(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_6

ID   LACTH_6; SV 1; linear; genomic DNA; STD; FUN; 1632914 BP.
XX
AC   CU928170;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome F complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1632914
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1632914
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1632914
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="F"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0F"
FT                   /db_xref="taxon:381046"
FT   gene            complement(<4885..>5721)
FT                   /locus_tag="KLTH0F00110g"
FT                   /old_locus_tag="KLTH-ORF7854"
FT   CDS_pept        complement(4885..5721)
FT                   /locus_tag="KLTH0F00110g"
FT                   /gene_family="HOG000190855" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7854"
FT                   /product="KLTH0F00110p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DJX9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJX9"
FT                   /protein_id="CAR23780.1"
FT                   /translation="MMSDAWGLQAKEYAEKLQKGPPKASVDAILQAVDSLLPFEKAKSI
FT                   LDNGCGTGLGTQTLIDKYGHQLPDLIHLVAADLSPGMIESVRMTKAAHKGNRFWDRLEL
FT                   QVCSVDNMSKTQNSCFSHIIASLVFFFAKPEATFSEAYRILQPGGVIGFTSFRENQWMD
FT                   LRNVAKKINPGLEPAPLPAEWASEEWIKRQLEKANFIDIKIEPMEVYVELDDSLPLATL
FT                   LVRSGIPEMSAVFQSLTDEEKDRAVQLIVEELAERYPKRPAKIPGILLVSSARKQL"
FT   gene            complement(<6732..>7352)
FT                   /locus_tag="KLTH0F00132g"
FT                   /old_locus_tag="KLTH-ORF7851"
FT   CDS_pept        complement(6732..7352)
FT                   /locus_tag="KLTH0F00132g"
FT                   /gene_family="HOG000158603" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7851"
FT                   /product="KLTH0F00132p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DJX7"
FT                   /db_xref="InterPro:IPR004898"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJX7"
FT                   /protein_id="CAR23781.1"
FT                   /translation="MRGQAVVAIFTSLLTASTVSSSPSYYGSPERQRNKRELLPRSSGT
FT                   SVLKAAQTVAAGKTFDGGMKVFDRGVTCTGQAEGSSSDAVFIIESGGTLSNVIIGPNQI
FT                   EGIHCKGGCTLNNVWWSDVCEDAFTIKTQTESQTTYIKGGGAFGAADKVIQHNGAGTVS
FT                   VSDFTVGDFGKLYRSCGNCKNMYKRNVVLNNITATSGKILVGM"
FT   gene            <10631..>14995
FT                   /pseudo
FT                   /locus_tag="KLTH0F00154g"
FT                   /old_locus_tag="pseudo-Klth0F-10631-14995"
FT   gene            complement(<18324..>18956)
FT                   /locus_tag="KLTH0F00176g"
FT                   /old_locus_tag="KLTH-ORF7836"
FT   CDS_pept        complement(18324..18956)
FT                   /locus_tag="KLTH0F00176g"
FT                   /gene_family="HOG000154814" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7836"
FT                   /product="KLTH0F00176p"
FT                   /note="similar to uniprot|P53058 Saccharomyces cerevisiae
FT                   YGL258W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR019435"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY1"
FT                   /protein_id="CAR23782.1"
FT                   /translation="MWLSTLFLFVTGILSTSVAAFRYDWSNITCKGLHGPHCGTYLLKV
FT                   KNQNDTYLGQSYFVGADALANDATDAWGRLLHEEYRFIPRLTTVQTLNDTGNFRPFVGT
FT                   TDMSTCNFQSVENAVVPYINTVTNELSYDSWASISMNATAVTGVAPQLLKASTYGIQVA
