FT                   YFR031C SMC2 Component of the condensin complex essential
FT                   SMC chromosomal ATPase family member that forms a complex
FT                   with Smc4p to form the active ATPase Smc2p/Smc4p complex
FT                   binds DNA possibly in the cleft formed by the coiled-coil
FT                   of the folded dimer"
FT                   /db_xref="GOA:C5DHJ3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ3"
FT                   /protein_id="CAR23254.1"
FT                   /translation="MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAI
FT                   CFVLGISSMATVRASNLQDLIYKRGQAGVTKASVTIVFTNDDKANSPIGFESYPKISVT
FT                   RQIVLGGTSKYLINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSEILS
FT                   LIEEAAGTKMFEDRREKAERTMNKKETKLQEIRTLLIEEIEPKLNKLRNEKRAFLEFQE
FT                   TQSDFEKTSRIVNAFTYSTLAQSRKNFEETFKSNESRIEQLEEAIQKTRQGMTNLEEDL
FT                   DVARTQKRNEMGKNGKLGQLEALENQLNNDLSRLKASLTITTDNLNEENVRRESLERSI
FT                   CDYESSLEKNTTHSKNTEDEYLSLNNLVSNLEKQLQTKEELLSTLTTGISSTGATTSGY
FT                   NLQLSSAKARFNDAQVQVQRFGMKIDLLRKELSANEPKLAKAKSICEEAKKEIEAHRMQ
FT                   CSKLNAHLEKLGFNPDLFKQLKEEESTLRQSIYKLSSEMESLKRRVANIEFTYSKPSEN
FT                   FNPSSVKGVAAQLFSLDEKNYSSATALQVCAGGRLFNVVVDNEGTASQLLERGRLRKRV
FT                   TIIPLNKISARSLHQNAVKAAKELAPGNVELALNLIGYEEEVSKAMEFIFGTSLICQDA
FT                   ETAKKVTFHPRVRARSITLQGDIYDPEGTLSGGSRNNSSSFLIDIQKFNSISKKVIDLE
FT                   NKLADVIGRIKQYSEISVKTKSVQNELNLATHKLHLANRSLENNPSAQLLARNKEIQEE
FT                   IENCTESMKNGREDVRRLEGEVSRIEKDIEEFSKDKGSKLDELKNEVTSISKQIEQKKI
FT                   VLEKKEDVNQTLQLKMDQLKSDISSARDGIKESLEVSKELDEKRVQVEGNLELTSGQLS
FT                   ETKAEVLEEKKRLYEIDEEMRVLADLLRTKGEGLKNDEVELKKLSNEVSKLANSTHSVE
FT                   ERIQLLLREEQWLADEGLVSSIVVQNQGINLAEYRQRAEQLGEKFNNMKRKVNPNIMSM
FT                   IESVEKKESALKTMITTIEKDKTKIQDTIAKLNEYKRETLIKTWEKVTVDFGQVFSELL
FT                   PNSFAKLVPLEGKDVTEGLEVKIQLGNIWKESLVELSGGQRSLIALSLILALLQFKPAP
FT                   MYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMFTNANRVFKTRFQDGTSV
FT                   VSAM"
FT   gene            complement(<430153..>433263)
FT                   /locus_tag="KLTH0E04796g"
FT                   /old_locus_tag="KLTH-ORF9686"
FT   CDS_pept        complement(430153..433263)
FT                   /locus_tag="KLTH0E04796g"
FT                   /gene_family="HOG000216012" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9686"
FT                   /product="KLTH0E04796p"
FT                   /note="similar to uniprot|P39692 Saccharomyces cerevisiae
FT                   YFR030W MET10 Subunit alpha of assimilatory sulfite
FT                   reductase which is responsible for the conversion of
FT                   sulfite into sulfide"
FT                   /db_xref="GOA:C5DHJ4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ4"
FT                   /protein_id="CAR23255.1"
FT                   /translation="MGLEFSTNPFGIPSNWKESNAYTTPVTAISSVLAGNLESVFSYKT
FT                   FSEPDLLDGALKKWSSKGYTTLQFEELQLRSGAGLAPLGFARGSGHSSLYGIITPGYGL
FT                   SYFANAFTREAETKNRFLFNVGALEYNEESGQVASDFVTPVKIAASMGLPVVSPTSVKE
FT                   VKHTALLAIALAKFGKPIGAVNLFDGANYAKTVLNIDEQESQDIIGELSSSLVVGSTFD
FT                   QILDKFNEVSSAKLHNFDYHGDENAETVFVTFGCVESELFSTSLRGNTNNVGHIAIRIP
FT                   LPFDTEKFVAQIPKSAKNLVVIGQSLDGQSPTTLKSQISAALFFQKAKTVKVSEYLYLP
FT                   SFVWSADAVKQVVSTFAPEFSSYVSHQAENFIYWASDSSVNLDVASRLVHALSLVDNRE
FT                   VSFRTKFDNNANGGVFQAQFSSGKQSGSHVFSNIDSANVAVVENLSILNAFDVAKTVDN
FT                   NGVVLIITEKSIKDKDLSDSKVLAEELKIPISFLRQAVDKNLLLAFLDTETIGDKEETK
FT                   GRTASFVTQAAFWKYAYKLSVAESVRRIWSSAGSDIELLAAVLSETITTAFEVGLHEVP
FT                   AEKLSKSIPEVSPEKDEEGPLPSLLTETCFKPNPRKSEEHSEVELSSKASVAQQLSFKE
FT                   AFATESSLRPDLPMKNFIVKVKENRRVTPDDYDRYIFHIEFDITGTGLTYGIGEALGVH
FT                   ARNNQPLVREFLESYGLSENDIIQVPSKEDHDVLESKTVLKAFTENLDLFGKPPKAFYQ
FT                   SLIDFASNEDEKRKLEELVSPEGAVLLKKYQDVEYYTYADIFKLFPSARPGITDLVRII
FT                   SPLKRREYSIASSQRVHPNEVHLLIVVVDWIDNKGRKRFGQSSKYLAELPVGAELVVSV
FT                   KPSVMKLPPSPQQPVIMSGLGTGLAPFKAIVEEKFWQKQQGHDIGKVFLFLGSRHKREE
FT                   YLYGELWEAYKDAGIVTHIGAAFSRDQPHKIYIQDRIREALKELQTALIDEKGSFYLCG
FT                   PTWPVPDITKALQDIIKADADERGEKVNLDEAIEELKETSRYILEVY"
FT   gene            complement(<433487..>436198)
FT                   /locus_tag="KLTH0E04818g"
FT                   /old_locus_tag="KLTH-ORF9683"
FT   CDS_pept        complement(433487..436198)
FT                   /locus_tag="KLTH0E04818g"
FT                   /gene_family="HOG000142339" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9683"
FT                   /product="KLTH0E04818p"
FT                   /note="similar to uniprot|P40547 Saccharomyces cerevisiae
FT                   YIL017C VID28 Vacuole import and degradation"
FT                   /db_xref="GOA:C5DHJ5"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ5"
FT                   /protein_id="CAR23256.1"
FT                   /translation="MPTSTSEASTQVSDQLNALKYTLLGDTFAKWNLMVSGQDVIEKVV
FT                   DVASCGGNLAVEALDVLLSFLNFSNEIKAEMGPRYYEVVTNITQKLQISSADPDIILLR
FT                   KLQLANICAGDYEPASMVADLQTCFLDVVKYKRRRFLSSKHRMAIIVELLACLSKNDGG
FT                   LEPEVKPATQQLLLDFTRKYADQLSFRYLFEKKADHSHASNLQDYDPLRNPGIGSKLTM
FT                   PLQTCPNQVDIYDPLDRPSFAFSLNVYLRMLESSSAAFLETNNLWECGPFVLLTSSFLK
FT                   SDDLVLKCCALRFFAYPYICRQELELKREPLELWLPHLVECFNYDNIPWWFDPFDTLIR
FT                   LVDHYNETTPLNNPVSNFLFDTKTTNGIVRLLAGFLSLEQQNGSTIDIVFKLIKLCASL
FT                   TSFDEKTRKLLLVDKAILYHAESGLQSHLNLLKRFLSHKDQHLDELKDVTVPPIYDSGL
FT                   TLSWILLLKSFSRSVTALRTFLKRNKLASLLLELVKVIFSLTKSYNFDGEQLIKAEIQI
FT                   MSAALGVLSNFVVEFSNLQSFVIENGVMDIVGSILKDPFFNDKIGGSAEMPYCAASQIS
FT                   TAGVQTNALWVLRHLMYNSHNDEKLELLSIIPMEVILQFVNNRNWLVQEQCFQLLRNLT
FT                   CNSRRVVNMLLESFSDSDSSLDSSKSGGRIESTYLFEFLAHKLKMLDSNDLNQRKTLEG
FT                   VLYVIVNITATNENKRQLVIEQDELLRLIKSILAENAESDHTAHSKTDIQIASLWILTN
FT                   LIWASTTSNFHMHATEPHSVMDLDETNPTRSGGSEDMQQNKTQSQESDDPYDEDMSDSF
FT                   KEDDEENQDEEGGGSSPFADNTGLIDRFERDKQVRGASKLKISAAERCSKLVKMGFYDI
FT                   VKLKTLDTQLRVREQAKLLLFHMELLRKGVQE"
FT   gene            <436597..>437133
FT                   /locus_tag="KLTH0E04840g"
FT                   /old_locus_tag="KLTH-ORF9681"
FT   CDS_pept        436597..437133
FT                   /locus_tag="KLTH0E04840g"
FT                   /gene_family="HOG000000972" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9681"
FT                   /product="KLTH0E04840p"
FT                   /note="some similarities with uniprot|P40548 Saccharomyces
FT                   cerevisiae YIL016W SNL1 Integral membrane protein
FT                   containing a Bag domain suppressor of nup116-C lethal"
FT                   /db_xref="GOA:C5DHJ6"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ6"
FT                   /protein_id="CAR23257.1"
FT                   /translation="MDMVRSWLQSPTVKPTKDYVTSSLEPWVRKLRNDNMAMIYTATAV
FT                   GALLLVLVFKPSKSSKPKKSHKSKGKKAKNPERSVQRKPLTLEEQIEGVHQKFVNEYKE
FT                   GLDRLAKNYDAKSEKDQYQLNYYNEMLLKLVIELDGVDLVEVEPELKAKLKSRRKQVIH
FT                   EIQSNLKKLDQLKRQ"
FT   gene            <437543..>438250
FT                   /locus_tag="KLTH0E04862g"
FT                   /old_locus_tag="KLTH-ORF9679"
FT   CDS_pept        437543..438250
FT                   /locus_tag="KLTH0E04862g"
FT                   /gene_family="HOG000151757" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9679"
FT                   /product="KLTH0E04862p"
FT                   /note="similar to uniprot|P38145 Saccharomyces cerevisiae
FT                   YBR256C RIB5 Riboflavin synthase catalyzes the last step of
FT                   the riboflavin biosynthesis pathway"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ7"
FT                   /protein_id="CAR23258.1"
FT                   /translation="MFTGIVELIGTVAEYKEYDTTHSGGGGVSVTVKDASPILGDCHIG
FT                   DSIAVNGICLTVTEYSSDSFKVGISPETLRRTNVASWQPGSKVNLERAVGQDVRFGGHY
FT                   VQGHIDGTAKVVSRVAEGNSIVFGFKLHEKEFEKYIVEKGFICIDGTSLTITKVEPDGT
FT                   FYIAMIKHTQEKVVMPLKTVGDEVNIEVDLTGKVIEKQVVLQLQEQISNEHSPLAILVD
FT                   KLVEAKVKKFLSK"
FT   gene            complement(<438303..>439622)
FT                   /locus_tag="KLTH0E04884g"
FT                   /old_locus_tag="KLTH-ORF9676"
FT   CDS_pept        complement(438303..439622)
FT                   /locus_tag="KLTH0E04884g"
FT                   /gene_family="HOG000094268" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9676"
FT                   /product="KLTH0E04884p"
FT                   /note="similar to uniprot|P35184 Saccharomyces cerevisiae
FT                   YIR012W SQT1 Protein involved in a late step of 60S
FT                   ribosomal subunit assembly or modification contains
FT                   multiple WD repeats interacts with Qsr1p in the two-hybrid
FT                   system"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ8"
FT                   /protein_id="CAR23259.1"
FT                   /translation="MSEYPSEQEHQTGDQIPEEEFITNQEVDQEVVLDDNDNDGDFPVD
FT                   EDDLEEIDGAGEDAEDEEDTIEIDMSNNSIAYFDKHTDSVFSIFAHPTLPLVCSGGGDN
FT                   TAYLWTSHSQPPKFAGSIAHSESVIGGGFTPDGQFLITADMNGQILVHKASNGGAKWKK
FT                   CAELQEVQEVVWIKVHPTVSGVFAFGSTDGSVWCYQVDSQSGELEQIMSQFVHQSDCTM
FT                   GEFINVEQGDANLSLVTCSLDSTIIGWSCYTNQQIFKVTSSEIRGYEAPWVSLAKAPVS
FT                   MTKNTPVVACGANNGTMAILNCSNGAVLQLSIVIELQADQDELDASIESIAWSEKLPLM
FT                   AVGLVSGEVLLYDALTWRIRRKFVLPDSVTKLQFEDSAATTLLASCINGKVYQYDARTG
FT                   SEKFVCVGHNMGVLDFVLIENGKKLITAGDEGVSLVYQLP"
FT   gene            <440170..>441069
FT                   /locus_tag="KLTH0E04906g"
FT                   /old_locus_tag="KLTH-ORF9672"
FT   CDS_pept        440170..441069
FT                   /locus_tag="KLTH0E04906g"
FT                   /gene_family="HOG000066121" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9672"
FT                   /product="KLTH0E04906p"
FT                   /note="similar to uniprot|P38637 Saccharomyces cerevisiae
FT                   YIR011C STS1 Protein that interacts with the karyopherin
FT                   Srp1p may have a role with Srp1p in ubiquitin-mediated
FT                   protein degradation"
FT                   /db_xref="InterPro:IPR013868"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHJ9"
FT                   /protein_id="CAR23260.1"
FT                   /translation="MSQSVGFNWGFKPSTAENTSSAISTCKVTKPRVKRRFAGEEAASG
FT                   GSPTYNNRPRAVAKRRTAVSGIQGQPLPLSRALELMDRTQLQSTLLELVKLHPEIQSTF
FT                   MALQPPSRGLDQYVTLLRGKLEQVYANLPYSRLRDRLPDDTGEGLNDYTFVRVKSFLLE
FT                   FLNCLVDCLLESIPPQVQNPLHSLKLLDTATGLLSQLPHFSTASNNYYKNVCYEQVAEI
FT                   WSTVIRQATQDISFLGATSTVLDWLQILQKHNEKSQGKLQRPLSLLQTFQESLEPVQAP
FT                   AGISQDQQQPSNLWNNIV"
FT   gene            <441235..>441656
FT                   /locus_tag="KLTH0E04928g"
FT                   /old_locus_tag="Klth0E.mRNA.at.339.p"
FT   CDS_pept        join(441235..441294,441360..441656)
FT                   /locus_tag="KLTH0E04928g"
FT                   /gene_family="HOG000000735" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.at.339.p"
FT                   /product="KLTH0E04928p"
FT                   /note="similar to uniprot|Q3E776 Saccharomyces cerevisiae
FT                   YBR255C-A Hypothetical ORF identified by homology"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK0"
FT                   /protein_id="CAR23261.1"
FT                   /translation="MGGVQPIHYDRETVKELTKEILTASGIGAFRGAIIGLTTALLLRR
FT                   FSTVYRNVRTQVRVFYHCSWISMGAVFYADKQLIKFQNRYYENEIKRRSRILDEAAERG
FT                   IFLEEDSVVTSTTS"
FT   gene            complement(<441717..>443321)
FT                   /locus_tag="KLTH0E04950g"
FT                   /old_locus_tag="KLTH-ORF9670"
FT   CDS_pept        complement(441717..443321)
FT                   /locus_tag="KLTH0E04950g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9670"
FT                   /product="KLTH0E04950p"
FT                   /note="some similarities with uniprot|P38335 Saccharomyces
FT                   cerevisiae YBR255W Protein of unknown function required for
FT                   normal growth rate at 15 degrees C green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cytoplasm in
FT                   a punctate pattern"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK1"
FT                   /protein_id="CAR23262.1"
FT                   /translation="MKNGATEHMSSSDKLEGDEARHVSSYRISQTAKLLTNAKISLLED
FT                   LNVDNLTVGNTEKSGAATLGKVLNEQNKGRPLKILSKASRIRADRVRSYIQFYYHLIEK
FT                   EITTGGTGLYKGVEGKYNPLQVIRNRKIKKKLHENPKNEIAFMKPPVLAIRDFSKHPDR
FT                   ENQWFVGVNETTADLAWRVSHWDELRRPDGKPWFKSKSKRRSQSAAEVSRAYKGERPPN
FT                   HSRNSSSILLRQTSSNWELPQISVESVDGPVTDGPRGRESKFDKALEKTKRLSRSALQS
FT                   KSASQQHIIYDERNPDSKPLGNAHNLYLTPTEPVHHPNIADIPINSFRTRTAEERSSES
FT                   SNRASEEFLELSEPFNIPKESVLQKQYNELIYLRCTFQVVRHRQETSRIIQARTSAKAS
FT                   VFVPEDPTQICKPAEDVLHEYENELVKALKTCDIWKSRLLNDYSIRVETLISTSDRVLS
FT                   DINSTLTLRLKMLQEKMDKFGTLRRMNREPLRVFLYRVLEVAITLLFWMIWVIFIIVKS