FT                   ICNPGFITDLFQSPTVNLFNVEDTLPSWCEAIEVEAVCPADVNYDTR"
FT   gene            complement(<19990..>20062)
FT                   /locus_tag="KLTH0F00198r"
FT                   /old_locus_tag="Klth0F.tLys.CTT.42"
FT   tRNA            complement(19990..20062)
FT                   /locus_tag="KLTH0F00198r"
FT                   /old_locus_tag="Klth0F.tLys.CTT.42"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   gene            <21017..>21087
FT                   /locus_tag="KLTH0F00220r"
FT                   /old_locus_tag="Klth0F.tGly.GCC.1"
FT   tRNA            21017..21087
FT                   /locus_tag="KLTH0F00220r"
FT                   /old_locus_tag="Klth0F.tGly.GCC.1"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            complement(<21856..>22284)
FT                   /locus_tag="KLTH0F00242g"
FT                   /old_locus_tag="KLTH-ORF7833"
FT   CDS_pept        complement(21856..22284)
FT                   /locus_tag="KLTH0F00242g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7833"
FT                   /product="KLTH0F00242p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DJY2"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY2"
FT                   /protein_id="CAR23783.1"
FT                   /translation="MDSRGLTISLESIKKVCLMLLEPNYKSRQEVCDKIYENYATLLQD
FT                   AVVESKEKPRSGQQRRTLLSKDTRLFLESVFEKKRSPNSRERKAIADKCGLTPIYISFS
FT                   VFSSSQGHGSQQKTFPTYSPIFLTFFMFWSNFRTFNTP"
FT   gene            <22655..>23332
FT                   /locus_tag="KLTH0F00264g"
FT                   /old_locus_tag="KLTH-ORF7832"
FT   CDS_pept        22655..23332
FT                   /locus_tag="KLTH0F00264g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7832"
FT                   /product="KLTH0F00264p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY3"
FT                   /protein_id="CAR23784.1"
FT                   /translation="MILSELNKVENMNWTEGYAECHLPKVANQIKYKFGTQKTLGKDRF
FT                   PCIAQRKCPKQICHFVTSGKTDKIKQSGLKSRNKFILMRGLLHCMVQQLRNCSDPFNAN
FT                   RAKVEEVSKIASAIWRTNKGVFQSYHEMLAVFEDSKSTNITISKSTLKKLTEAIGRECI
FT                   PSTYSYETLTNGADTTAMESKKTYKAFCGRFSLKEATGRVRKKKPTQTFALRSAKIEDI
FT                   FLI"
FT   LTR             complement(24067..24483)
FT                   /locus_tag="KLTH0F00286t"
FT                   /old_locus_tag="Klth0F.LTR.1"
FT   gene            complement(<26133..>27077)
FT                   /locus_tag="KLTH0F00308g"
FT                   /old_locus_tag="KLTH-ORF7829"
FT   CDS_pept        complement(26133..27077)
FT                   /locus_tag="KLTH0F00308g"
FT                   /gene_family="HOG000225104" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7829"
FT                   /product="KLTH0F00308p"
FT                   /note="highly similar to uniprot|P28272 Saccharomyces
FT                   cerevisiae YKL216W URA1 The enzyme catalyzes the conversion
FT                   of dihydroorotic acid to orotic acid dihydroorotate
FT                   dehydrogenase"
FT                   /db_xref="GOA:C5DJY4"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY4"
FT                   /protein_id="CAR23785.1"
FT                   /translation="MPASLKTEFLGQSFENPFMNASGVHCMSKRELDELKNSGAGSYIT
FT                   KSSTTLSREGNPAPRYHSVPLGSINSMGLPNEGFDYYLDYVLQYQKENPENVPPFFSVA
FT                   GMSLNENLELLKKIQDSEYRGITELNLSCPNVPGKPQVAYDFEITKEILTKAFEFFKKP
FT                   LGVKLPPYFDFAHFDIMAKILNEYPLAYVNCINSIGNGLYIDIEREAVVIKPKDGFGGL
FT                   GGEYVKPTALANVRAFYTRLNPSIRIIGTGGIRTGQDAFEHILCGATMLQVGTELYKEG