FT                   GKIMILSLLRVVRWITW"
FT   gene            <443419..>443931
FT                   /locus_tag="KLTH0E04972g"
FT                   /old_locus_tag="KLTH-ORF9668"
FT   CDS_pept        443419..443931
FT                   /locus_tag="KLTH0E04972g"
FT                   /gene_family="HOG000214139" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9668"
FT                   /product="KLTH0E04972p"
FT                   /note="similar to uniprot|P38334 Saccharomyces cerevisiae
FT                   YBR254C TRS20 Trapp subunit of 20 kDa probable membrane
FT                   protein mutations in the human homolog cause
FT                   spondyloepiphyseal dysplasia tarda (SEDL) a genetically
FT                   heterogeneous disorder characterized by short stature and
FT                   early-onset osteoarthritis"
FT                   /db_xref="GOA:C5DHK2"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK2"
FT                   /protein_id="CAR23263.1"
FT                   /translation="MPCYFAIIGARDNPIYEAEFTSQQLNSFPPELKELNPFILHASLD
FT                   IIEDLQWQVNPQSINSGGGSGGFLRSRHSNNNGNCYLGKIDHFYGLAITGYLSYGNMKF
FT                   VMIHSSNGNGSTPAQVEDGSVKNFYQEVHELFVKTLMNPFYKLNDPITSPVFDSKVRTL
FT                   ARRYLLK"
FT   gene            complement(<443995..>445623)
FT                   /locus_tag="KLTH0E04994g"
FT                   /old_locus_tag="KLTH-ORF9667"
FT   CDS_pept        complement(443995..445623)
FT                   /locus_tag="KLTH0E04994g"
FT                   /gene_family="HOG000112286" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9667"
FT                   /product="KLTH0E04994p"
FT                   /note="some similarities with uniprot|P40568 Saccharomyces
FT                   cerevisiae YIR010W DSN1 Essential component of the MIND
FT                   kinetochore complex (Mtw1p Including Nnf1p- Nsl1p-Dsn1p)
FT                   which joins kinetochore subunits contacting DNA to those
FT                   contacting microtubules important for chromosome
FT                   segregation"
FT                   /db_xref="InterPro:IPR013218"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK3"
FT                   /protein_id="CAR23264.1"
FT                   /translation="MSRERPRSLTPQGRASQRKHGLKVQTLPLPPELKSYDSVRTTQEL
FT                   EENGEPDEYRRNNPQSSFEKDEDFKFKRHKHRNNAGTASLGERLDSLHELQNARWVDNF
FT                   NSSVNMDRRARNSQRENPSQESQRSIPALPAQSIPPSYMPYMYYYPFAPMVHPMSTSPA
FT                   RAANGEMPQYISSSQGYPNTSTQPFMPPMPPMPQPNTQLMPPPPLYPNYSSYNYYNNAN
FT                   EDVAKKSQRRREKRSSLMAQRGRRLSLLSFQENSQIISPHKDVPERDFYRHIANTSFGQ
FT                   DLQIRQLFSWCLIRCLRKWESNEHQPSREEAKSNEETYADPKKIALTIVKEFVEELRKG
FT                   KTDVNWDAEEYTDSSTEDNTQFQEEDTELRELFDEDDDDTDILHSRPRKRRRQQPLKIP
FT                   NEKNVENAKNLKVLEKQISSLEEEIKTWIQELDKIDHTSEWRSFKSQLIKLATAEIKPA
FT                   SPSPLLHDLKTELECRVESLRVTSHFLHSNSELLSLSTQQKVQKLTQCINNGVFSARTD
FT                   PQTNKHTTRNLLRGLSRSLTKEDSP"
FT   gene            complement(<445941..>446309)
FT                   /locus_tag="KLTH0E05016g"
FT                   /old_locus_tag="KLTH-ORF9664"
FT   CDS_pept        complement(445941..446309)
FT                   /locus_tag="KLTH0E05016g"
FT                   /gene_family="HOG000000733" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9664"
FT                   /product="KLTH0E05016p"
FT                   /note="similar to uniprot|P32570 Saccharomyces cerevisiae
FT                   YBR253W SRB6 Protein involved in transcription as part of
FT                   the Srb/Mediator complex"
FT                   /db_xref="GOA:C5DHK4"
FT                   /db_xref="InterPro:IPR016530"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK4"
FT                   /protein_id="CAR23265.1"
FT                   /translation="MSNRGLLEQLERTTETLSHSLSNLIKYSSVAKERDDEDSGEQHEL
FT                   PESTAKNSTSGLMMVNAQTAQLIKGIQDLLVMTRSIREKWLLTQIPDEGVDSQSELDYE
FT                   KCSQLLKQWTQEVVSSEE"
FT   gene            complement(<446503..>446973)
FT                   /locus_tag="KLTH0E05038g"
FT                   /old_locus_tag="KLTH-ORF9662"
FT   CDS_pept        complement(446503..446973)
FT                   /locus_tag="KLTH0E05038g"
FT                   /gene_family="HOG000028966" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9662"
FT                   /product="KLTH0E05038p"
FT                   /note="highly similar to YBR252W, uniprot|P33317
FT                   Saccharomyces cerevisiae YBR252W (DUT1)"
FT                   /db_xref="GOA:C5DHK5"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK5"
FT                   /protein_id="CAR23266.1"
FT                   /translation="MTNIDAPARKQQKLNNSLLIQLRSPDAIAPTKGSASAAGYDIYAS
FT                   QGSVIPARGQGLVSTDVSFTVPVGTYGRIAPRSGLAVKHGINTGAGVVDRDYTGEVKIV
FT                   LFNHADKDFEVRKGDRVAQLILEKIVDDAEIVVVDSLEESARGAGGFGSTGK"
FT   gene            <447698..>447768
FT                   /locus_tag="KLTH0E05060r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.9"
FT   tRNA            447698..447768
FT                   /locus_tag="KLTH0E05060r"
FT                   /old_locus_tag="Klth0E.tGly.GCC.9"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            complement(<447921..>449132)
FT                   /locus_tag="KLTH0E05082g"
FT                   /old_locus_tag="KLTH-ORF9659"
FT   CDS_pept        complement(447921..449132)
FT                   /locus_tag="KLTH0E05082g"
FT                   /gene_family="HOG000000930" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9659"
FT                   /product="KLTH0E05082p"
FT                   /note="similar to YGR111W, uniprot|P53265 Saccharomyces
FT                   cerevisiae YGR111W"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK6"
FT                   /protein_id="CAR23267.1"
FT                   /translation="MTKQTQKDNLVFEETKDPEVIRFTHMQNGENWAPPFMSKEDYLQR
FT                   ERVIGTSEISTKHLCPKMQKRFPEGSECLGIKYYVLRNLGLPATSKTSQVVASCETLNR
FT                   VGMAASPQTGGAVQPVLTACIGGVYTLPEYRCKGYGSQMITRLNKLYDEYSQRADTPPL
FT                   AKTVVMTLYSEVGEYYSKFGFSSRPVPVHVVKNIDRLLNEYCGGEPGGGDGGGRALDFD
FT                   GCESLLERQVREFSQNITRLQKENPNAFVFAVEPSLDNFRLFHRRGLFHKKYVEPDSPV
FT                   TFGYALPNGSHLVWHHNYYPGDRALFLLKLHVSEDSEDKDADLKLLLAQAICEAKKTKI
FT                   DRLQFWDTELGHQAWSKPFMEFLGKIEDKSGLYQENPSRSAVRVSGFKGEDIIWDHNTK
FT                   YCWF"
FT   gene            complement(<449481..>453038)
FT                   /locus_tag="KLTH0E05104g"
FT                   /old_locus_tag="KLTH-ORF9655"
FT   CDS_pept        complement(449481..453038)
FT                   /locus_tag="KLTH0E05104g"
FT                   /gene_family="HOG000001003" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9655"
FT                   /product="KLTH0E05104p"
FT                   /note="similar to uniprot|P40851 Saccharomyces cerevisiae
FT                   YPR122W AXL1 Haploid specific endoprotease that performs
FT                   one of two N-terminal cleavages during maturation of a-
FT                   factor mating pheromone required for axial budding pattern
FT                   of haploid cells"
FT                   /db_xref="GOA:C5DHK7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK7"
FT                   /protein_id="CAR23268.1"
FT                   /translation="MSGMSDAVQHFDVAFYTPISSSNKGVELCRLANGILVLLISDPAD
FT                   TSVSSSVSVASGSHADPDEVLGLAHLCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAY
FT                   TTGENTTFYFELPASNDSGELLFDKVLDTLASSFKNPVFSDSSINKEIYAIESEHNVNK
FT                   ASTPKQLYHATRLLANPRHPFSRFCTGNFATLCDEPNLHKVNVKATLCQYFKTNYDATR
FT                   MALCLRGPQSLNALAKLAKKYFGDLPASRDRDPTRPPLKKRPSSGVASQDLHVRPLDFK
FT                   NSKQQTQVQDAFVPDTSNLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFF
FT                   GDEGVGSLTHCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDL
FT                   FIPRLIHDKTKDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKC
FT                   LLKGSPLIECNQNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCP
FT                   KSDLLSSVTSVSKTDAYYEFTYQISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRK
FT                   LGLIKQALQASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDSDLSFKSKS
FT                   IISIEVASKTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLS
FT                   FTISGFPEGVCAMVRVIIDQTKSLINSDTVTPAMFRKARVAVRNKYEEAASANSTTLAT
FT                   LGLLIVLEECMWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEIST
FT                   FLDSGLTSHLSRRTWHEPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRD
FT                   DAQMLSLTCLTEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHL
FT                   ESQIDQYLAYMEHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEA
FT                   NVHSGNLPEQGAAMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKI
FT                   SICSTTRSKLSVMVASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKP
FT                   STLMRGLFKFFLARGETLRLCNVILKELSKAVVLSLKPRPTNNNSAGVLQNVRKEVSTA
FT                   VPLIEVQANHFRQRSPVTG"
FT   gene            complement(<453279..>453367)
FT                   /locus_tag="KLTH0E05126r"
FT                   /old_locus_tag="Klth0E.tTyr.GTA.29"
FT   tRNA            complement(join(453279..453314,453329..453367))
FT                   /locus_tag="KLTH0E05126r"
FT                   /old_locus_tag="Klth0E.tTyr.GTA.29"
FT                   /note="tRNA-Tyr (GTA) cove"
FT   gene            complement(<453418..>453705)
FT                   /locus_tag="KLTH0E05148g"
FT                   /old_locus_tag="KLTH-ORF9650"
FT   CDS_pept        complement(453418..453705)
FT                   /locus_tag="KLTH0E05148g"
FT                   /gene_family="HOG000073517" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9650"
FT                   /product="KLTH0E05148p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK8"
FT                   /protein_id="CAR23269.1"
FT                   /translation="MGAMANLKEKLVKLKRFLSGEPVEGETYEKSPDVKDLPHMKDADG
FT                   KLIAVSSGNRELSPVLSAKLNIQNSQGLSKSGSRNEPIDSRFSGEDKIAA"
FT   gene            <455057..>456283
FT                   /locus_tag="KLTH0E05170g"
FT                   /old_locus_tag="KLTH-ORF9645"
FT   CDS_pept        455057..456283
FT                   /locus_tag="KLTH0E05170g"
FT                   /gene_family="HOG000000929" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9645"
FT                   /product="KLTH0E05170p"
FT                   /note="similar to uniprot|P30283 Saccharomyces cerevisiae
FT                   YPR120C CLB5 B-type cyclin with a role in DNA replication
FT                   during S phase has an additional functional role in
FT                   formation of mitotic spindles along with Clb3p and Clb4p
FT                   and uniprot|P32943 Saccharomyces cerevisiae YGR109C CLB6"
FT                   /db_xref="GOA:C5DHK9"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHK9"
FT                   /protein_id="CAR23270.1"
FT                   /translation="MSELTRSRTLNNAVTDENASRSVGRAKTIAGASLGAQRKALGEVR
FT                   NWQTQSQDDAKIETTSTQEVRSQRDWELEGPSRKKRQIYMSDDESESDDESQGSGASTS
FT                   STKRPRLEEGPAHRALQSWRDLDRDEKDDVCMVYEYTDDIFDHLYQREKQTTPTYNYLT
FT                   ATDSPQYLRPSLRAILIDWLVEVHQKFQLLPETLYLAINVMDRFMSMRKVSMAKLQLLA
FT                   VSSLLIAAKFEEVNLPKLSQYAYITDGACSSQDIKDAEMYVLTTLKFNIGWPNPLNFLR
FT                   RISKADNYDVQARSVAKFFLEYAMCCPKFVDIIPSRVSAMAMFCARQSLDKDDKWDSTF
FT                   EHYSGGVDPLNEPEFQDLCRDLIKEISKPTTQLKALEAKYSSKQMGSVFEPAKIWCDLM
FT                   VASKFEDLF"
FT   gene            complement(<456907..>458370)
FT                   /locus_tag="KLTH0E05192g"
FT                   /old_locus_tag="KLTH-ORF9643"
FT   CDS_pept        complement(456907..458370)
FT                   /locus_tag="KLTH0E05192g"
FT                   /gene_family="HOG000167672" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9643"
FT                   /product="KLTH0E05192p"
FT                   /note="similar to uniprot|P24869 Saccharomyces cerevisiae
FT                   YPR119W CLB2 Involved in mitotic induction G(sub)2-
FT                   specific B-type cyclin and uniprot|P24868 Saccharomyces
FT                   cerevisiae YGR108W CLB1"
FT                   /db_xref="GOA:C5DHL0"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL0"
FT                   /protein_id="CAR23271.1"
FT                   /translation="MSFAHNDNSQDSRPRTLKSTRTALNNVTNTTIAQEVKSANSSARS
FT                   LGKVLRAARSKLQSDKTVGSLIPQIRREGTLSEIPPSSSSSTSLSSAGTIPASQVTSSE
FT                   LDKENMDPFASKLPSIEEEQQSQSLSSSREALQYSEHQTMLKDSDYASAMQSDLQAQQQ
FT                   QQRSSNILEPAADVSKKRPISTVVEQEEPKKFKVCAKGTEYEWEDLDAEDINDPFMVSE
FT                   YVNDIFEYLHKLEIMTLPNRHDLYKHSNIRQNRDILVNWMVKIHNKFGLLPETLYLSLN
FT                   IMDRFLCRELVQLEKLQLVGTACLFIASKYEEVYSPSVKHFAYETDGACDEDEIREGEK
FT                   FILKTLEFNLNYPNPMNFLRRISKADDYDIQSRTLAKYLLEISVVDFRFIGVLPSLCAA
FT                   TAMFLSRKMLGKGKWDGNLIHYSGGYTREELAPVCNMVMDYLVQPVVHDEFFKKYASRK
FT                   FMKASVISRQWAKKVVAHGYDIMTLHEPT"
FT   gene            <459225..>459314
FT                   /locus_tag="KLTH0E05214r"
FT                   /old_locus_tag="Klth0E.tLys.TTT.10"
FT   tRNA            join(459225..459261,459279..459314)
FT                   /locus_tag="KLTH0E05214r"
FT                   /old_locus_tag="Klth0E.tLys.TTT.10"
FT                   /note="tRNA-Lys (TTT) cove"
FT   gene            complement(<459700..>460953)
FT                   /locus_tag="KLTH0E05236g"
FT                   /old_locus_tag="KLTH-ORF9638"
FT   CDS_pept        complement(459700..460953)
FT                   /locus_tag="KLTH0E05236g"
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9638"
FT                   /product="KLTH0E05236p"
FT                   /note="highly similar to uniprot|Q06489 Saccharomyces
FT                   cerevisiae YPR118W Methylthioribose-1-phosphate isomerase
FT                   catalyzes the isomerization of 5-methylthioribose-1-
FT                   phosphate to 5-methylthioribulose-1-phosphate in the
FT                   methionine salvage pathway"
FT                   /db_xref="GOA:C5DHL1"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHL1"
FT                   /protein_id="CAR23272.1"
FT                   /translation="MSLEAIQFDRSHRDDISVRVLDQLLLPYTTKYVPIYTIDDGYTVI
FT                   NTMQVRGAPAIAIVGALAVLMEIQLLQNDGFARTQTFYDISSFELTRSALSQRLDFLLS
FT                   SRPTAVNLSNALREIRVLLAQSAGLAAFGNGVYDFVCRLIDEDLTNNVKMGDNGAAFLL
FT                   DALQQEGFDEDFAVLTICNTGSLATSGYGTALGVVRSLWNDSLAKSQAPGDGSAKKRKL
FT                   NQGRAKMVQVYPLETRPYNQGARLTAYELVHDQIPATLIPDSSIAYRIATSPVPIKAAF
FT                   VGADRIVRNGDTANKIGTYQLALVCKHFGIKFFVTAPKTTIDSKTETGAGIVVEERKPN
FT                   EFKHVSGTLIDSQTGLPCVDNQDKPVSASVGVAPSEIDVWNPAFDITPHELIDGIVTED
FT                   GVFTKSASGSFDLTNLFA"
FT   gene            complement(<461191..>461271)
FT                   /locus_tag="KLTH0E05258r"
FT                   /old_locus_tag="Klth0E.tLeu.GAG.28"
FT   tRNA            complement(461191..461271)
FT                   /locus_tag="KLTH0E05258r"
FT                   /old_locus_tag="Klth0E.tLeu.GAG.28"
FT                   /note="tRNA-Leu (GAG) cove score=65.59"
FT   gene            <461626..>462387
FT                   /locus_tag="KLTH0E05280g"
FT                   /old_locus_tag="KLTH-ORF9633"
FT   CDS_pept        461626..462387
FT                   /locus_tag="KLTH0E05280g"
FT                   /gene_family="HOG000141890" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9633"
FT                   /product="KLTH0E05280p"
FT                   /note="weakly similar to uniprot|P53262 Saccharomyces
FT                   cerevisiae YGR106C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL2"
FT                   /protein_id="CAR23273.1"
FT                   /translation="MLLKSLFLFLAALFQACAAETSFLSVNSRRYRDALGDDQVGSLEE
FT                   LTKISDAEEPMVWFKFDKFDLLGELARSTAETRFLTAFFEGSVTDVLDQDSSSKAAENV
FT                   RSEKFEVAEIPASAFESLYDRVHPSDGALVFEFTESNYDLALLDEYLEAVYIYLEETLA
FT                   NIDNLAFQVPTSGKNYARAHSKVEVTDPEKKPGSSTDGVQSALWTEGLISCLIVAALLL
FT                   WILVIAISWITSLDISYGALEKPANPLKKTN"
FT   gene            complement(<462508..>462817)
FT                   /locus_tag="KLTH0E05302g"
FT                   /old_locus_tag="Klth0E.mRNA.3287.m"
FT   CDS_pept        complement(join(462508..462734,462808..462817))
FT                   /locus_tag="KLTH0E05302g"
FT                   /gene_family="HOG000234560" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.3287.m"
FT                   /product="KLTH0E05302p"
FT                   /note="similar to uniprot|P41806 Saccharomyces cerevisiae
FT                   YGR105W VMA21 Protein involved in vacuolar H - ATPase
FT                   assembly or function required for the biogenesis of a
FT                   functional vacuolar ATPase (V-ATPase) but not part of the
FT                   final enzyme complex"
FT                   /db_xref="InterPro:IPR019013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL3"
FT                   /protein_id="CAR23274.1"
FT                   /translation="MCLGLNSSVVQKLMFFTAAMVILPVLAFFIVQQFTANTLVSGGLA
FT                   ALAANLVLIGYVVMAFREDTTQEEAKLEEKKRD"
FT   gene            <462964..>463791
FT                   /locus_tag="KLTH0E05324g"
FT                   /old_locus_tag="KLTH-ORF9628"
FT   CDS_pept        462964..463791
FT                   /locus_tag="KLTH0E05324g"
FT                   /gene_family="HOG000113528" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9628"
FT                   /product="KLTH0E05324p"
FT                   /note="similar to uniprot|P32585 Saccharomyces cerevisiae
FT                   YGR104C SRB5 subunit of RNA polymerase II
FT                   holoenzyme/mediator complex"
FT                   /db_xref="GOA:C5DHL4"
FT                   /db_xref="InterPro:IPR019095"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL4"
FT                   /protein_id="CAR23275.1"
FT                   /translation="MMLQLSLVSSIDDASYDLFVSTLSNLCGNPPVVFGNFTAMLKPNP
FT                   AFDIEQVNSKNQLVEQSRIKLCRGLPLQEVEADNAKRDFRLLKKYQNDEVQGLDLQIIQ
FT                   DMLHGSRDLDEMEVDGGSNKGGSGAQDVWSLSISDIPTAGSGRKVSTQAITETTVLASG
FT                   GSSPSIVSFLSELGYVLDFQLLVLGIKFNMNNGVFLELSKIWRLNDGRTEQITKGGFLV
FT                   KAFVNVAKSTDIKSINSGTTSLLALQKELSGYVELEIPDRKSMDSRLENKNDI"
FT   gene            complement(<463898..>465709)
FT                   /locus_tag="KLTH0E05346g"
FT                   /old_locus_tag="KLTH-ORF9627"
FT   CDS_pept        complement(463898..465709)
FT                   /locus_tag="KLTH0E05346g"
FT                   /gene_family="HOG000006022" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9627"
FT                   /product="KLTH0E05346p"
FT                   /note="similar to uniprot|P53261 Saccharomyces cerevisiae
FT                   YGR103W NOP7 Nucleolar protein involved in rRNA processing
FT                   and 60S ribosomal subunit biogenesis constituent of several
FT                   different pre-ribosomal particles"
FT                   /db_xref="GOA:C5DHL5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR010613"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL5"
FT                   /protein_id="CAR23276.1"
FT                   /translation="MRIKKKNVSGNARNFITRSQAVRKLQVSLADFRRLCIFKGIYPRE
FT                   PRNKKKANKGSTAPTTFYYFKDIQYLMHEPVLERFREHKTFSKKLTKALGRGEVSSAKK
FT                   LEEKSPSYKLDHIIKERYPSFADALRDIDDALNMLFLFANLPASDQVSARVTKDAQVIC
FT                   NQWLAYVARERAVRKVFVSIKGVYYQASVKGEDIRWLVPYKFPENIPSDVDFRIMLTFL
FT                   EFYSTLMHFVLYKLYTDSGLVYPPKLDAAKDKIIGGLSAYILESNAEDSSLTAPQLADS
FT                   NSDAKALDAKTLSSAIKADASEKAADDAEDAGGEDAEDELGEGELDTFEDKNKNQGDLL
FT                   IQPSKYDSPTATLFSDFVFYISREVPVDILEFLVLACGGSVICEAALDQLESKKDIDLG
FT                   KVTHQIVDRPVLKNKVGGRTYIQPQWVFDCINKGELVPANLYLPGETLPPHLSPWGDAA
FT                   GYDPTAEPAEDESGDESEDVSDQEAGAESDDAEASAEAAAEDAAEEESDEDLEAQKELE
FT                   LEAKGIPYSDAKDKKEVKKKSKKPEKRKATEEDEEKDLKTIMMSNKQRKLYKKMKYSNE
FT                   KKDDRVEKLKQKKKAIAKAKSKLEKTN"
FT   gene            <465977..>466504
FT                   /locus_tag="KLTH0E05368g"
FT                   /old_locus_tag="KLTH-ORF9624"
FT   CDS_pept        465977..466504
FT                   /locus_tag="KLTH0E05368g"
FT                   /gene_family="HOG000000959" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9624"
FT                   /product="KLTH0E05368p"
FT                   /note="similar to uniprot|P53260 Saccharomyces cerevisiae
FT                   YGR102C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL6"
FT                   /protein_id="CAR23277.1"
FT                   /translation="MLKVSARHAPVLRLPRRFYAQKTRVVIGPRLKNLDEIKEYLGKPT
FT                   WSVEKYLQSSSNGETQPPSRETVEKLLKLSGLPNENVEMFQATLGKQLAFINKVQSLPV
FT                   DESLDPSHARIIDRNSEALDYESLSCSVEQQETEKDSKMGEVGGSWDGTGLAAISENGF
FT                   YVLREGLLKNRK"
FT   gene            complement(<466567..>467571)
FT                   /locus_tag="KLTH0E05390g"
FT                   /old_locus_tag="KLTH-ORF9623"
FT   CDS_pept        complement(466567..467571)
FT                   /locus_tag="KLTH0E05390g"
FT                   /gene_family="HOG000000958" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9623"
FT                   /product="KLTH0E05390p"
FT                   /note="similar to uniprot|P53259 Saccharomyces cerevisiae
FT                   YGR101W PCP1 Mitochondrial serine protease required for the
FT                   processing of various mitochondrial proteins and
FT                   maintenance of mitochondrial DNA and morphology belongs to
FT                   the rhomboid-GlpG superfamily of intramembrane peptidases"
FT                   /db_xref="GOA:C5DHL7"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL7"
FT                   /protein_id="CAR23278.1"
FT                   /translation="MNSFVSRFGKHFFLSNAINIQTKPLSASILGPLGLNLRQRIPTQP
FT                   ARFFSRTSEIKSSWRDVFNGAGASRYARLNRFQQFEKGSRNTNNPFSNNSLRNVTIAGA
FT                   LFMGGTYFGLPYLFDNVPPFTYFRAHPSSLVYGLIGLNCGVFALWRVPQCWRFLQRYML
FT                   LEKDHIYSKWSLIGSAFSHQEVWHLGMNMLALWSFGTTVATMLGPANFMSLYLNSALAG
FT                   SLLSLWYPRIARISMMAPSLGASGALFGVFGCFSYLIPHAKIMLFVFPIPGGAWLAFLG
FT                   SMVWNAAGCALRWGSFDYAAHLGGSVAGIVYAYLISEQLKKEKARRMQRFSVF"
FT   gene            complement(<467786..>470611)
FT                   /locus_tag="KLTH0E05412g"
FT                   /old_locus_tag="KLTH-ORF9620"
FT   CDS_pept        complement(467786..470611)
FT                   /locus_tag="KLTH0E05412g"
FT                   /gene_family="HOG000173111" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9620"
FT                   /product="KLTH0E05412p"
FT                   /note="similar to uniprot|P53258 Saccharomyces cerevisiae
FT                   YGR100W MDR1 Cytoplasmic GTPase-activating protein for
FT                   Ypt/Rab transport GTPases Ypt6p Ypt31p and Sec4p involved
FT                   in recycling of internalized proteins and regulation of
FT                   Golgi secretory function"
FT                   /db_xref="GOA:C5DHL8"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL8"
FT                   /protein_id="CAR23279.1"
FT                   /translation="MSFFDSLRQKAANVKFLDKLADNFTPVMNRDEKFRLEYKLPEEEH
FT                   VLDDTNADVSILNPYKRAKRAENSERSELAYVFSGRLYLTPHYLVFRDSFDSTSCNFTL
FT                   NISTIRKVERAPIMSYAYSLAITLHCGTRMVIQFIGLRNRTDQFCHKFKELLRENIPNT
FT                   KLLAPFLETCYSEYLIARNVLRESDVNPPPGGLGQRYRYPGDASKEKPKLKLWLDYFQD
FT                   QGKNLTIVKNHMFYKLIRVGVPNRLRGELWEVCSGSLYSRFANPGEYKRLLEANEGKDS
FT                   RAIEEIEKDLNRSLPEYAAYQEKEGIQRLRNVLTAYSWKNPDVGYCQAMNILVAALLIF
FT                   MTEEQAFWCLVSICDNYIPGYYSKTMYGTLLDQRVFESFVEQKMPLMWEHITSHDIQLS
FT                   VVSLPWFLSLFFTSMPLPYAFRIMDILLVNGPKTFFQVALAVLKINGEDLLEVDDDGMF
FT                   IAILKNYFQTLDHSAHPDSADIRYRQITKFQELLVVAFKEFSIITDSMVDQQRSKYRKD
FT                   ILHNIESFAKRTQLRNLPQVRNLTPDNLSNIYDLFYLCIESHKISMGTGSSNMDFEAFV
FT                   QFLSKFCDWCKPSESDERPNFRKQKRAFLKRLFTKWGSSGSQELTLNDVVFGLDGLLSK
FT                   DLMSSINYFFSLFDEQGKDEINGESILQISEALLFLTEAWKSGRYVDKLTQKSIEDDIA
FT                   DSIVMNNSAKGGTLEDIELPAGVTIDEEKYKQEQAERYLQAASNFLQRSFEYARPSEEK
FT                   EVDLIDLSDDETESKQAKEKKWESLKANVALNPNQTSVMDLATFRMIILADETYEMFFA
FT                   HTLRNSIHVDEKIGSRDSRGGALRNMFDGFLADGKRVASQVRRRVDSVATKNSSSSGSA
FT                   AEATDIQDEVDDFTSGHTFEHDDLLKHDLISLEDNEGNEPNPESQRKKLESFSFSDPSE
FT                   TREHSLIEFEA"
FT   gene            complement(<470916..>478109)
FT                   /locus_tag="KLTH0E05434g"
FT                   /old_locus_tag="KLTH-ORF9618"
FT   CDS_pept        complement(470916..478109)
FT                   /locus_tag="KLTH0E05434g"
FT                   /gene_family="HOG000001002" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9618"
FT                   /product="KLTH0E05434p"
FT                   /note="similar to uniprot|Q06116 Saccharomyces cerevisiae
FT                   YPR117W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR019409"
FT                   /db_xref="InterPro:IPR019415"
FT                   /db_xref="InterPro:IPR019441"
FT                   /db_xref="InterPro:IPR019443"
FT                   /db_xref="InterPro:IPR019449"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHL9"
FT                   /protein_id="CAR23280.1"
FT                   /translation="MHQFLTWLPLASRYAIYAALLLLLIPNVIIHFCICHISQNSALPS
FT                   RLTLVPWINGVRFLYVTSERYTLWVRRIKLKFKRALEIELEGLSITLKGSQHLTKSNPH
FT                   AADLKKPLPQIFIKPLWLTLLKFVRPRKLILKDLVLHVPASKRTFKIETLLIECKPLPG
FT                   KSPSVSVSLVAICLSDSLGQFSAHTIDYASSYSFTRQNTSRGFCFELKNHVQALTIRGL
FT                   QARLDKSSQTNYEKRAQHTEEPHSSLDLKRFSEVLIALSDLEIRLENLALLLEDSLQFR
FT                   SSGILFTTKAIDPSHHSMLDLFPAERKLPLNHEITLSINSLTGLVNGQEVLRIPSINCT
FT                   SASDLTSFLLLRKPPQLKIGLTLTIVDTAITATKEQLGKLWVIYTTAKSSSPKSGTSRW
FT                   RYWFSQIKCPHFIVKIIMSNFSFTLRLSQSKHFVVRVSNLHAFGHNSMKPNTIVAYERL
FT                   NVKGMKNTRDYVDNFLKIDRFSLSYFRADEATNIKVHDIPVVVFSKWEFFSKKIITEES
FT                   NLTSTLRDLKISLEHSEVLAGASNFLDEWTYTLSAFNQKKDPTDAKGLKYSLRLRLKNT
FT                   SLSVLVANHLKKELDVLGDDKFNLADYTRGASVCLEEAFLDAMPDECKLHIVHAFVYRV
FT                   MGHPDVYARSDEIANLKDFVISSNSLTNHCFAPALNIKVDVNAIWLYYYLKDIATNYLR
FT                   PKKLRASSDKVPFNDLCKEWHVEVASLLIEIGLPHSTKLLFDFENAHFSGESLALHLDR
FT                   LVMFSPSVYREEEIFVPLALINDFTLDIERLVAKRIVSLNAGFMSLKFEYHLRLYKILD
FT                   NVMTLVKCFKQIRACFESPIGFKRLKPVPEEPKRVFPIDLSLDLLSLNVEEDPFEQELG
FT                   LVFKVGVSEQQERLEKLRLFYEEIDSFEPNKVLSQEEMKLKYDSRMQKLFENFSTSWIN
FT                   RIRKARLTFFGNPSQTIKLRNAGTFRFRSLDGMNSTVLKVELERLKMKLREPSFSLDKC
FT                   SEFLYKYGKQIPKDTAFTTLLPLGISLETERWEIRLRDYPLPILFFPSVEISGDITFAE