FT                   ASIFERLGKELKEIMEKKGYNSIEEFRGKLNNL"
FT   gene            complement(<27980..>28891)
FT                   /locus_tag="KLTH0F00330g"
FT                   /old_locus_tag="KLTH-ORF7828"
FT   CDS_pept        complement(27980..28891)
FT                   /locus_tag="KLTH0F00330g"
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7828"
FT                   /product="KLTH0F00330p"
FT                   /note="similar to uniprot|P32331 Saccharomyces cerevisiae
FT                   YPR058W YMC1 Putative mitochondrial inner membrane
FT                   transporter member of the mitochondrial carrier (MCF)
FT                   family"
FT                   /db_xref="GOA:C5DJY5"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY5"
FT                   /protein_id="CAR23786.1"
FT                   /translation="MSDELTMPQVVDDLADKSDFHRATKDVLAGISGGIAQVLVGQPFD
FT                   ITKVRLQTSSTSTTAFKVIKDLIKNEGVSAFYKGTTTPLIGVGLCVSSQFGTNEAMKRY
FT                   FHRKNNFQSPTLRLSEYYVCGFVSGSANAFLATPIEHVRIRLQVQTKSLAEAEYRGAID
FT                   CIKKLLAEGKLMRGFTPTISRTSHGFGVYFLSYETMICGERKRGVARENIPAWKLCLFG
FT                   ALSGSLLWMMVYPFDVIKSVMQTDKLRKPVYGNNVVEVAKNIYRERGAGAFLKGFGPTM
FT                   LRSLPVNGATFTTFEMAMRLMN"
FT   gene            <30187..>30670
FT                   /locus_tag="KLTH0F00352g"
FT                   /old_locus_tag="Klth0F.mRNA.at.317.p"
FT   CDS_pept        join(30187..30250,30300..30670)
FT                   /locus_tag="KLTH0F00352g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0F.mRNA.at.317.p"
FT                   /product="KLTH0F00352p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY6"
FT                   /protein_id="CAR23787.1"
FT                   /translation="MTRYFACLYIQRRLASSGARKREVQQVNRERERLHWESEKNARKQ
FT                   VEEVLVAGSRAVVARTSASESATNLANCFNNFIADGANGDFAALATSIAEFTVATAGSK
FT                   DAQDFLCALKDLTGTEEEMTDKVIDLNIHLQRLFANQTLT"
FT   gene            complement(<30927..>31676)
FT                   /locus_tag="KLTH0F00374g"
FT                   /old_locus_tag="KLTH-ORF7823"
FT   CDS_pept        complement(30927..31676)
FT                   /locus_tag="KLTH0F00374g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7823"
FT                   /product="KLTH0F00374p"
FT                   /note="weakly similar to uniprot|P01365 Saccharomyces
FT                   cerevisiae YCR040W MATALPHA1 Transcriptional co-activator
FT                   involved in regulation of mating-type-specific gene
FT                   expression targets the transcription factor Mcm1p to the
FT                   promoters of alpha-specific genes one of two genes encoded
FT                   by the alpha mating type cassette"
FT                   /db_xref="GOA:C5DJY7"
FT                   /db_xref="InterPro:IPR006856"
FT                   /db_xref="InterPro:IPR017931"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY7"
FT                   /protein_id="CAR23788.1"
FT                   /translation="MNSTKPSFKVLIKKKGKTLNRRLKNSSKSYRENGANLYMSYSKPQ
FT                   AIPKPPNTLINLVRSKKTSQSSRKCLKNDYILKELDVKKLSIYSNNTVLKKKINPFIGF
FT                   RSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVTSMCFTLWLEENY
FT                   QQSYEESELDSECMAKRSQPYIEDLYSGTGEFLTKLTSRELLDISGNHSGFQGSLNSLP
FT                   FFEEHNRTTDWMLSSILQCDQVPYYPN"
FT   gene            <31990..>32612
FT                   /locus_tag="KLTH0F00396g"
FT                   /old_locus_tag="Klth0F.mRNA.10.p"