FT                   RMPQPFSERFVHVPFVPMASLAKYSNIDSVYGASVIRTLNPVKTYMNLRCQIDSTRPTT
FT                   ITWGKALQPGYQSVMIWFDYLTKPPIDPSEKLGFWDKFRLLIHGKFVFEWAGDSHIHLN
FT                   IKGSHDPYLITDDGAGLSFCWGGSARLAIHESSDPTEFLKITSKHFLLAIRDFTSPQKI
FT                   EKALMELNGTITWTMGLAFESGNPKNPGMEERSSNFKPHYHINLFNPAFLEGDKTHDSY
FT                   AGFRSDFIHLFFRVHASSNPEGSNKVFLAPHCMAHFLKWWSLFSTYTSGPIRQGSLFPD
FT                   LVQNPKKFSKALFTVKYELHLTPLVISHTYRHADSRLNIESDNETAFTSLKGKFETLKL
FT                   ELHQKRVKMMHSDKKLNVSRTVWKFKMNAGEIDCVSADIRFVYTMLGHPSGPRKGGATA
FT                   NIENDVLKSSWFDFEDYNDLNQITFADPIPLNFCEAPLLYSPRISYLRELNEGVPLDYP
FT                   FGDESVHECTLGHNHPEVTQRELAKKRAREIETQLDQIEQSIEALSSVAMKGSNGSVQK
FT                   LELLGRQLHEFRHRLHIIHKVLEDLKLSKMPSSSLLSDDIESELSERHSDKTQDELENA
FT                   LAATATIASFRSMRKVTSAFVKSSFDNRFIIHNMLLKVNNKTRDLLLNYAFNVFSRKKS
FT                   SFFQTYKAVALLDELLKNRLWNTSSRAKDSAGFFTLEDNLSNADLLERCDEIIREVFED
FT                   GFKTFDNYQIKFVSPQIQVTSEAVPRKCILVTARDIETSIVDVNQLLETNQNVPLDVNS
FT                   LVETRYCAKLNEAHFLIFDKCEIAIDDGLGFQTNGYGMDTNSSFWPPWLPMEMCYNCES
FT                   LTDSVFLSRSEMILLFTQPNSLFFQDKTKNFGRSEAKFRIGFPELFLTSTSDQYSSIYA
FT                   IAVELLHFASSFDNKADKLSRVLLAEEVRNNLDRLDTSIIVNLQKTVKNLYRTRGYLKV
FT                   HDPKGYEKVAQSIAAEIEATVLELNLLMSAIKKNHDRLKVSNVKGSSQDRLNWQIGADE
FT                   VTWQLYDEFKNSFVSFELGPACFIRSQAPDGANNNKVSISSLECFNLQKNAVYKQLLGP
FT                   HDNDTDTEKPMIQILWAMGPAIGGIADLEQLVVLLEPFKFKMDHLTSDILLKYLFPGTN
FT                   EASTAAQSDIAFDVASIGLSKKNTESSETWKLKSVPSLLPPNPLKKSDTEARNSVSLSR
FT                   RGTGRDMNEMVTRSSRYFNVRSVVIRKVTMSISYKGSRSLITNVDGLTVKVPTLRYTNK
FT                   LWSRDEFIATLKKDIIKVVLQHTGYIIGNKFTLHKKENEAKFSKALIKTSVGEADSLRS
FT                   ASSSQHKTPQLRHISSSLKPESSSDGRSGHLSQDQRSGADDVTAFYPASHQ"
FT   gene            complement(<480127..>482205)
FT                   /locus_tag="KLTH0E05456g"
FT                   /old_locus_tag="KLTH-ORF9611"
FT   CDS_pept        complement(480127..482205)
FT                   /locus_tag="KLTH0E05456g"
FT                   /gene_family="HOG000141891" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9611"
FT                   /product="KLTH0E05456p"
FT                   /note="similar to uniprot|P53038 Saccharomyces cerevisiae
FT                   YGR099W TEL2 Essential DNA-binding protein specific to
FT                   single-stranded yeast telomeric DNA repeats required for
FT                   telomere length regulation and telomere position effect"
FT                   /db_xref="InterPro:IPR019337"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM0"
FT                   /protein_id="CAR23281.1"
FT                   /translation="MSVNQAIETLKSQPSLEVISQCLITLKEETRSNIEAAAVIVKYVV
FT                   LVYPSLSDQVRKLLVSNLSNSFLLLTHVMNFISLLQNSTEAKICKRFLIDTLRSNVTCL
FT                   NSYMRLYTSSTEKQMLKATFFGSKLLNALNGEIDIEDYLEIMKNQLVYILARHEVVEEK
FT                   ACTDFFISFLSLHPACASNVFFGGLVFSNEDMFRKYVQLLRNSSAFTQKRLVKSMVQFL
FT                   NSNTTYSSSDSIYNVLLHTGTSMIGFETLMRLRSNFLQAIVVHLLTDTELLNLYRYLMS
FT                   FFPRPDHPEDETVCYLLSILLEKLTSAEREQKGHDPIFLDAVTSRLSSQNSEARERTMF
FT                   IAKKIAGSELKYESSFTIEIPVILKPKTENIDYRVFWASSGIDVEGNLERKSFSSPSNK
FT                   INNELASLKLSDEETNEEGPQIVFLKDLVREFELDNKSHRSQVFLLKATVKLVRQKIDF
FT                   QLEIQSYSSILLSIIGSLSNTLEEPAFEEWKINALVSLLFVAPEKVVDLVRILFGNELS
FT                   LQQRMSLLSALGLAARELRGIDDNMILKPQTDFPTKRLPWDEGDKESKPALAQSSRIDA
FT                   SPLRGEQVVWKSRKLKMNASETVAPENRFRKFAPKFFYPLAHGWLNGIDMGTYDHMFKK
FT                   HYLSTMQIILSASFPHYEFRAMYQQMCTILENALEQGIEVDATRVSNLSKLALQELE"
FT   gene            <482401..>487293
FT                   /locus_tag="KLTH0E05478g"
FT                   /old_locus_tag="KLTH-ORF9609"
FT   CDS_pept        482401..487293
FT                   /locus_tag="KLTH0E05478g"
FT                   /gene_family="HOG000065988" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9609"
FT                   /product="KLTH0E05478p"
FT                   /note="similar to uniprot|Q03018 Saccharomyces cerevisiae
FT                   YGR098C ESP1 Separase with cysteine protease activity
FT                   (related to caspases) that promotes sister chromatid
FT                   separation by mediating dissociation of the cohesin Scc1p
FT                   from chromatin inhibited by Pds1p"
FT                   /db_xref="GOA:C5DHM1"
FT                   /db_xref="InterPro:IPR005314"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM1"
FT                   /protein_id="CAR23282.1"
FT                   /translation="MGEKDVALSDIDLNSPIKRVGSTTNAFFEQSKENNTDTWLKKAKE
FT                   DGLCDNSIARPSLPINIELERNEIHKFLQKPCLDLADRVHLSSRRLYQAYLWKHQIKRI
FT                   KEFTKQHMLVIIKLIDLGGIESAEQEVLNLYNGTNLGKIETLDHVLLADFSVSNNYYLS
FT                   TLKLLVMQIIIRGKMHDKHSAAIIQLFAYDSRYLLRSEKTKAQSLIKLLLNFFSILPTY
FT                   KILFGLKFLQYIKQFDLCYGDFVKNMPIQRFQELLSQWGRKSFVHICDFLNLFYVSYSK
FT                   HFFTVDKIMLHDITETIHSDRVKPLLCCFDSTPPHQWELQLKSLSPLSSTEKNSLIDFM
FT                   AENLKERAYDFPKLILLATWFLRICNKEFVPAPKEVWRVIDKITILINTHLKLIDMHVS
FT                   KEIMGTLSDFCINNLEPKRLLNIVNVGFNSFIIFKNEIFLFEAAKLEIARQVILENGDL
FT                   CLSRLEKFISNASKEYRIKLFSMFFNIFTCFKYETLASLMHIMTQFSRSVKHIRNFSSK
FT                   ELLETSELMLCLLSTNQPVQTTSISAWSPLTQKLFLSLSDFRGANDIEIKNGREPLDPL
FT                   RPYEPVIMSMYYLGLEIKKGSCISLAKITDAFIKEWVLRSDPLGEPVSLLELSLVDALF
FT                   GFLKFNKFYKKVVHLANALKESYFFSHENCAENVLEQLVEGYAGLQLRDCVIATSTEVE
FT                   SRRNPSRIDDMSEDEFSRFARLQLMKCFWKKDVNTFNELFVEKVPKVKPEVFDVNNTSR
FT                   IPTKTYLGFLILNIRITSTASALQLYNDNMVEALIEAKKSLKLCQTLLKKSAQLPHNVR
FT                   WDILTFLSKSFSDVIDIYTHLGVSKDCDFYTTEYLRVACSVKDAVIVHECLQKSVVYYR
FT                   ITLQNNLAGALIKKANAVFGRLDGSENFEALALFLFNNGETDKLNESLHLFFKDHFKDS
FT                   FLFASWKLLLGCTIDITHGHLQFVKANDINYSKEIYSRISLQMESDPFFRSMRDSVTSI
FT                   PSFALRIPDKRTEICIKGIEFNTPVKNRTRNVIINSPRPSSLTPRGKSLKQSFDRAKAT
FT                   NDLELIKRKIEFLDIEGMKSYEIAEASALYSLSLSLISSINASKAYSSVLDRKFALAEI
FT                   PKYTPMFFDKLLSKQGNEIYSSFIPKCIQLKVSGSKNSTDSTKQVHLSEVQSSFGLEFS
FT                   GAFNVISIDVCEITGDLLLSKMDSGRDSKVCLRLPLNRSNSRDMDEIELSFDNAVNELT
FT                   QIIKESNKTTSVEVTSNISTKDARKRWWQYRYELDSKLQSLLSKIESSWFSGFKTFFAQ
FT                   EIIEQKDLEKFRVCFEEILQQTLPTRKQCGNPSDFFRINDVVLELFLKLNPSDKSFMEM
FT                   MEDLIFFVFDLLLFHGEENAYDEIDIDSIHVQLEALINDYRKEIPSPAKVSHTFLVVCS
FT                   AGHMIPWESLDFLASNSVSRIPCFQTLKSIMDDRSGPFPPTVELDERLSMILNPHGDLQ
FT                   RTQSNFDDIFREWSRELPDSNLVVGEKPEESKFIEMLNNSKAFIYVGHGGGEQYVRLKK
FT                   IKQQSKIAPSFLLGCSSAFMENRGKLEPTGVSYSYLLGGCPMVVGNLWDVTDKDIDKFS
FT                   RTMFEELGLIGGSKIHKTVSEALALARGSCQLKYLNGAAPVMYGIPLRFTR"
FT   gene            complement(<487303..>488139)
FT                   /locus_tag="KLTH0E05500g"
FT                   /old_locus_tag="KLTH-ORF9602"
FT   CDS_pept        complement(487303..488139)
FT                   /locus_tag="KLTH0E05500g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9602"
FT                   /product="KLTH0E05500p"
FT                   /note="weakly similar to uniprot|Q06109 Saccharomyces
FT                   cerevisiae YPR116W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM2"
FT                   /protein_id="CAR23283.1"
FT                   /translation="MSKPSVLKGCLESLVALEKTKRIPKKPSCDASPLISNFENWSGKP
FT                   RKLYLRDARSMKRQGLPYELNSNMFAQLLASPMRLDKITRVRAPKELLVQIKLRKADTD
FT                   ISAARGKPFELRPSFGMERGHPTSYVSNSVALVHKYASSAMKWLPSSANSTIRHINQAD
FT                   VATQPEWYSQAYTEQMLGSLREALSSTLMHLGKAPESDPRDVIIVCNPQLPAISLRKSE
FT                   NPFIALATTVLNLYPIKDPELEKVVNNRDIELCSSKHRSLCFLIYRLLAFQADRII"
FT   gene            <488343..>488969
FT                   /locus_tag="KLTH0E05522g"
FT                   /old_locus_tag="KLTH-ORF9601"
FT   CDS_pept        488343..488969
FT                   /locus_tag="KLTH0E05522g"
FT                   /gene_family="HOG000093530" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9601"
FT                   /product="KLTH0E05522p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DHM3"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM3"
FT                   /protein_id="CAR23284.1"
FT                   /translation="MRFPIVRFQPTLGRSALVQQKFKDSMARMGGQAMILTSAGKKALP
FT                   HDLFRGVTLSSVSSLSLKPQPLLQFNLQLPSFTSESLHMHEYFALHLLKPDANSITLAR
FT                   AFSKGAMKNHENGEVVPTQPFKELTESVHYRTYGLSNSDLAVPILINSERVFVCRKKEV
FT                   FRVGDHEIWVGMVDDIIEGDDVNQDVSGGLLYCNRKFHKLGGRIE"
FT   gene            complement(<489071..>492214)
FT                   /locus_tag="KLTH0E05544g"
FT                   /old_locus_tag="KLTH-ORF9599"
FT   CDS_pept        complement(489071..492214)
FT                   /locus_tag="KLTH0E05544g"
FT                   /gene_family="HOG000034101" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9599"
FT                   /product="KLTH0E05544p"
FT                   /note="similar to uniprot|P48361 Saccharomyces cerevisiae
FT                   YGR097W ASK10 Component of the RNA polymerase II holoenzyme
FT                   phosphorylated in response to oxidative stress has a role
FT                   in destruction of Ssn8p which relieves repression of
FT                   stress-response genes"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM4"
FT                   /protein_id="CAR23285.1"
FT                   /translation="MSSAKQSGFHDTEPTQRDFLAPEREEDDASSLFSSDSGYLMDLAD
FT                   ASEDTETILPKTDFHSPYYVNVPLPSQSGLTSDYTEPSQDSTSTGFVREYPTDILLDRF
FT                   NKWRKILKGLANYLREVAYAQERFARINYGLRSTVKFSFLTDLEESTNRVIDPFQQRAK
FT                   KQAGASAASLNSSLRTPSAPGEESPGGINSSQSALDVKNVPMAPGDNSSASSGFMKFGS
FT                   GSIEDIQVVLKKYHASIANQQIKMSKEITTMVVPKLDDLRKDLQLKIKEIKELHGDFRT
FT                   NIGEHIALTGQLLQKYMAAVEFMSTNSNDQKIFKLKNQKLKPKHDPYLLKLQLDLQLKR
FT                   QLLEENYLQEAYINLQSSGMELEKIIFGEVQHTLQRYSALIGTSARISISNLCNELHQG
FT                   VLSKPPAIEWDHFVGHHPKCLIDWKSTEPIPQPRKLSDIRYPKMKSSLAKCIKAGYLCK
FT                   KSQILKNYNKAYFVLTSNYLHEFKSSNFFKLSQENSEKKDHGEVQTGSKKRAMVPVTSL
FT                   SLNSAQLLEASEHKFSIRGVTSYNNFEKKSAETGKIISKSTSSIHKFLKSGSKLQPHKK
FT                   DQHHHGSIAGLPSGAGAHGPSEDLDDVATWVFKAASSKPEDAKDLKKWVTEVKNLSSFM
FT                   NSDERAKFIEEKILRAHNRASSMNLSKMAAESGNNGRRQDRLPSHKVSGTRSKPQFIHL
FT                   GPQEMQDPALARAKVNTPAIDDNGNLITAGERRSSSLKSPSEVPSPHLSPTPTNHSGGG
FT                   TTPGSSGHGSDTPMKQQGFVITSNGITPINRTPGSASKRNVSGVVPSGGSSDGSNSAPM
FT                   NSPGSSSAPVNSPGSNSQTNFFGSNNSPIHSPGSGILPLNSPASHLSGGSGSGGYFAIP
FT                   VRPSSQASTPGLGNPDSTAAAAQTQGSNVPRLRVNDRDMSQEKTDKNLPHSEQSTEKPA
FT                   GSGRPAEGGPLSRGAPVHLRKTSNPGGISTFISEPHQTIYSNPRQSLSSQTLGSTNHQH
FT                   VRKHKKNVSFGSLNSLLFSKKGGDVSNNNMTDYFMSGNRIQENDDPDALNVNQSLYRS"
FT   gene            complement(<493049..>493975)
FT                   /locus_tag="KLTH0E05566g"
FT                   /old_locus_tag="KLTH-ORF9588"
FT   CDS_pept        complement(493049..493975)
FT                   /locus_tag="KLTH0E05566g"
FT                   /gene_family="HOG000111209" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9588"
FT                   /product="KLTH0E05566p"
FT                   /note="similar to uniprot|Q06107 Saccharomyces cerevisiae
FT                   YPR114W Hypothetical ORF"
FT                   /db_xref="GOA:C5DHM5"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM5"
FT                   /protein_id="CAR23286.1"
FT                   /translation="MDAAVHFLMGLEPPSRFPIHWLTRYGIITSPNILAHLHSVLYVAL
FT                   AYHAVFLASKWVLFPPLVRRRLAHSKDHSRRGRQGLVNQAALHFVSLVQSFVILYLCLS
FT                   YWRTHGRGSSHPTAEQRVFRQERDTDTVCVFAIGYFVWDALISMVYSSAPFVLHGVISA
FT                   VMFLIGLKPYIQFYAPAFLLFELSNPFLNVRWFGIKFFPQLSDHNTTRAARVLNVFQLA
FT                   NNVALVLVFFGARIVWGWCQIFHLCRDFWQMRHDPRFLPLETLTIVSGNFVLDVLNVVW
FT                   FSQMLLVAKRILSRRGRVQDKPATEAH"
FT   gene            complement(<494815..>495861)
FT                   /locus_tag="KLTH0E05588g"
FT                   /old_locus_tag="KLTH-ORF9581"
FT   CDS_pept        complement(494815..495861)
FT                   /locus_tag="KLTH0E05588g"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9581"
FT                   /product="KLTH0E05588p"
FT                   /note="highly similar to uniprot|P00330 Saccharomyces
FT                   cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved in
FT                   the production of certain carboxylate esters"
FT                   /db_xref="GOA:C5DHM6"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM6"
FT                   /protein_id="CAR23287.1"
FT                   /translation="MSVPKTQKAVVFETNGGELEYKDIPVPKPAANEILINVKYSGVCH
FT                   TDLHAWKGDWPLATKLPLVGGHEGAGVVVGIGENVKGWKLGDLAGIKWLNGSCMACESC
FT                   ELSNESNCPHADLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVYKAL
FT                   KSANLRAGNWVAISGAAGGLGSLAVQYAKAMGYRVIGIDGGDEKEQLFKKLGGEYFVDF
FT                   RKSKDVVAEILEVTGGGAHGVVNVSVSEAAIESSTHYVRANGTVVLVGLPGGAKCCSDV
FT                   FNHVVKSISIVGSYVGSRADTRQALDFFARGLVKSPIKIVGLSELPDVFEKMEKGQIAG
FT                   RYVVDTAK"
FT   gene            complement(<496524..>497189)
FT                   /locus_tag="KLTH0E05610g"
FT                   /old_locus_tag="KLTH-ORF9576"
FT   CDS_pept        complement(496524..497189)