FT   CDS_pept        join(31990..32051,32348..32612)
FT                   /locus_tag="KLTH0F00396g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0F.mRNA.10.p"
FT                   /product="KLTH0F00396p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DJY8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY8"
FT                   /protein_id="CAR23789.1"
FT                   /translation="MSHISVSSLLNLPVFQASHQEKATSPITSQSCLVASGKQRKFNAT
FT                   AKKRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESIDSLLEP
FT                   ILNS"
FT   LTR             complement(33726..34066)
FT                   /locus_tag="KLTH0F00418t"
FT                   /old_locus_tag="Klth0F.LTR.2"
FT   gene            complement(<34215..>35240)
FT                   /locus_tag="KLTH0F00440g"
FT                   /old_locus_tag="KLTH-ORF7819"
FT   CDS_pept        complement(34215..35240)
FT                   /locus_tag="KLTH0F00440g"
FT                   /gene_family="HOG000046976" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7819"
FT                   /product="KLTH0F00440p"
FT                   /note="similar to uniprot|P25379 Saccharomyces cerevisiae
FT                   YCL064C CHA1 catabolism of hydroxy amino acids catabolic
FT                   serine (threonine) dehydratase"
FT                   /db_xref="GOA:C5DJY9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJY9"
FT                   /protein_id="CAR23790.1"
FT                   /translation="MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRG
FT                   IGYMITKQAIKIRSEGNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQ
FT                   KIWNLGAEVHVYGRNWKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDE
FT                   IIDSLKEQKIDLKNIKAIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNS
FT                   SLKLGKLTEFEDITSIATSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADET
FT                   NIIPEPACGAALHLGYYPDILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSKKIL
FT                   Q"
FT   gene            <35640..>36995
FT                   /locus_tag="KLTH0F00462g"
FT                   /old_locus_tag="KLTH-ORF7818"
FT   CDS_pept        35640..36995
FT                   /locus_tag="KLTH0F00462g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7818"
FT                   /product="KLTH0F00462p"
FT                   /note="weakly similar to uniprot|P25591 Saccharomyces
FT                   cerevisiae YCL063W VAC17 vacuole inheritance"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ0"
FT                   /protein_id="CAR23791.1"
FT                   /translation="MEQLQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDK
FT                   SSTNMAQYYEYIGQLYSLYTKAQKLSDTVILSDSKSLSSVQQRAIENLIQEFQEIAKND
FT                   ENFISYSMRESPNSMSVQSICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDE
FT                   TNLATASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRLN
FT                   FFKDRQRLSISFIEDEEDVSDEATVISAGSLQSAYIFETDIKSSPFKSQIGEKEIRIPK
FT                   AGYLAVGEKSKGFNNLLSATPSAPQIGITEVDYKPNFGFSHQPGVEREASQSKKMLSQL
FT                   VSQGNKTKCKNWFNECDGLGKPISNTLRLLNNLVLVTSETGLRSVNNTTSAKLLMPPRK
FT                   RKEKQAAHGSCSIFIHGSSRSKFVTAPQQTKLHFKVSHGALQEALNTDLDFK"
FT   gene            complement(<37017..>39998)
FT                   /locus_tag="KLTH0F00484g"
FT                   /old_locus_tag="KLTH-ORF7816"
FT   CDS_pept        complement(37017..39998)