FT                   /locus_tag="KLTH0E05610g"
FT                   /gene_family="HOG000204051" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9576"
FT                   /product="KLTH0E05610p"
FT                   /note="similar to uniprot|P06197 Saccharomyces cerevisiae
FT                   YPR113W PIS1 Phosphatidylinositol synthase required for
FT                   biosynthesis of phosphatidylinositol which is a precursor
FT                   for polyphosphoinositides sphingolipids and glycolipid
FT                   anchors for some of the plasma membrane proteins"
FT                   /db_xref="GOA:C5DHM7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM7"
FT                   /protein_id="CAR23288.1"
FT                   /translation="MAKVTASQVLWYVPNQIGYMRVFTAILSFFLMAKHPIWTTWIYGI
FT                   SCLLDALDGTMARKYNQTSGFGAVLDMVTDRSTTSSLICFLCVLFPRYAPVFQLLISLD
FT                   LSSHYLHMYATLSTGGASHKTIEKEQWLLYMYYSRRWVLFTVCAFNELFYLALYLYGFP
FT                   QLKHFDVPLWGRAHIGGVMAAVCLPGYVFKQVANVIQLKRAALLLASKDAEAASEKRA"
FT   gene            complement(<497958..>498728)
FT                   /locus_tag="KLTH0E05632g"
FT                   /old_locus_tag="KLTH-ORF9570"
FT   CDS_pept        complement(497958..498728)
FT                   /locus_tag="KLTH0E05632g"
FT                   /gene_family="HOG000216644" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9570"
FT                   /product="KLTH0E05632p"
FT                   /note="highly similar to uniprot|P29453 Saccharomyces
FT                   cerevisiae RPL8B and to YHL033C uniprot|P17076
FT                   Saccharomyces cerevisiae RPL8A Ribosomal protein L4 of the
FT                   large (60S) ribosomal subunit"
FT                   /db_xref="GOA:C5DHM8"
FT                   /db_xref="InterPro:IPR001921"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM8"
FT                   /protein_id="CAR23289.1"
FT                   /translation="MAPGKKVAPAPLASKAGKAGKAKNPLTNSTPKSFGIGQDIQPKRN
FT                   LSRYVKWPEYVRLQRQKKILSIRLKVPPAIAQFQHTLDRNTASETFKLFNKYRPETAAE
FT                   KKERLTKEAAAIAEGKTRQEASPKPYVVKFGLNHVVSLVENKKAKLVLIANDVDPIELV
FT                   VFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVREEDESALAKLVSTVNANY
FT                   LEKYEETKKHWGGGIVGQKAQAKKDQRAKASEAN"
FT   gene            complement(<499361..>501421)
FT                   /locus_tag="KLTH0E05654g"
FT                   /old_locus_tag="KLTH-ORF9565"
FT   CDS_pept        complement(499361..501421)
FT                   /locus_tag="KLTH0E05654g"
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9565"
FT                   /product="KLTH0E05654p"
FT                   /note="similar to uniprot|P32190 Saccharomyces cerevisiae
FT                   YHL032C GUT1 Glycerol kinase converts glycerol to glycerol-
FT                   3-phosphate glucose repression of expression is mediated by
FT                   Adr1p and Ino2p-Ino4p derepression of expression on non-
FT                   fermentable carbon sources is mediated by Opi1p and Rsf1p"
FT                   /db_xref="GOA:C5DHM9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHM9"
FT                   /protein_id="CAR23290.1"
FT                   /translation="MTAAAPTGATEEPSEVPLVASIDVGTTSSRVILFNMLGQEVSKHQ
FT                   IEYSTSASREKYAPVGKRRHSVDETTAAAAGGGSDSRRASRASPPSPAQPIFSAEGIAI
FT                   EANEYLEIEDLERPSVPTLSFPRAGWVECNPLGILAHVVQCFAANLVSVDRVNGSRVSN
FT                   GLAPYRIRCVGIANMRETTLVWSRKTGEPVVPYGIVWNDTRTSAIVTEKRNSTPQAVQD
FT                   RLRAKTGLPLYSTYFSCSKLRWLLDNEPAVRACYDAGDLMFGTVDTWLIYHLTSNRAFV
FT                   SDVTNASRTGFMNLDTLVYDDELLNYWDLARDKVNLPRIVSSAEYYGDFALPECVRTNL
FT                   TPVAWSLLTDFCARTPAVPIQGCLGDQSASLVGQLAFKPGAAKCTYGTGCFLLYNTGTK
FT                   KLISSHGALTTFGYWFPHLENEEHAQPHFALEGSVAVAGAVVQWLRDNLRLIPKAEDIG
FT                   PLASRVSDTGGVVFVPAFSGLFAPYWDASARATIMGMSQHTTASHLARAAVEGVCFQAR
FT                   AILKAMSSDAAGEGRKDRDFLEEVADGTYEKAPLSMLAVDGGMSRSKEVMQIQADILGP
FT                   CVKVRTSASSECTALGAAIAAALAYEKREDRVLWKDLKDVKKWVMYGGTEPGNRPPVDE
FT                   ESFRTRIFRSKSIDTERRRKWKLWEAAIERSRGWMNIVEQSTHDNATAKNM"
FT   gene            <502686..>504530
FT                   /locus_tag="KLTH0E05676g"
FT                   /old_locus_tag="KLTH-ORF9551"
FT   CDS_pept        502686..504530
FT                   /locus_tag="KLTH0E05676g"
FT                   /gene_family="HOG000066120" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9551"
FT                   /product="KLTH0E05676p"
FT                   /note="similar to uniprot|P23900 Saccharomyces cerevisiae
FT                   YLL043W FPS1 Plasma membrane glycerol channel member of the
FT                   major intrinsic protein (MIP) family of channel proteins
FT                   involved in efflux of glycerol and in uptake of the
FT                   trivalent metalloids arsenite and antimonite"
FT                   /db_xref="GOA:C5DHN0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR012269"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN0"
FT                   /protein_id="CAR23291.1"
FT                   /translation="MSKKSLPDSQDGNQRKPQEYMNDFLSDAESGSNVSHDQQNGGDGG
FT                   EHYIPSRDFAPQHRISASASYVPRNGEGGGGSNYAVQQVVPNTHIPMSRSNSGNNGSGG
FT                   GGGGGGGSGHSTGYRNRAQSGVSSNYMNMRSVQSNSGSAQNVNQPEASADPRDNDIPLM
FT                   VKPKTLYQNPQTPTVLPSTYHPINTWSTLKQTYLKEFLAEFMGTMVMIFFGCTVVCQVR
FT                   SGQQQQRVTFLKELSASTQVPAENKIELLQYLMPVDQFGTYDDVALIWGGAVVMGYFAA
FT                   GGSALSGGHMNPALTLSNCVFRGFPWRKVPVYWAGQLLGAYCGALIVFAYYMPVIKYVY
FT                   PDWNGNETVLGMFCTSPLQYLDSSRQFISELICSAVLQVGIFALTDPYTCLRSDLFPLM
FT                   LFVLIFCLIGATALQTGAGLNPARDLGPRLALATVGFESDTLWRAHHHYFWVPIVAPFV
FT                   GTLLGGTVYDICIYQGHESPLNWPYSLVKHKARRAWSNRPRFYRKRAGSDSAVSDWEYD
FT                   NESNNASARDTDNEDTPKTGFFPESDPQIQKHVQFKSMSKNFNGKRNPVSGIPTIFEEG
FT                   DDDDVDDADEAASGNETEKRPPLKPKSSKSFDKKGKKQ"
FT   gene            complement(<504588..>505232)
FT                   /locus_tag="KLTH0E05698g"
FT                   /old_locus_tag="KLTH-ORF9545"
FT   CDS_pept        complement(504588..505232)
FT                   /locus_tag="KLTH0E05698g"
FT                   /gene_family="HOG000207760" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9545"
FT                   /product="KLTH0E05698p"
FT                   /note="similar to uniprot|P38736 Saccharomyces cerevisiae
FT                   YHL031C GOS1 v-SNARE protein involved in Golgi transport
FT                   homolog of the mammalian protein GOS-28/GS28"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN1"
FT                   /protein_id="CAR23292.1"
FT                   /translation="MASFVTVRGQAISLESQTESLLSKFSQYAQTTSSEPTSQERNLDS
FT                   KLDSLLTQRQEVVDSLSNICNENPSISASKLSQLQRHREILQEHWQHFRNLRSSIQQER
FT                   NRLNLLFSVKKDIAQQSEQDQDKYIQDEARRIDESHNVVDSLVSQAWDTRDQFSSQRTV
FT                   LQTANNRMMQTLQRVPGINQVIAKINTRRKKNAVILASLITLCILFLFFTW"
FT   gene            complement(<505291..>505767)
FT                   /locus_tag="KLTH0E05720g"
FT                   /old_locus_tag="KLTH-ORF9544"
FT   CDS_pept        complement(505291..505767)
FT                   /locus_tag="KLTH0E05720g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9544"
FT                   /product="KLTH0E05720p"
FT                   /note="weakly similar to uniprot|Q07879 Saccharomyces
FT                   cerevisiae YLL042C ATG10 Enzyme that mediates formation of
FT                   the Atg12p-Atg5p conjugate which is a critical step in
FT                   autophagy"
FT                   /db_xref="InterPro:IPR007135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN2"
FT                   /protein_id="CAR23293.1"
FT                   /translation="MIPLGEFREQLQALIPVLQLWPKCLSVHASLNGEALIGLAEHPTL
FT                   AFYTYEFEIGYSQTYQEPRLIFKIWEATTEQGAELQRPCFPADLSRLMNVQDFSIGLDH
FT                   LHEARKDSWFSVHACDTSHIVGSVKHHYLKRWASVYLSLFDPCFSNTYLFVDDV"
FT   gene            complement(<505942..>506733)
FT                   /locus_tag="KLTH0E05742g"
FT                   /old_locus_tag="KLTH-ORF9543"
FT   CDS_pept        complement(505942..506733)
FT                   /locus_tag="KLTH0E05742g"
FT                   /gene_family="HOG000160590" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9543"
FT                   /product="KLTH0E05742p"
FT                   /note="highly similar to uniprot|P21801 Saccharomyces
FT                   cerevisiae YLL041C SDH2 Iron-sulfur protein subunit of
FT                   succinate dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which
FT                   couples the oxidation of succinate to the transfer of
FT                   electrons to ubiquinone"
FT                   /db_xref="GOA:C5DHN3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN3"
FT                   /protein_id="CAR23294.1"
FT                   /translation="MMMSGILKRNIAGVVARRGLATEVVQEPRLKTFKIYRWNPDHPAD
FT                   KPKLQEFKVDLNKCGPMVLDALLKIKDEQDATLTLRRSCREGICGSCAMNIGGRNTLAC
FT                   LCKIDTDVSKQTKIYPLPHMYIVKDLVPDLTQFYKQYKSVQPYLQRSKMPEDGKENLQS
FT                   IEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDEASKFRKE
FT                   MLQNSMSLYRCHTIMNCTRTCPKGLNPGYAIAEIKKALATS"
FT   gene            complement(<507436..>516744)
FT                   /locus_tag="KLTH0E05764g"
FT                   /old_locus_tag="KLTH-ORF9541"
FT   CDS_pept        complement(507436..516744)
FT                   /locus_tag="KLTH0E05764g"
FT                   /gene_family="HOG000191432" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9541"
FT                   /product="KLTH0E05764p"
FT                   /note="similar to uniprot|Q07878 Saccharomyces cerevisiae
FT                   YLL040C VPS13 homologous to human COH1 component of
FT                   peripheral vacuolar membrane protein complex"
FT                   /db_xref="GOA:C5DHN4"
FT                   /db_xref="InterPro:IPR009543"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN4"
FT                   /protein_id="CAR23295.1"
FT                   /translation="MLESLAAGLLNRFLGSYVENFDPKQLNVGIWSGDVKLKKLKLKKE
FT                   SLDALDLPIDVRFGFLGDLTLLVPWSSLKNKPVKILIEDVYLLCGPRDQSAKSFAEDEE
FT                   RELRLKLQKLDEYEALGKSQPTGKEDSSSSESFTQSLLTKVVDNLQISIKNIHIRYEDM
FT                   DCVFGEVPYSLGATLSELSIVSTDEHWEPSFISITSSIARKLLTLNSLSVYWNTDCESV
FT                   YHPDHDELFRRLRNSISSKKNIPDHEFLLRPVTGIGRLVLSKKGSTETNPHVDIALVFD
FT                   EFGFDINNCQYEDILNTASKLHWYQKTLKSRKHRPNFPVSEDPKAWFKYAAKAVLQEVH
FT                   EKNYKWSWDYIKWRRDRRIEYIPLWKKKLGTEKKTQSLSDEEQQKLKELHKELSFEDIK
FT                   LFRALAKKSYLTEKLEVSNSAAESKGSSAAGSSGWFSSWWNGNSPQNDDDLVMSEEQQQ
FT                   ELYDAIEFDENKQVIDSIDIPKDRITAKVTCVLNRGSLSIVDKNRSIKLGEMVFEGCET
FT                   EFLQRPDSFFCSFKLHEFKVEDGSPNTLYKHIVSVKNLQMNEGNVSQHDEPFFKVAVEK
FT                   NPLDDSADSKIDIKLRSMTIFYHVHFVNEIIKLFRPPRQHLDTIGAIMSAAEATVEGWT
FT                   VQTRMGLESILEDHKTVNLSLDLQAPLLIIPLDPHVWASPCAVIDAGHMSIVSDLVPKE
FT                   TLTKYKNMSSSEYEKLDTRDIKRLMFDRFKLRLTDTQFLIGPDIRSTISNLNVSERESS
FT                   FVILDKLEVELDVDVSILPKALNLPKIKIYGKLPLLKLSLNDYQYKVMMQLIDQCLPDL
FT                   DYPESDLDSVDPKTSSDSKILNSLESKEVAILRQTLSRLQKMSEAELKQRLLQLTFDVE
FT                   VIQLSIFKCNNAETMKSDLLVDLFGDRMHLTFAKKAQDMDLHLNLQSFKVVDHIDSGAS
FT                   SEFKNMIASSNENTQASHLFELKLNRAQRIVTYNNTLIEVFDQDVSLDMTELTFVLTPK
FT                   SILTILNYTLTTFTNPEAPELPGDALKHNSPDLADAPQKINLRMNMDNIIVILNDDSVK
FT                   LATFRLSAAQIEQLLLPEKMKINAKLGAMQLTNDADDGLSIDSPLRELISMSGSELAEL
FT                   TYETFDPSTEKLDYSSLLKYKTGSMNVNFVDHAVNKIVNYLAKFQKMKVFFDRAREAAY
FT                   NQAGNIETVNNIKLDILVRAPVITFPKLIDPRRNLFDHVSFFLGEFFLQNSFHNEGERL
FT                   VNKIKAGIRSGNLGSTFHMEHELTQNLHIIENLDLHFDIDHYQGTKQIPVKIDAKGVFE
FT                   PLAAHLTELQLQYIYLLSQRLPNAFIIDYCEDDFAEIQDVARNANTFVSPEAKTETKPD
FT                   PILFTEEEDRTSETEFSVNFTAPQLSLTIYNDTKNSSDISQSGITKISLNDIGLSLGID
FT                   KDSRMRAETHIASFTVDDIRKVKQNKHDKIIPKVSHDSYQFMASYTKEQHESLTVDNVN
FT                   VTVDSPRIILALDYLFALKSFIDASVNINPPAKVFDKSPAHASPPALEQEQQPSSTKFQ
FT                   YSINVVDSSLVLLSDPSEENTEAIVFNVGQLLFADQNIMTASANNIGMFLCRMQSFDKN
FT                   RIRLLDDFSSSILFDQRSSTSEKLITDVHASVEPLVMRLALRDIRLAMSIFNKAMTLAR
FT                   EHGLSPQVEPEADESGTKYGSFSKEFKKTLSRYAPSIVSSMSNISKSDDISEEELETIV
FT                   KHEKLEANFEGLRLVLIGDIHELPIIDLSIKPFTLNAKDWTNDVEAVASIETYANVFNY
FT                   SRSSWEPLLETVPLSFHLSKGIETDAALCFDIISRQLAEVSLSSRTIALLSQIPNSLYY
FT                   TKDTEARGATKPYKICNDTGMDLKIWIASEKPQSKDQITILKSGETIPWEFEDWRKVRE
FT                   NLDTDDSMNTLGASIEGGHYESTLKIDVTSEGEDVYTLQPKVNGVHTRLACELKLCEDN
FT                   VKLLIIRSTLTLENATSDLLEFKLSNEDGIFTINPGESRSIPAEKAYSSRFLLKPSGNY
FT                   GWSRESISWRDLMSRPRSVVCENKEDPALFYYEVDAKFDKEEPLASIYPHMKVIISSPL
FT                   ILENLLPYSMKYKLFWRSESANATKGKEETETRLLHKGERVLIHSVTLRDYLLLAVQPM
FT                   DDGLQMSEQSLINTRPNSELKAESKLFLKYENGQKLNLNLHYRTVEGSRAKIISVYSPY
FT                   VILNGSNRDIQVEGDRNNIAISKVLLKDDSSKYTNPRMFSFERDRSNKNRARIKFKDSD
FT                   WSVRTSFDAIGQSVDLTMDIPNKNQESNIGVVVSEGEGKYALSKIIKIMPRYILRNNLD
FT                   VDLEVSEYGSSNVLTAFSKVSFPLYKMRNIVNKHLSIKFLGSQSEWSSPFMIKDIGSSY
FT                   VKVLKNRSGHQLLKLDIVLEDSTIFISIDNADGEWPYSIRNFSDHEFIFYQRDPHTFDT
FT                   EEDYDLYDDLGDMKYEALYYRVPPRSAMPYAWDYPAARQKKLVLVCRQRQREIQLAEIG
FT                   NLRPMRIPSRNGNEAPAIVDLNVVADGPTQALIITNYRPELSLYKLKTGNTTSSSLSSD
FT                   KGDRFEVRDEDKNVFTKVVVSFEGVGISLINTRLQELCYVTLNGLELRYNESDLYQTAS
FT                   VKLKWLQIDNQLFGGIFPNILYPTAIQKTAKELNNHPVLSGSVSKVKDDTHGVLYLKHA
FT                   TLLLQELTVQLDEDFLMALIDFTKVPGASWVNNVEDNMCTECTMLSYPSELQRNNDIYF
FT                   EVFHLQPTMLHLSFVRTERLNVEGEKVDPQNTLMFFTNVLTMAFANINDAPIKLNSLFL
FT                   DNAKVPLPMLMSAIQVHYGQQFFYQIHKILGSADFLGNPVGLFNNISSGVWDIFYEPYQ
FT                   GYMMNDRPQELGISIAKGGLSFVKKSVFGLSDSFARFTGSVAKGLSVATQDAQFQERRR
FT                   LEQRKARNNKSINGFGSGATSFVNGVSSGLRGIAFDPYQGASKEGVPGFLKGLGKGLVG
FT                   LPTKTAIGMLDLASNVSEGIRNTTTVMDGSLTTQVRLPRYIGYDKIIKPYNLRESQGQY
FT                   WLKSANGGECITDQYLAHVVLPGKQLAVLVSLQHIIEVRLASLEIMWKVRYTDVRSMTL
FT                   ERAGLVIVLKGASSELFVPISDPEEKRFLYKNISVAVNEYNKYCQAEL"
FT   gene            <517896..>520349
FT                   /locus_tag="KLTH0E05786g"
FT                   /old_locus_tag="KLTH-ORF9531"
FT   CDS_pept        517896..520349
FT                   /locus_tag="KLTH0E05786g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9531"
FT                   /product="KLTH0E05786p"
FT                   /note="weakly similar to uniprot|P39961 Saccharomyces
FT                   cerevisiae YER184C Hypothetical ORF"
FT                   /db_xref="GOA:C5DHN5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN5"
FT                   /protein_id="CAR23296.1"
FT                   /translation="MRYVESRSGYLLLDHAYKAKCMAQDSRPPQVMATPRVTKRAYTIR
FT                   KTPQACISCRRRKVKCNGCRPCSSCKTNGLECAYDTPSLEQVNIKGKPHIDTSEALRLI
FT                   SNLHSTLRNLSSLAQDDPGSMSSTVTDISMRVHDLESRLHMQLNPYKAANCRGEKSLEY
FT                   KLASFGPAKVGYEENPNSPVEPALSLGRFHGLYSPLSMLSLDNLEKIFEKVHEELSPAK
FT                   VQEAFFLLGRYFDLATVGYQQTLALHRSPIRTCAQHFGLKGSSSSEAIYDKLLELIPLE
FT                   LRQAHLQSEKQKDAGSRWRFVALSELFQDHCRNGKSLDVSSATTAELWRFFEVYSVISI
FT                   LSTEQLQKDWFSEFFSMEHFECLLNYIECRVSFDQTLILGRVVCFLVRFAIDNGLNRWE
FT                   FYHNLKESEADHHRKLWWKCYWWDKFYAVSHGKLPLLRDEESVCLFPRCVMALGVEDSM
FT                   SCETLIERVSLKGASSDAASLFGYIFMGKMIERASRNLLFARKYTTYQMSGSKFGSSAT
FT                   EVVNSLKSDYQDTIALITSFRRLFSDSEPSDVPKPSSKWTVIIEYCYLCLLLAFEKLIL
FT                   RLSKTTNSARDLASSIEDCQTRYIECARANLLRGTRVGSAPVFCALMIPNYTSFLVVSD
FT                   CYINHRGENSDFDISVLCFFASLLMRIGGGEGLDQQHLRQFLQPRIQAGQAISLVICRI
FT                   CLQLYLKRSQHLFGNELPTEVKELDQKLNEFCSKTLDSNSDLWRLFETKSKKKSLYHET
FT                   FTTFMKKKGWSIDKHDIPAESKDTPEHSSATEFTTVLSSMFNEDIWGFQFDEQDLMPFL
FT                   YHDTN"
FT   gene            <520621..>521553
FT                   /locus_tag="KLTH0E05808g"
FT                   /old_locus_tag="KLTH-ORF9529"
FT   CDS_pept        520621..521553
FT                   /locus_tag="KLTH0E05808g"
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9529"
FT                   /product="KLTH0E05808p"
FT                   /note="similar to uniprot|P40100 Saccharomyces cerevisiae
FT                   YER185W Hypothetical ORF"
FT                   /db_xref="GOA:C5DHN6"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN6"
FT                   /protein_id="CAR23297.1"
FT                   /translation="MGTSTSDFELYNYTPSTSAAALFAAVFALSLLVLSVEVIVLQRRA
FT                   KKTISVTMDDRLNHSEYSMVGLSRKKPSSKFVCLIVGCGLETIGYIARAYSSKNQDKIL
FT                   PYVIQSMFVLVAPALIAASIYMIFGAMLSLLDCSSLSIIPARFNTMFFVCGDIFSFLLQ
FT                   CGGGGLMAKSSSQKTGEILAIIGLIVQLVFFGFFLLTEIRFLILARGRADLTLKFGNKW
FT                   KIINWTLIVSSIFILIRCIVRTAEFCQGREGYLMSHEWTIYVFDALFMTASVWVFAVSL
FT                   PFASLFDLNMVKMAVNEFKVVPSEYESRY"
FT   gene            <523206..>528761
FT                   /locus_tag="KLTH0E05830g"
FT                   /old_locus_tag="KLTH-ORF9528"
FT   CDS_pept        523206..528761
FT                   /locus_tag="KLTH0E05830g"
FT                   /gene_family="HOG000248783" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9528"
FT                   /product="KLTH0E05830p"
FT                   /note="similar to uniprot|P38737 Saccharomyces cerevisiae
FT                   YHL030W ECM29 Major component of the proteasome tethers the
FT                   proteasome core particle to the regulatory particle and
FT                   enhances the stability of the proteasome"
FT                   /db_xref="GOA:C5DHN7"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN7"
FT                   /protein_id="CAR23298.1"
FT                   /translation="MKGPMMLSESQELQLIEKVDLRFVLASSEDALERSLDTFFPALLL
FT                   KLDSPHGSARVAVFNSIKNVMGRISSLTSVKLPVKKLIVQAKTWKPSGDHSENSVGLYS
FT                   LLFASKGVDRLSPEEKTELIPEGIKGISALPVSLKPRMFHILCKLLLSWKAPTESSEDS
FT                   AKTFLTIGSALDRSYLFQKFRQFFFLNPLKPELGSAAIPRGYSCPGLNVQEVEFFTFSA
FT                   GVSFTRDSLSTYKRAIFTFMTRAFALEDRALLEFLVVVSADSTDLSDQAIALVKKYQVP
FT                   YEDQQFVDTLIGLYIGERLTNRPPVGRELQEVILSILIKSVCATKSPGKVSLICSMGLN
FT                   STHYKLRSLSLTFVQHVARHNYEALTFQDTQSDYSVNIASLIRNNLHGEGWPQYQLNSS
FT                   VPNFNIGLEQRRRQYETLGVVLKQDPQLLMDFSFIEFLFDSLKSDLREFRKSIQETLNS
FT                   LCVHVACLPEASKFKLRTLAKKLLADNFDVVYGDKEAIDALMYCRAVAIKFVNSAFPFD
FT                   DSEARLLNVMGLFRENRHDIREESTKGLHPYWFKMTQCINRSKTGVLEDFKSPSTNEVI
FT                   FPDVRSLMDLFQSQMEHSTDVKTSALFQSFDYGANFVFQTLISQAIVGKKSSVLQDEFW
FT                   HLRVAHAIQSDSNVRSLVESEVLSLDSNVLSTFTHMLLSHFVGRESRSENNSVNNETFS
FT                   MGFVSLFFASYMNHSMLQKMSDFLPKLFELLHRYLLLSEADIECAAKIYGIIQSSNFSD
FT                   GTASRMAEATRVPIESGDFVPAILTSSFTLPLLGLQEKALTAEEALPLIDKVIVSLEVT
FT                   DLKPNGLRCLDPILKFGLLRLLSKEKRKATVQRVMIALRRYPLRTQPTIQAWSQLSLYA
FT                   AEFGFIDTFFDALEESHLSKEVDVLFFAGEGMTVLAGGWNSSILRDKEYLKKNELDFLT
FT                   NTFGDTSSELIIGKLLVLCEASKPSLRKAACIWLLCFVQYLGHTDSVRTHARKIHVSFA
FT                   RFLADNDDLVQDSASRGLGLIYDVSDKDLQEEMLKGLFKFFIDPKAALDMSSGTISSES
FT                   QLFEPGTMNTGEGSISTYKDLLSLASEAGDPSLVYKFLPLARNTALWSSRKGVAFGLTS
FT                   IFSKSSVDEFLRSTPHASQKLIPLLYRYRFDPFKNVSEAMNGIWNALVDNTSATITEYF
FT                   DEILNSILQGIGGKDWRVREASTTALIDLLEITNEKQYQDKLEEIWTMAFRAMDDIKES
FT                   VRSAGIKVTKILSKILVRSVKHDDINGKSSQPILEKLIPFFLGHKGLNSDAEEIRAFSL
FT                   ETLLVLIKEASSAVRSFAPSLIYEFLLLLSPLEPQVVNYLTMNAEKYNLNTSDVNAQRA
FT                   LGVQQSPIMRSIETLVGNCDTGLLPSVVDKVIKASKKSVGLPSKIGSSKVISLLVLQNP
FT                   TSLSEFGSKLLKTCFSGLNDRSFTVSEAYTVSFGRVCKVCKPGKVGKYAGKLTEKYFNS
FT                   EDSSSRVIAGMAIMSMFKYSTEMFQNVESALLPLVFIGMHDSDDVAETYTKIWNESTSS
FT                   SSGTVNLYLEEIISLAAQRLKSNNFNIKITCAKSVCEACAQASVETPLNTIPQLFKVIL
FT                   ETTQGRAWQGKETVVETLVVLARKFKPFYLNSTAIRSSVESRLINEISRTNFGYVRDVI
FT                   FTSLSYSADFWSPALHEKNLEVAMHIIERIDNGADETASDENLDESNYKKQRVSTDVNR
FT                   KSRKDNVASEEYKIKLLKKVVLLYRMSDDGDLSQRTLEAITKASLNLFESSNIIFTWRS
FT                   QIAVCELGSAILERAPQGLTEGEQTCLKELWTKSFAQASSPESIENVKIQCVRFGKSLL
FT                   EKKVNFWFIVENDLRRLMHLDPSPVVSVELKNAGVV"
FT   gene            complement(<528861..>530090)
FT                   /locus_tag="KLTH0E05852g"
FT                   /old_locus_tag="KLTH-ORF9524"
FT   CDS_pept        complement(528861..530090)
FT                   /locus_tag="KLTH0E05852g"
FT                   /gene_family="HOG000233942" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9524"
FT                   /product="KLTH0E05852p"
FT                   /note="highly similar to uniprot|P04838 Saccharomyces
FT                   cerevisiae YLL039c UBI4 ubiquitin"
FT                   /db_xref="GOA:C5DHN8"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN8"
FT                   /protein_id="CAR23299.1"
FT                   /translation="MVIPEHQLGAELPKPIFAVENYVREQCSSCGGRDKRKGCERGARF
FT                   RGRLSEANGLPEHRSINTKELEYLPPLLTAERHSFPSVKASNNDTRKRLTERKTQARDT
FT                   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY
FT                   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQR
FT                   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
FT                   VKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
FT                   TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTL
FT                   HLVLRLRGGW"
FT   gene            complement(<530814..>531581)
FT                   /locus_tag="KLTH0E05874g"
FT                   /old_locus_tag="KLTH-ORF9520"
FT   CDS_pept        complement(530814..531581)
FT                   /locus_tag="KLTH0E05874g"
FT                   /gene_family="HOG000112378" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9520"
FT                   /product="KLTH0E05874p"
FT                   /note="similar to uniprot|Q07872 Saccharomyces cerevisiae
FT                   YLL038C ENT4 Protein of unknown function contains an N-
FT                   terminal epsin-like domain"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHN9"
FT                   /protein_id="CAR23300.1"
FT                   /translation="MSLLRTVRSFGQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYS
FT                   SRTLREITAVVRKRLSGNNRKSSHKNAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLI
FT                   DSLKEFTIGSRGQERMAVQIRSLASTLSVILRDDELLRQRRSDVTLFRSSISTPGRKST
FT                   DNSHLKFTQLSNRAEDLRNTRPTRSLDVGSRSYPRHSLDHARARVALDPLTEEEALDKE
FT                   NICPSVRSEQKFQEEGVFRRRGVTRLASNNPFR"
FT   gene            complement(<531754..>533364)
FT                   /locus_tag="KLTH0E05896g"
FT   CDS_pept        complement(join(531754..533294,533352..533364))
FT                   /locus_tag="KLTH0E05896g"
FT                   /gene_family="HOG000115709" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0E05896p"
FT                   /note="similar to uniprot|P32523 Saccharomyces cerevisiae
FT                   YLL036C PRP19 Splicing factor associated with the
FT                   spliceosome contains a U-box a motif found in a class of
FT                   ubiquitin ligases"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP0"
FT                   /protein_id="CAR23301.1"
FT                   /translation="MFCAISGKPPKTASFSPSSKCVFEKSLIEAYVAENGIDPISKEPL
FT                   QIDQLVEIAKAPEQYAMSNSVNSPSLNSNYSIPNLLSALQDEWDAVMLENFQLRQQIEA
FT                   SKKELSTALYRCDAAMNVAARATMEADKLKQELNILTTNLAPAKAQDTQLPSAEQGLVS
FT                   ELPRDLVAELGARSRNFAAESRKIKFSAPSCSEMTRASDVEPVNIPKGEARIAAAFIDG
FT                   NIANGKLISFYNADGDCYVCSAASSWKGYQNVTFEGNALISYAAPLNAAEMIVGTQDGR
FT                   HGIYDLNTEKISTAFHSNDESPVVFALGLQEVYGGSYIAINARGRILYVVPEERHVFDA
FT                   EVDSFPTEFAHIHKDGLLIAQANSAQLIVRDLTNLHEKPIHYLHDVEKEGEITSARFAS
FT                   NGYWLIVSAQKALKVFDLRKTPNTLAADPILFENETLKAWDIEPSMKILFTVTEDANGT
FT                   NLIRRYRFTKASKSWTLESSINCEDLLEVKEVHGLSYLWDQASGFLKVQNGNELITVRV
FT                   "
FT   gene            complement(<533655..>535355)
FT                   /locus_tag="KLTH0E05918g"
FT                   /old_locus_tag="KLTH-ORF9516"
FT   CDS_pept        complement(533655..535355)
FT                   /locus_tag="KLTH0E05918g"
FT                   /gene_family="HOG000000867" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9516"
FT                   /product="KLTH0E05918p"
FT                   /note="similar to uniprot|P38738 Saccharomyces cerevisiae
FT                   YHL029C Cytoplasmic protein required for replication of
FT                   Brome mosaic virus in S. cerevisiae which is a model system
FT                   for studying replication of positive- strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="GOA:C5DHP1"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP1"
FT                   /protein_id="CAR23302.1"
FT                   /translation="MTDRKTLVHSHLHWRNVKRKHWQKDLVAKVVELIKVGDHDALALV
FT                   ARTAGIPPQLRKHVWPVLLKFHPMVVSPNIMSNTLVWDSQHQKWHYHPEIRSEDEIRDQ
FT                   MAHDLGKYFHKRTSAGKRAQSAASGPGAAPGGDLSPLPPGQQRVVAALQQCILKFLQKW
FT                   AQFFKYESGLAWIALALAEWCPLDGGEDVLPGKRHGAPVNLYHEYFLPEEIRDQLPSES
FT                   EFAFDELFERLVLVILHSPDIPKAERLARAESEMTSVLQYYPVISGGDLSFQCQLFFKV
FT                   FSVILPELYQPVSDEETLRPSKKTNWMYWWFKCSGARVFHKQDRARIWDTLLGWRPHPR
FT                   SLNFYLNYNSKLFDHLYSTRTSSALDSEFFHKICKYGHDAFWFPDLDSLSLGSQDLKCD
FT                   FQVLSELVRRNKYDNSDDELEITPKNNGTVGSKIKKGVEIPFSLLDPHVQLIFIYMAIL
FT                   QQHEFKLLEFEEAEISEFFNNVPSLSRADDHNYRSLYEEEIESRSVSSSETEPEDLFKR
FT                   PGSSASTPHMLIEVGDDDKASKSFDDLYNLAGDIWRKWIWRELEDNAGT"
FT   gene            <536972..>538642
FT                   /locus_tag="KLTH0E05940g"
FT                   /old_locus_tag="KLTH-ORF9502"
FT   CDS_pept        536972..538642
FT                   /locus_tag="KLTH0E05940g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9502"
FT                   /product="KLTH0E05940p"
FT                   /note="some similarities with uniprot|P38739 Saccharomyces
FT                   cerevisiae YHL028W WSC4 cell wall integrity and stress
FT                   response component 4 Putative integral membrane protein
FT                   containing novel cysteine motif. Similarity to SLG1 (WSC1)
FT                   WSC2 and WSC3"
FT                   /db_xref="InterPro:IPR002889"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP2"
FT                   /protein_id="CAR23303.1"
FT                   /translation="MNVRSRSPSRLAWSCVLLWACVSSFAAAAQTYCSSENTASTAAKW
FT                   WQYQSNGWCSDECAGYSYAVLQGHNCWCSNTEPQSTTSVSDCSDTCPGYHEQCGNVDEG