FT                   /locus_tag="KLTH0F00484g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7816"
FT                   /product="KLTH0F00484p"
FT                   /note="weakly similar to uniprot|P25588 Saccharomyces
FT                   cerevisiae YCL061C MRC1 S-phase checkpoint protein found at
FT                   replication forks required for DNA replication also
FT                   required for Rad53p activation during DNA replication
FT                   stress where it forms a replication-pausing complex with
FT                   Tof1p and is phosphorylated by Mec1p protein involved in
FT                   replication checkpoint"
FT                   /db_xref="InterPro:IPR018564"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ1"
FT                   /protein_id="CAR23792.1"
FT                   /translation="MDLIDNLRARNRGSGTAKKVKERGCDSLPLVTGTGFLFGNSVLRR
FT                   VKSRLGDDENHEADSTKSPIDNGCCDLSQTQVVGLAYDGEDLEQDFADSTARIEGKSWA
FT                   GPTNKPNYPKDKRRVSSNNSTVERRIPRSELESTEVNTQLISPHQVKEIDELETQLLLP
FT                   DVDLHPTNQSSNNTILDGTITQISGFGETCHDNAIQATSKDVSDTSTFVPITTKTKYSN
FT                   SSLSFNANDPEEESNTIAMSPADATERDRTIRKRFDAQSFIESFDDETDELQSCAASNA
FT                   SETEAPVLKQLEDGEKNANNLKKPTHFESNRENNPNKDSSSIKIFPTMFEENKADASAI
FT                   ILSSSSEEEEDYESKKPSFKAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLR
FT                   KANKSQILDYRKEKYQSKGIDYDKITEEKNSIESLLERELARNKKIRLREIEQERQNER
FT                   KDFGEQSSAFDYSNDELEEEPSDEEIDENQSSSPVSLHSGIVCADDAVECAANRMQDLK
FT                   QTIKPNEEEDAIRKSGLRKHKKFCLIDTDEEDGSVLNSGNIIDLGAYGSNIGNLNQIEQ
FT                   EQVGEHVGAHIENDLTTTGRNKNLIKPSSRSSSFQVEDNSHEDMNPGVIRELIEKHKRK
FT                   ELLREAKLEKLHQSKASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNS
FT                   RFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFRKRGRNALDLELSDDDDEELLKYH
FT                   SRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALEDEGPPPVRGFSSVNA
FT                   PEEKNSDSDKKGKKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGSLPTHVPSFNTEET
FT                   QDIFALKQNSSIKSLSAPTRNSSNMLIDDQEDLLSRKRACSFFARFTKRVDANEKFEEG
FT                   KKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVAHQQSRKRGHKPAAGFGIFASNSE
FT                   SFES"
FT   gene            complement(<40222..>41220)
FT                   /locus_tag="KLTH0F00506g"
FT                   /old_locus_tag="KLTH-ORF7812"
FT   CDS_pept        complement(40222..41220)
FT                   /locus_tag="KLTH0F00506g"
FT                   /gene_family="HOG000116208" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7812"
FT                   /product="KLTH0F00506p"
FT                   /note="highly similar to uniprot|P25586 Saccharomyces
FT                   cerevisiae YCL059C KRR1 Essential nucleolar protein
FT                   required for the synthesis of 18S rRNA and for the assembly
FT                   of 40S ribosomal subunit"
FT                   /db_xref="GOA:C5DJZ2"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ2"
FT                   /protein_id="CAR23793.1"
FT                   /translation="MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLF
FT                   PKYREAYLKSVWNDVTRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLL
FT                   ARSVPFPQAVKILQDDTACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCY
FT                   ILVQGNTVSAMGPFKGLKEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSR
FT                   FLPMFKKRNVARKKPKNIKPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKL
FT                   EERKREQAEKQVEKNKERAKDYVAPIEKGYEGSSKKRRHEVQESPKKKTKV"
FT   gene            <41595..>41909
FT                   /locus_tag="KLTH0F00528g"
FT                   /old_locus_tag="KLTH-ORF7809"
FT   CDS_pept        41595..41909
FT                   /locus_tag="KLTH0F00528g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7809"
FT                   /product="KLTH0F00528p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ3"
FT                   /protein_id="CAR23794.1"
FT                   /translation="MARKGSGKKPRSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISE
FT                   LNEREHNTKRTPALESLKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL
FT                   "
FT   gene            complement(<42092..>42340)
FT                   /locus_tag="KLTH0F00550g"
FT                   /old_locus_tag="KLTH-ORF7808"
FT   CDS_pept        complement(42092..42340)
FT                   /locus_tag="KLTH0F00550g"
FT                   /gene_family="HOG000205880" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7808"
FT                   /product="KLTH0F00550p"
FT                   /note="similar to uniprot|Q96VH5 Saccharomyces cerevisiae
FT                   YCL057C-A"
FT                   /db_xref="InterPro:IPR007512"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ4"
FT                   /protein_id="CAR23795.1"
FT                   /translation="MSEQLKVSPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLF
FT                   KRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVKA"
FT   gene            complement(<42946..>43533)
FT                   /locus_tag="KLTH0F00572g"
FT                   /old_locus_tag="KLTH-ORF7807"
FT   CDS_pept        complement(42946..43533)
FT                   /locus_tag="KLTH0F00572g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7807"
FT                   /product="KLTH0F00572p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ5"
FT                   /protein_id="CAR23796.1"
FT                   /translation="MDTHPGKSRPLSKRGSRSCPDKPSTLEGQGKNIESALVSGLETIA
FT                   GIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSRRNASDIINLAISRSR
FT                   LKREQAEFMRRPVNPVRKVLNAKVTARIQEINQKLILVALELIQNIGYLTLVAADVLAF
FT                   GLTEKWKRLLERVSSIFAIARLLFSGFSSLTP"
FT   gene            complement(<43649..>44950)
FT                   /locus_tag="KLTH0F00594g"
FT                   /old_locus_tag="KLTH-ORF7806"
FT   CDS_pept        complement(43649..44950)
FT                   /locus_tag="KLTH0F00594g"
FT                   /gene_family="HOG000111205" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7806"
FT                   /product="KLTH0F00594p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ6"
FT                   /protein_id="CAR23797.1"
FT                   /translation="MITLRISSRTTPQGLQRDDLKARLIYQSMARSTEEKIAELQNLYP
FT                   DYGVDGLLDVLVSCGGSLKRSAQLLGDTTTPESSSKRFKSRQQQTLNRFLDVRLLPKAA
FT                   IKTNGSKASRPIELHSKEDVESTLKYCTYHPNVLPLELANKLLEALSKDTSFKPNEFYL
FT                   FGNKCISNCKSRIFLPENRIEPFYYNGKRVESYSTYSDEIMMAQILVEELVNDVLSQRT
FT                   ALPFQVEAGKWEVQAVLSNSYSRDSNLDWHSDRLTNIGPHAIIASLSLGFTREFRVRRV
FT                   HPSNSSTYSLRPQHNSLIIMHAGFQEEYKHCVPFLPKNCNIPAEDVHPISNDVRVNLTF
FT                   RNYALTTKVFCKLCGFPMDLRRSFKDPSKRGLYIFQCSKSYTEENSFKEGRECKGFAFA
FT                   CFKKKPPFTEFETDGSRWIADDDLEAKQAQRQLK"
FT   gene            <46437..>47438