FT                   LFGYIYLGEASSTSSASSTVSSTASSVSSTASSVSSTASSTASSVSSAASSTASSVSSA
FT                   ASSTASSVSSAASSTSSSIITSSSTSSSTSSSTSSTSTSSSTSSEATSSATSPASSASS
FT                   SSSSSSPPTSSEPSSTSSTTPTASSAAASASASTSASSSATPSTSSSVTSTPLTTSSSS
FT                   TSQTSSSSSTLQTTSSSSTPQASSSAALSSTSPPSSSLKPTSSSRSSPRSSSTSFSQNM
FT                   VTSILYSVQTVTASPAAGGTSDDRVFTTQIMTTVYATPSGQLPSLSSSSSNANANSRNS
FT                   GGSGFWGSPGKVAGTFVAVGVVVFCLALLGFILWYRRRRRNEEDFEKRYNDVTAPAGSN
FT                   TSIDPASAGSHAAFVYADEKGIEVPPTPVEKKETFTRLSQPASFTDNESGIPQDEGPVV
FT                   VDQRLDPRQVFMHWENEGSKTSLADDVDYSRRVLRVINE"
FT   gene            <539474..>540739
FT                   /locus_tag="KLTH0E05962g"
FT                   /old_locus_tag="KLTH-ORF9492"
FT   CDS_pept        539474..540739
FT                   /locus_tag="KLTH0E05962g"
FT                   /gene_family="HOG000115422" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9492"
FT                   /product="KLTH0E05962p"
FT                   /note="weakly similar to uniprot|P33400 Saccharomyces
FT                   cerevisiae YHL027W"
FT                   /db_xref="GOA:C5DHP3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP3"
FT                   /protein_id="CAR23304.1"
FT                   /translation="MAPLKDLLNEEEAPGYLSSPPSEDERKYWERSSCSSDSRSVSEAS
FT                   GSESDSGALLTCDWDSCGQKYAQPELLYHHLCQDHVGRKSQKNLQLNCRWGRCTTKTVK
FT                   RDHITSHLRVHVPLKPFACSTCTKKFKRPQDLKKHLKVHLEDESVIRRRRGPKPSLKKV
FT                   YKAAQRSPDAPVLPSISFEKFLADEMPHYKPYYTPQLGERLQTVLPPPSSVISAPGEVS
FT                   AAGTPTFSRSPCSNPQDLRAAAGFFSTLSQDMHRRLPRLPHLNSVVPPAPVSPLTAASA
FT                   PSRYPPVLQLPPIHASVPYPNVPYVSSRVDTSARLPHFNRAETYSLHQKNSGDQQGNET
FT                   QEQIEELMSKLALESEEIDMADILLKVNTIRDYLMCALLEEEYEDEQDPSDFAPSGTSS
FT                   ETANQGAPVEPRPLSKYPTVMV"
FT   gene            <540906..>542904
FT                   /locus_tag="KLTH0E05984g"
FT                   /old_locus_tag="KLTH.mRNA.222AT.p"
FT   CDS_pept        join(540906..540915,541001..542904)
FT                   /locus_tag="KLTH0E05984g"
FT                   /gene_family="HOG000112809" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.222AT.p"
FT                   /product="KLTH0E05984p"
FT                   /note="similar to uniprot|Q9P4W6 Saccharomyces cerevisiae
FT                   YLL035W GRC3 Protein of unknown function required for cell
FT                   growth and possibly involved in rRNA processing mRNA is
FT                   cell cycle regulated"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP4"
FT                   /protein_id="CAR23305.1"
FT                   /translation="MVNGVQSTFGPSYDKNDDDDSSDASSITATLNDEALPSAGSDSEY
FT                   FEDEEHDEVNGGIENGYKWETFKAVSGVNYFPLNDGAGTVLIGLKQGQEVMISGSYRLQ
FT                   IAKGGIKYNDIHYNASWRSISIWHPTCSSMSPILSSYYADWNERTFIPVEASKTSLKHE
FT                   DFECILKVSSRCSGLLKIAELNPAFKDLWIPQDYRPEEGVFAKPSFCVISKDTVRDTTN
FT                   IAALKISERWHTSLSDLTLFHKNSPHDMRVVVLGGKNSGKSTFLRLLAQRLLHTGRQED
FT                   DFLYFLDIDPGQSEFSRPDCISLSKLGSNFELGNHLGQAEAEQVLEYYVGTSSPHVFPT
FT                   KYLSDVSRLIDSFSEENSMGSALLNVPGWIKGFGVQIMNDVINRFKPTHVVFIDSNSRS
FT                   EAFLNELQIESTFSTPQREEYEPCIYKIDGYHGSPTSGIHSRLHAPHLRLFRLLAHFHK
FT                   VENTRSLISYDFTPLVRRAPLQVSFSPGPIKAFDIVDFNDAVSDEVFKDIMDGSIVGMF
FT                   CFEGECETHKDGKFPILKRECLEESFVSLGLIHSVDTENSCINIYIPESTVGSVRGRKN
FT                   STWLIRRCKTATPICELFPSSKELSTFKSSGLPFLSFHKQAKYEFIWKVRRNILRRGHQ
FT                   NR"
FT   gene            complement(<542954..>545413)
FT                   /locus_tag="KLTH0E06006g"
FT                   /old_locus_tag="KLTH-ORF9487"
FT   CDS_pept        complement(542954..545413)
FT                   /locus_tag="KLTH0E06006g"
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9487"
FT                   /product="KLTH0E06006p"
FT                   /note="highly similar to uniprot|Q07844 Saccharomyces
FT                   cerevisiae YLL034C RIX7 Putative ATPase of the AAA family
FT                   required for export of pre-ribosomal large subunits from
FT                   the nucleus distributed between the nucleolus nucleoplasm
FT                   and nuclear periphery depending on growth conditions"
FT                   /db_xref="GOA:C5DHP5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP5"
FT                   /protein_id="CAR23306.1"
FT                   /translation="MVKARKSKAPLSQGFDNKISDLIYLMLDEKSLEKRRANAAEKARR
FT                   EEEELADEEETAEDDFSDIFLARDLSFGEVLAFVQSKDLSLQRVKKVVLEKTVDKVLKQ
FT                   AIEEEEEQFAAYFANETSKDDQMNLDSESLSQQNLMVTPTSNDMNKSITSIWATTKSEE
FT                   NKEDGDKKLSSKKRAKETGSKPKRQKTQEDRSPPSSNLSSLGGMDDVVAQLMELIGLPI
FT                   LHPEIFASTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGESE
FT                   KKIRDLFEEAKSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELSFEKTG
FT                   GKPVIIIGATNRPDSLDAALRRAGRFDREICLNVPNEISRLHILKKMSSTLKIDGSIDF
FT                   LKLAKLTPGFVGADLKALSTAAGTCAIKRIFQSYASLAPTSMEVDDETLTSDGSQEPKN
FT                   TVNMIDPLPLSTVQKFIQSFPEPLTEEQLASLSIRYEDFLKALPTIQPTAKREGFATVP
FT                   DVSWANIGALNRVRIELNMAIVQPIKRPELYEKVGISAPAGVLLWGPPGCGKTLLAKAV
FT                   ANESRANFISIKGPELLNKYVGESERAIRQVFSRARASVPCVIFFDELDALVPRRDASL
FT                   SESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDAAMLRPGRLDKTLFIELPNFEE
FT                   KLDIIKTLARTNGTPLSSDVDFEAIIRDESCRNFSGADLAALIRESSVLALKRSFFRTE
FT                   EVHSITENNLEKEFGELNTSSEDVIVTMQDFSNALKKVKPSVSDKDRQKYERLNKKMGW
FT                   VDEADGS"
FT   gene            <545638..>546252
FT                   /locus_tag="KLTH0E06028g"
FT                   /old_locus_tag="KLTH-ORF9481"
FT   CDS_pept        545638..546252
FT                   /locus_tag="KLTH0E06028g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9481"
FT                   /product="KLTH0E06028p"
FT                   /note="weakly similar to uniprot|Q07843 Saccharomyces
FT                   cerevisiae YLL033W"
FT                   /db_xref="GOA:C5DHP6"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DHP6"
FT                   /protein_id="CAR23307.1"
FT                   /translation="MASRGITITTNKAITTSKSTLILKHDKFLPPRNMINEFPHDDVLR
FT                   MCYRRHMRLKPFISQRSMIQTTYVDYVRYKYKNEDYPKKCRASGIAHKTPVQSVLQQAE
FT                   LSLRFCLQAVMQVKKGVSDERSVSNEIRLSRNMLKNILAIEHEKAKLIAQNPRQNYPIL
FT                   REAFSYISPTAHKSSLLLRFNALREFDRCLIRFNMCMGTKL"
FT   gene            complement(<546306..>548399)
FT                   /locus_tag="KLTH0E06050g"
FT                   /old_locus_tag="KLTH-ORF9480"
FT   CDS_pept        complement(546306..548399)
FT                   /locus_tag="KLTH0E06050g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9480"
FT                   /product="KLTH0E06050p"
FT                   /note="weakly similar to uniprot|Q07834 Saccharomyces
FT                   cerevisiae YLL032C Hypothetical ORF"
FT                   /db_xref="GOA:C5DHP7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP7"
FT                   /protein_id="CAR23308.1"
FT                   /translation="MPNTIALYPFETTIFFKPENSEFTSQNLWKSLKKEHVQRLELDDE
FT                   QQEVLGDIPREAVIHDFERFPNCIRCKCSIQSASPAEPTVKFETPLERRLSTQESRQLM
FT                   ELSSTLGVEAVVASTQLYSTFPDPLKQRLLYVLGLESLVAAAMPQVLAFVALLKGRFVE
FT                   YTKIESPVLLPSCVGNEQLNIKNILDIYKTEVVTPELWSQDSSDIFLINEVHSLNLLAK
FT                   EKLEQMVGVARNSILCSSIYNISETKLHYLKMFRKRELTDIMSRYQCYVKINKSSIDFV
FT                   AGSIQVIEQTMKQLTLELLMTAYEAQIIIHDQEGNVVQGRLTAKLRELASQNQVIILQL
FT                   LPNALNCVIVGSPHNVSKCIDSFEKEEFKDDVQIRFLVELHPDYKEFISGKKNGKMSKI
FT                   IENAKCAVSLELREDQTNMCIVLTSNSFAAAKIGVRLLSDELPAEDSFFIPDSYHRPVI
FT                   GTGGSVIQTIMRRYNVFIQFSNTYQVPYINIGFTRRNNVVIRCPHKNQKSISQARDELM
FT                   RLVSEYSEMQARTFVNLSPGQYRHCFLQNSNFMQDVVSDLEKKTGVYIKFPTTCPRENV
FT                   IFEVRGDEQNSVNAAKELVRRFALEREITVDAKIKDVEDFTNKLVVPLKSGFDIETSVK
FT                   GSTVTLTYSEAKVPLMKKARDILRAYLSSKGMQVVAEKELDRNSALETRHNPKQEIIAG
FT                   PLY"
FT   gene            <549274..>550182
FT                   /locus_tag="KLTH0E06072g"
FT                   /old_locus_tag="KLTH-ORF9478"
FT   CDS_pept        549274..550182
FT                   /locus_tag="KLTH0E06072g"
FT                   /gene_family="HOG000141845" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9478"
FT                   /product="KLTH0E06072p"
FT                   /note="weakly similar to uniprot|P18888 Saccharomyces
FT                   cerevisiae YHL025W SNF6 Involved in global regulation of
FT                   transcription subunit of the chromatin remodeling Snf/Swi
FT                   complex"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP8"
FT                   /protein_id="CAR23309.1"
FT                   /translation="MPPRKRRTHNLKGLRGSQDQQQSHSSYFATRLKPEQVGALVHDES
FT                   DTISYRAYLVQNFIRSSEMMDALMTQNVPLPKIKAPPIFRNPNVEEMKRAVVSEREQLD
FT                   AIESHLQSYAIDLPDGYHQLKELSMQIDLSQDVSDNSIQAAESAYKAQTGKYTQDDRIV
FT                   VHKDRFPQLRGDHSKAPPDYWERRLDILASQQQEALRLKIMQEEEEELKRRTEEENRLR
FT                   QKQEEQRLYEDPFQQQATHAQPMAGPVTANPGIPDPQPAQQPSDQPPHAMLGSIFGDMN
FT                   GENFNNGFEDDEFADLDTAFF"
FT   gene            complement(<550258..>553308)
FT                   /locus_tag="KLTH0E06094g"
FT                   /old_locus_tag="KLTH-ORF9475"
FT   CDS_pept        complement(550258..553308)
FT                   /locus_tag="KLTH0E06094g"
FT                   /gene_family="HOG000201274" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9475"
FT                   /product="KLTH0E06094p"
FT                   /note="similar to uniprot|Q07830 Saccharomyces cerevisiae
FT                   YLL031C"
FT                   /db_xref="GOA:C5DHP9"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHP9"
FT                   /protein_id="CAR23310.1"
FT                   /translation="MPPIDSTNEDYVKKNMLSSSIEDKRLFKSRIQRFKTTHRLYIYLM
FT                   GSLAVLQIIAIAFFARGFLLTRTVLENVATGADHEARFSKCVILVIDALRFDFSIPVDP
FT                   ADNAFNSYFHNNLDVLHTSFNNATSETHSSLLLKFIADPPTTTLQRLKGLTTGSLPTFI
FT                   DAGSNFNGAVIEEDNLIKQMFLNNQSVLFAGDDTWDNLFNPFLSPASQPFESLNVWDLD
FT                   TVDNGVIRFFEDNLFAKSEKSEEWDVLIGHMLGIDHVGHKYGPNHFTMKEKQLQANEFI
FT                   KRICESIDDDTLLVVMGDHGMDHTGNHGGDSKSELEAALWLHSKRPNMWSHLPEQFYDI
FT                   SALGENYRQVNQIDLVPTLSLLLGLPIPFNNLGWPIQEVAATQEQLRSYSKIALDQIKA
FT                   YKDISRVITAAEKNERLNELLNESLEDILQASEYQKIFLESCKDLWARFDYFSIATGII
FT                   LLTASLVLLITITKLIPSIVVGQMVTELVPSITIMALVSNVCFIGIFHVLHQPKFLENW
FT                   IWCSLLATAVGIIVGCFIPLFDRYNFAWITVKFIEDLSDYWSRIAAMCVTLHALLFTSN
FT                   SFTIWEDKIVSFLLATLGMLTLYEFVFLPKRKLTTALLSAAMGEKRGSSSSNASSSSET
FT                   ESSPLGKFARFVGSYHSIVLIACTRISSMITICREEQGEYCTPTFTTANNYSPWCLSLC
FT                   LVLVAYLPSLIKGYYNVCSSYQAAAPIWIGQFLKFVLLGNFVYWTVCAMENTVPTWSWD
FT                   VKIFKLTLSRIIAGFSLVAANIGWLMGPLCVKINIHNNDVKSQQATILGYANAYGSQYF
FT                   LLILNFFMCIMLFNKPMAQLSLSLMCTQLLSMLEIFDLLKLKENLIGPVSMGLLAYQQF
FT                   FSTGHQATIPAVQWDIGFILTERITFPFTHLGIVLNTFGPHIIVALSVALLTLWKQPPS
FT                   VLKPQTLLARIVSNCGMLLIYNTVLCLSSFVWVTHFRRHLMVWKIFCPRFMFASLSLIV
FT                   TQVIVTLVTIAFASGRLIRQINTIFPS"
FT   gene            complement(<553784..>556297)
FT                   /locus_tag="KLTH0E06116g"
FT                   /old_locus_tag="KLTH-ORF9473"
FT   CDS_pept        complement(553784..556297)
FT                   /locus_tag="KLTH0E06116g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9473"
FT                   /product="KLTH0E06116p"
FT                   /note="some similarities with uniprot|P39720 Saccharomyces
FT                   cerevisiae YAL051W OAF1 Oleate-activated transcription
FT                   factor acts alone and as a heterodimer with Pip2p activates
FT                   genes involved in beta-oxidation of fatty acids and
FT                   peroxisome organization and biogenesis"
FT                   /db_xref="GOA:C5DHQ0"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ0"
FT                   /protein_id="CAR23311.1"
FT                   /translation="MTSNPPAVKAPREKPAAMFTCKSCRQRKRKCSREKPACQRCVRLA
FT                   IPCVYELPPKHLIRSVSTGTIEGVGADSAGGAGSAGSASASASTSVSVDVSGRSSACST
FT                   AGAAGSGLLRDFPAGFMHGSALASLPTLEPTGSLDTDTRISGQPLKVHFHTTLDLDSHL
FT                   HKDPFLLEFAASCVACGPQLARNPQSSGLGHAWFSLTVQCHDLLVPRLNSLKTPSPVPS
FT                   LLAPGTPRTRAFQGPRSEDFQASCAALIADISSALPSMQAIETYKVQFYQNVYTAVPVL
FT                   NIQTFERSFQDLVVGDSCGAARLKFGSADHHPKITHLVILLMAIRMGYVCLCLYNDRVE
FT                   RDALLKKQTELWLRQNAVPRDVLLLVKRCLELLDVYENPSEDILCCLIYLRQILLLERS
FT                   DGWSLIGVTNAELLEATVYLASRMNLYSNAIDTMTEGATTVQEKLYRRKLWLSICSISL
FT                   HEHTLRGGEPFVKARQLRQFSDHYQVFDDYRAISLRELPLDDQIELDYHIMLLKNHQFM
FT                   EVLCDIEESHPSNVEFLDNKVHENERLALFFKDGFPDADPAYKIDVNLPLYLLCNSGHI
FT                   PVRIGSVKQIAVFQTRFALLIKQLSNSSLLMFYYEKEYKFSNAVDSLYNFERHLFDSMK
FT                   ILLQLFEYYRDYAFGRLAEVTPSAMRYILANTMSPIFNRTTLVIHGIILRFVYLQERAD
FT                   FERDLEKAPLLQKIVSQLRALVVTSSDCMKMEFLPPKSLDLNRNFIRLLDARVLLISTK
FT                   QYAVLDDIDLEKQHDAMQICGPGYADYYNNAVTQLSLNSLGKFLQLLESTTFNKKSDSP
FT                   MNIFSNIASYSGASLDANENTSSFS"
FT   gene            <558501..>560345
FT                   /locus_tag="KLTH0E06138g"