FT                   /locus_tag="KLTH0F00616g"
FT                   /old_locus_tag="KLTH-ORF7804"
FT   CDS_pept        46437..47438
FT                   /locus_tag="KLTH0F00616g"
FT                   /gene_family="HOG000144381" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7804"
FT                   /product="KLTH0F00616p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ7"
FT                   /protein_id="CAR23798.1"
FT                   /translation="MELQSKRSHSALGACQEGLPLKRRVLNLAPSPVSMSSRTNIPRSS
FT                   FLLSKNSTSEEDNEAYDSDFSKKPAVHFKTAPTVDSTLIDAVSKYSESEKEAPEDVGRA
FT                   NAGAATDPHEGLDSSYLLERRRSLSRHPSFSSSSRKQTVPRSDSVAQERCFDYLLQSID
FT                   EVWARYCNTTATAEAKVYDNLSKPQRALDPYTESHDDSFARKSSTPVTPRYQRVLSFAS
FT                   VNNFSDEDSDDTSGYKSEITNPTEYETDCDYRKISNLPDSIRLQSLKDRLCRAKNDLED
FT                   LHDSNSFDDCVRFWRRWDMIKYSAVEMMEEDDDDDIIESVIEELERGRCIVN"
FT   gene            <47778..>50513
FT                   /locus_tag="KLTH0F00638g"
FT                   /old_locus_tag="KLTH-ORF7803"
FT   CDS_pept        47778..50513
FT                   /locus_tag="KLTH0F00638g"
FT                   /gene_family="HOG000164493" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7803"
FT                   /product="KLTH0F00638p"
FT                   /note="weakly similar to uniprot|P37020 Saccharomyces
FT                   cerevisiae YJR040w"
FT                   /db_xref="GOA:C5DJZ8"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ8"
FT                   /protein_id="CAR23799.1"
FT                   /translation="MPFKNAAAHNDSNTFHSAMKGSSRRIRGRSSQRGGVSRAASVNLR
FT                   LEGLPGPGVINEVVQGTESPHPHSKALSQLTQISSIRSPIRNAGPQDYFHINSQGSSPT
FT                   KYGSTDQGRNGQESEASLYSESTQPPYLFPKFRNLTETLNSETLLPRNYYDDFTSVDWV
FT                   KDYLYDVWQKQQMSALRGFTGKLKRVYGNAQDWVLITVVAFSCSLLAFFIDKAEELLVD
FT                   LKRGYCKSNFFFNQQQCCASYTCANWKLWPEALRFLHGGVLRSDFMVYTFLSLILALSA
FT                   AKVTLTTKYINPLAFQTDKKIFKTMYHAYGSGVPEVKTILSGFIIRKFLGTYTLFSKSI
FT                   ALVLAIASGLSLGKEGPYVHLATCVGNIVSRQFAKFKLNGIERRVILSASAAAGVTLAF
FT                   GSPLGGVLFSLEEVSYFLPGNQLFKTFFSAIMANLFLRLLNPYGTGKAVLFEVKYSSDW
FT                   QTTELFLVTIIGAIGGVFGAYFCKFASFWGSWFRSKSFIREKHLREVALIALLTAALTF
FT                   PNSYTNISVAELLANLASPCFSPDDFTGKHGLCPVDRKSFPSEIVPLSYALIVKIVLTS
FT                   ITFGVKVPAGIYVPSMVIGALFGRIFATWFEHLASLYPNFFVFTQICNKSGLEGVCIDM
FT                   GIYAMISAGAFMAGVTRMNVTLAIIIFELTSSYNYVVPISIAIAVSNLVAHVIEPQSLY
FT                   EMLMRKNDLPFLDNRKVRDFRNHDGLREIVSTLKQGNGNIYVNLSEQKAFSSAVLREHL
FT                   SNLQKEGLVDGCIPIINNGKLAGVLPAPELELALDKLKCFADEFKLTQDLKVRLLEVDT
FT                   SIPSRGGDKNFTSPIESFPNLTSQEEWLAVNEILEKLCDLTPIVEKFPIMLDLNSSPSL
FT                   VELIFTKLGNRFISVLDGDEFVGLVHRKHFIDYCRDKAIL"
FT   gene            <51436..>52404
FT                   /locus_tag="KLTH0F00660g"
FT                   /old_locus_tag="KLTH-ORF7802"
FT   CDS_pept        51436..52404
FT                   /locus_tag="KLTH0F00660g"
FT                   /gene_family="HOG000247875" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7802"
FT                   /product="KLTH0F00660p"
FT                   /note="similar to uniprot|P25583 Saccharomyces cerevisiae
FT                   YCL055W KAR4 Transcription factor required for induction of
FT                   KAR3 and CIK1 during mating also required during meiosis
FT                   exists in two forms a slower-migrating form more abundant