FT                   /old_locus_tag="KLTH-ORF9464"
FT   CDS_pept        558501..560345
FT                   /locus_tag="KLTH0E06138g"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9464"
FT                   /product="KLTH0E06138p"
FT                   /note="similar to uniprot|Q07824 Saccharomyces cerevisiae
FT                   YLL028W TPO1 Proton-motive-force-dependent multidrug
FT                   transporter of the major facilitator superfamily able to
FT                   transport eight different compounds including polyamines
FT                   quinidine cycloheximide and nystatin involved in excess
FT                   spermidine detoxification"
FT                   /db_xref="GOA:C5DHQ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ1"
FT                   /protein_id="CAR23312.1"
FT                   /translation="MSTSLSSSSSSASFTHERGAGAAGAANRASSDDTRSSASDPTLNA
FT                   KMHSFDTAGNTGVADSGVMADDVRSDTDVLNERKRHSAASASFEQDLERTGTNATSETH
FT                   AAINRRVSRILSGSQNEVEKVKVDYSHCPPMGGGRPFPPTLPSREPYEVAFDGPDDPIH
FT                   PYNWPMRKRAFLCLLLGLNAVTVAMGSSIFASAVPQICAKYHVAQVVGVLGVTLYVFGF
FT                   AASPVIYAPLSELYGRQKLLIISSFGFVLFMFATATAKDLQTIMICRFFAGFIGAAPLA
FT                   IVPACFFDMFDNETRGTAVVVFAMGVFMGPILAPVFGSYIVQHTTWRWTQYCVGMFAAL
FT                   VTILLAIFYEETHHPTILVNKARRMRQISGNWGIRAAHEDAELSLKEIAQKTVTRPIYM
FT                   LVTEPILFAITLYHSFVYGILYLLLEAYPIVFVKKYHFYVNGELPYIALLIGMGVNAAY
FT                   NIWEEKSYVRKVRENSGKPLPEERLKTMILAGIVFPIGILWFCWTGNYSDKVHFMVPTV
FT                   AGSFIGFGLIGIFLPCFNYIIDSYLFLSASAIAGNTFMRSSFGAAFPLFAGFMFNNMGV
FT                   NWAGLLLGLFALAMVPVPILFIKYGKALRQRSKFAFVL"
FT   gene            <560782..>562956
FT                   /locus_tag="KLTH0E06160g"
FT                   /old_locus_tag="KLTH-ORF9461"
FT   CDS_pept        560782..562956
FT                   /locus_tag="KLTH0E06160g"
FT                   /gene_family="HOG000255713" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9461"
FT                   /product="KLTH0E06160p"
FT                   /note="similar to uniprot|Q07825 Saccharomyces cerevisiae
FT                   YLL029W Hypothetical ORF"
FT                   /db_xref="GOA:C5DHQ2"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ2"
FT                   /protein_id="CAR23313.1"
FT                   /translation="MSTRQNTLNMKNSLSSMNTFGGATPVAGSARPSRPCANCTCSPGL
FT                   LSRQNRRSSLLLRQVSSSRKRPILRTSVATGGSGESIYSSDTICQVKNVNTSERLLHLR
FT                   RKMSEKEICCYVVPSEDEHQSEYVSQADQRRSFISGFTGSAGVACITRDLLNFNNDKPE
FT                   GKSILSTDGRYFNQATQELDFNWTLLRQGEDKMTWPEWCVYEAKEMSLALGGKEARIGI
FT                   DPKLISYDQVIRFQKLIKDKTDGSKAKVSLVPVVENLIDAIWSRFEPLPVRDANDLLLL
FT                   NSHFTGETFKEKRERLMNYLNEKTPGCSTFCIAALDEISWLLNLRGSDIEYNPVFYAYL
FT                   LVHNEETILFTDDPYDDKIKGYFEDNNIAVKAYEDVWSFLCSTATKTKSSNDVMAIASG
FT                   SSWEIVRSLGNAPYKQIQSPLELLKAVKNDVEISNARAAQVKDAVCLVQYFAWLEEQLI
FT                   SKEALIDEYKAACKLVEIRKTQKNFMGNSFETISSTGPNAAIIHYAPPAENSAMIDPCR
FT                   IYLCDSGSQFLEGTTDITRTLHFTKPSDEEVRNYTLVLKGNLALERLVIPQGTSGYNID
FT                   VIARQFLWQHGLDYRHGTGHGVGSYLNVHEGPIGIGFRPHLGNFALEKGNIITNEPGFY
FT                   KDGEYGIRIENDMLVQKAEGLKFGEHEFLKFENITLVPYCRKLIDRKLLTHEEKAQINS
FT                   YYKRIWHTVVPFIQPQSISYKWLKRETAPL"
FT   gene            <563423..>564226
FT                   /locus_tag="KLTH0E06182g"
FT                   /old_locus_tag="KLTH-ORF9460"
FT   CDS_pept        563423..564226
FT                   /locus_tag="KLTH0E06182g"
FT                   /gene_family="HOG000216851" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9460"
FT                   /product="KLTH0E06182p"
FT                   /note="similar to uniprot|Q07821 Saccharomyces cerevisiae
FT                   YLL027W ISA1 Mitochondrial matrix protein involved in
FT                   biogenesis of the iron-sulfur (Fe/S) cluster of Fe/S
FT                   proteins isa1 deletion causes loss of mitochondrial DNA and
FT                   respiratory deficiency depletion reduces growth on
FT                   nonfermentable carbon sources"
FT                   /db_xref="GOA:C5DHQ3"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ3"
FT                   /protein_id="CAR23314.1"
FT                   /translation="MRFAMSCHESLAVRSLQAFRLFSSRSILLNSAPAQASHTENHTYR
FT                   ARNAKRFLQTNHLQRTLGNSGPERWSFDFNQEKKSAPFKKPALTPLKPFHQESKESTIQ
FT                   TAASPNASKWSTYSMPSKESLAKQQDQAKRQGQEIEKQLASEPKPVKKQKRRLRPRKAL
FT                   ISLTPNAVDHLKLLLNQPEPKLIRVGVKNRGCSGLTYDLEYITAPGKFDEVVEQDGVRV
FT                   ILDSKALFSIVGSEMDWIDDRLSSRFVFKNPNSKGTCGCGESFMV"
FT   gene            <564895..>567618
FT                   /locus_tag="KLTH0E06204g"
FT                   /old_locus_tag="KLTH-ORF9458"
FT   CDS_pept        564895..567618
FT                   /locus_tag="KLTH0E06204g"
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9458"
FT                   /product="KLTH0E06204p"
FT                   /note="highly similar to uniprot|P31539 Saccharomyces
FT                   cerevisiae YLL026W HSP104 Heat shock protein that
FT                   cooperates with Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold
FT                   and reactivate previously denatured aggregated proteins
FT                   responsive to stresses including: heat ethanol and sodium
FT                   arsenite involved in [PSI ] propagation"
FT                   /db_xref="GOA:C5DHQ4"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ4"
FT                   /protein_id="CAR23315.1"
FT                   /translation="MNDETQFTERALTILTLAQKLAQDHQHAQLQPVHILGAFVETPED
FT                   GSIPYLQNLIEKARYDYDTFRRTVNKHVVRIPQQNPAPAQVTPSYATGQVLQEAMKIQK
FT                   QQKDSFVAQDHILFALFKDSTIQQIFKEAQVDVEAVKQQALELRGNQKIDSRGADTSSS
FT                   LEYLSKYAIDMTEQARMGKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGKTAII
FT                   EGVAQRIIDDDVPSILFGSKLFSLDLAALTAGAKYKGDYEERLKGVLKEVEESKTLIIL
FT                   FIDEIHMLMGNGKDDAANILKPALSRGHLKVIGATTNNEYRSIVEKDGAFERRFQKIDV
FT                   QEPTTRQTVAILRGLQQKYEIHHGVRILDSALVTASQLAKRYLPYRRLPDSALDLVDIS
FT                   CAGVAVARDSKPEELDSKERALQLLQVEIKALERDEEADPTTKERLQQARQREASLQEE
FT                   LEPLRQRYNEERKGHEELTKAKKKLEELENKAADAERRYDTATAADLRYFAIPDLKNQI
FT                   EVLENQVLEEESRAGSGAMVQNVVDSDTIAETAARLTGIPVNKLTESENEKLIHMEREL
FT                   SSEVVGQSEAIKAVSNAVRLSRSGLSNPRQPASFLFLGLSGSGKTELAKRIAAFLFNDS
FT                   DAMIRVDCSELSEKYSVSKLLGTTAGYVGYEEGGFLTNQLQRRPYSVLLFDEVEKAHPD
FT                   VLTVMLQMLDDGRLTSGQGKTIDCSNCIIIMTSNLGATFISSQSGSRIEESTKNLVMGA
FT                   VKQHFRPEFLNRISSIVVFNKLSPKAIHRIVDIRLKEIEDRFEENDKHYKLDLTPEAKN
FT                   YLARNGYSEDMGARPLNRLIQNEILNRMAMRILKGQIKDKETVRVVLKHNENPDMEEPD
FT                   QLDVLPNHQSSDADMDVDNDWDEDLDDSVTDATPLD"
FT   gene            <568785..>571112
FT                   /locus_tag="KLTH0E06226g"
FT                   /old_locus_tag="KLTH-ORF9451"
FT   CDS_pept        568785..571112
FT                   /locus_tag="KLTH0E06226g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9451"
FT                   /product="KLTH0E06226p"
FT                   /note="weakly similar to uniprot|P38741 Saccharomyces
FT                   cerevisiae YHL024W RIM4 Putative RNA-binding protein
FT                   required for the expression of early and middle sporulation
FT                   genes"
FT                   /db_xref="GOA:C5DHQ5"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ5"
FT                   /protein_id="CAR23316.1"
FT                   /translation="MSLESATTAIDPTAAFAAQTSAKDGLLVPDVSDSIAQFLPTEVSS
FT                   SESEDEEEAGSAAGGSARPPTASDPHPESCGAPESESEFLEELDDISDGEGAGAASKEK
FT                   DSAPGAGAGAGAGAGAASGIASAHVAPRSGIAASEAAPKFRGRPSSCVFVASLAASLGD
FT                   DDLCLSVTENFKKFGRLTMVKVLRDPANRPYAFVQYTNDADAKKALKEAQGSSLNGRTI
FT                   RCGPARVNRTLFVCYKGRNLNSSGLVSAAFVNQLLEKFGELEQLVACRDQFFHRKNNAY
FT                   SGSDRSNAWFIQFAYRDDAIRAFANLKSDLNWVVEWAQNIEAPSHMNMLSDSKNLVIRE
FT                   ETEPENEGACIMPADSYSESSGSEVVIDQKSIFVGQLDPMATEEGVLERFSRHGSILEL
FT                   NLISKPNNVFAFIRFTTEEAAAAALEMENHAMFLNKTMHVQYREIGGIKKFRRGNYNHR
FT                   NNNNGVHGNHNPSGSGNGSRHESTSNSQAYNQATYQPPRLNLAPPPINVGKRRSSTGSG
FT                   NYNHHYQHYPFGHEFQVYAHQPHQLSMMGGPKKSKASLRHRNVEITKSIDESNNDSTNT
FT                   SSNNNNNDTDNLNGGASEKSKGLPNELKSAASQSFVTDVTSDTSGSAGNNDASTNASTS
FT                   RYTYSAGGINYKKKLDEYKKRGNYPTFDPYYYPPYYYPVEFPLNPMGPSGLAGRAGPGA
FT                   PLSASGSPAHPGNQPYFMYYPLPQGSGMEFADMHNMMVPHLGGSPGPMGSPIFPLPISQ
FT                   QHFIPSDRSVSFNGEEKAALEY"
FT   gene            complement(<571398..>574007)
FT                   /locus_tag="KLTH0E06248g"
FT                   /old_locus_tag="KLTH-ORF9445"
FT   CDS_pept        complement(571398..574007)
FT                   /locus_tag="KLTH0E06248g"
FT                   /gene_family="HOG000094523" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9445"
FT                   /product="KLTH0E06248p"
FT                   /note="some similarities with uniprot|P38742 Saccharomyces
FT                   cerevisiae YHL023C RMD11 Protein required for sporulation"
FT                   /db_xref="InterPro:IPR005365"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ6"
FT                   /protein_id="CAR23317.1"
FT                   /translation="MSLNLPNPCLLGIVLTISTHSGPQVVFHYPPTDRSPGSRHVKRQQ
FT                   KADDHGFENKESSYSLRSQGKGSTPKKRSQKFQHDGESEANLSIHSNKTENVDSDMSSS
FT                   SSDEDPSTGLSDGDISTDYADVSSSSSSSASDSESEDFNATRSYLENSASLKSQDISMS
FT                   GSFKGTQVSATKVFQLLRPDESKRNSVVSRHTSTRGPEVSWLNAVRSISDSEYGEEPLC
FT                   ELNDQHFGSDFQDINKILRFDKDFFAEISSPPKEMCNTRFELTIDELALVGLPIHRNAD
FT                   GQWRKTKKRKSSSRSKRSNSSSRTRKVSRSHYEGTDVTGDSEILEEQLSGSQLFEEETG
FT                   KAEYEALEKSVNMFHLCFLTNPRLVEYNKRVDDIYHYVVSRLSLVLRYAQIKSGYVTRE
FT                   CYEIIKTQDRILKSSERYKSIKGPANKARYLYQKIIQRSSLARAISKCFDAISQNEVAN
FT                   LEINGDKIISLQIPIINEFDVLPDLKTDPVLKGSFLTSILNRKFLEEGSATMNEAWARS
FT                   HDENDDLLDYAVLLLNEPAIIIQELQFSSPQNDITSVLLTSLVKHLKPTVPLRNYQYVI
FT                   DEIVGKPVASESDVEERNSFQTSMLRSLALHLMYWRHARVIIPVSSKNTYIVSPLAPIT
FT                   GNTKDDFSGNRLDSEESKPLILQNQEVFSKKFPSLPPLPVFLSLVSSMKPRAFGSIIPS
FT                   KDHKSVYLSALAWLIRYGYLTQLLTFAWVRVDSRIKIAVDEDLEIDGVRRSKRAQGQSL
FT                   NSDISDNIVSRDQIRTDSAEDDLDFFYYGGDEDIINNSDFTIILSPETATAVEKRWLYK
FT                   CIEGQPVDIQVMFHRVVKYMNGKIPIELVQLREGISRHEIKRLFHALGKYLVDVYHW"
FT   gene            <575037..>575108
FT                   /locus_tag="KLTH0E06270r"
FT                   /old_locus_tag="Klth0E.tHis.GTG.11"
FT   tRNA            575037..575108
FT                   /locus_tag="KLTH0E06270r"
FT                   /old_locus_tag="Klth0E.tHis.GTG.11"
FT                   /note="tRNA-His (GTG) cove score=63.64"
FT   gene            complement(<575313..>575921)
FT                   /locus_tag="KLTH0E06292g"
FT                   /old_locus_tag="KLTH-ORF9443"
FT   CDS_pept        complement(575313..575921)
FT                   /locus_tag="KLTH0E06292g"
FT                   /gene_family="HOG000160229" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF9443"
FT                   /product="KLTH0E06292p"
FT                   /note="similar to uniprot|P32803 Saccharomyces cerevisiae
FT                   YGL200C EMP24 Integral membrane component of endoplasmic
FT                   reticulum-derived COPII-coated vesicles which function in
FT                   ER to Golgi transport"
FT                   /db_xref="GOA:C5DHQ7"
FT                   /db_xref="InterPro:IPR000348"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ7"
FT                   /protein_id="CAR23318.1"
FT                   /translation="MKFFICSLVALMWCSLCGAHNVLLPAYGERCFFETLSKNDELAVS
FT                   FQFGDRAPDSTEQLKGDFIMYSSDRRDALRTFRDVSHGDVRLRVPHGGKFEYCFVNINS
FT                   GATTKDVTFNIEGTIFVDPNDPKSDSLDGAVKQLSRLTKELKNEQSYIVIRERTHRNTA
FT                   ESTNDRVKWWSVFQLGVVIASSLFQVYYLRRFFEVTSYV"
FT   gene            complement(<577084..>578536)
FT                   /locus_tag="KLTH0E06314g"
FT                   /old_locus_tag="Klth0E.mRNA.3152.m"
FT   CDS_pept        complement(join(577084..577842,578360..578536))
FT                   /locus_tag="KLTH0E06314g"
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0E.mRNA.3152.m"
FT                   /product="KLTH0E06314p"
FT                   /note="highly similar to uniprot|P32598 Saccharomyces
FT                   cerevisiae YER133W GLC7 Catalytic subunit of type 1
FT                   serine/threonine protein phosphatase involved in many
FT                   processes including glycogen metabolism sporulation and
FT                   mitosis interacts with multiple regulatory subunits
FT                   predominantly isolated with Sds22p"
FT                   /db_xref="GOA:C5DHQ8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:C5DHQ8"
FT                   /protein_id="CAR23319.1"
FT                   /translation="METPAVDLDNIIDRLLEVRGSKPGQQVDLEEHEIRFLCSKARSIF
FT                   IKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI
FT                   IDEKIFCMHGGLSPDLNTMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGV
FT                   SFTFGPDVVSRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAM
FT                   MSVDESLLCSFQILKPAQKTLPRPQGKKKK"
FT   gene            <579448..>579554