FT                   during vegetative growth and a faster- migrating form
FT                   induced by pheromone"
FT                   /db_xref="GOA:C5DJZ9"
FT                   /db_xref="InterPro:IPR007757"
FT                   /db_xref="UniProtKB/TrEMBL:C5DJZ9"
FT                   /protein_id="CAR23800.1"
FT                   /translation="MSHDRTAPKNSIEHSRKRKSNASLKAAAHLHNNNYTDHYIHTGAL
FT                   PQKNVRNTDNPVEGYPNLQKLFRLKEKQIANHSSAPYGCRLDIDEMVPTLKNWIHNEKI
FT                   VFDVVMIGCLTDNQFIYPLLTGLPIDKLISKPGFLFIWGSAQKINELTRLLQNDGWAKK
FT                   FRKSEELVFIPIDKKSPFYPGLDNDDQVLFEKMQWHCWMCITGTVRRATDGHLIHCNVD
FT                   TDLSIETESTRKSAIPSHLYKVAENFSTATRRLHIIPARTGTETPVKVRPGWVIMSPDV
FT                   MLNNFDSKRYREDINKVGAHLPIRNEIELLRPKSPVQKRNS"
FT   gene            complement(<52524..>54041)
FT                   /locus_tag="KLTH0F00682g"
FT                   /old_locus_tag="KLTH-ORF7801"
FT   CDS_pept        complement(52524..54041)
FT                   /locus_tag="KLTH0F00682g"
FT                   /gene_family="HOG000180107" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7801"
FT                   /product="KLTH0F00682p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DK00"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK00"
FT                   /protein_id="CAR23801.1"
FT                   /translation="MPSYTFGGLDFQETPAAPNPEPSNTKFGVRTTDSPAIKNAPLPAE
FT                   GPSSKHFSNLLVLALITGIPFYVTRKLGGGTKTFVFFFLLFVLPILMAYWTLASTFSPR
FT                   LNEKCKLPGKPIEHYLTFHDDRLARKYHDKKIPMETFHELYFANKVSFNGDALEILEYR
FT                   HDWAQFSFTLSLFKFFLFGMIPEVIMHTRSQDEEQVRDHYDRGDDFYAWFLGPRMVYTS
FT                   GVISDIESEETLEQLQDNKLKVVCDKIDLKAGEYLLDLGCGWGTLAAYASKVCGAKVTG
FT                   ITLGRNQTKWGNEKLELQGISETQSRILCLDYRDTPMATAEGKKYDKITCLEMAEHVGI
FT                   RKFGAFLQQVYDMLEDDGLFYLQYAGLRKSWQYEDLIWGLFMNKYIFPGADASTPLDFV
FT                   VGKLEGSGFEVVSIDNIGVHYSATLWRWYRNWMGNKDSVVNKYGVKWFRVWEYFLATST
FT                   IISRQGSATCFQIVLRKNINAYHRIEYVPKQKGLLGPIKEGVPKWFK"
FT   gene            <55161..>57653
FT                   /locus_tag="KLTH0F00704g"
FT                   /old_locus_tag="KLTH-ORF7798"
FT   CDS_pept        55161..57653
FT                   /locus_tag="KLTH0F00704g"
FT                   /gene_family="HOG000176256" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7798"
FT                   /product="KLTH0F00704p"
FT                   /note="similar to uniprot|P25582 Saccharomyces cerevisiae
FT                   YCL054W SPB1 AdoMet-dependent methyltransferase involved in
FT                   rRNA processing and 60S ribosomal subunit maturation
FT                   methylates G2922 in the putative tRNA docking site of the
FT                   large subunit rRNA and in the absence of snR52 U2921
FT                   suppressor of PAB1 mutants"
FT                   /db_xref="GOA:C5DK01"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012920"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK01"
FT                   /protein_id="CAR23802.1"
FT                   /translation="MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKIIQINEKFGHFME
FT                   KSKVVIDLCAAPGSWCQVASNLCPVNSLIIGVDIVPMKPMPNVITFQSDITTEDCRSKL
FT                   RGYMKTWKADTVLHDGAPNVGLGWAQDAFTQSHLTLQALKLAVENLVVGGTFVTKIFRS
FT                   KDYNKLIWVFSQLFDKVEATKPPASRNVSAEIFVVCKGFKAPKKLDSRLLDAREVFEEL
FT                   PDGPQNNEAKIFNPEKKVRKRQGYEEGDYLLYHHKPIMEFVKCEDPIDMLGNLNKFTVN
FT                   SEDHEWKILKKLKQTTPEFMMCIEDLKVLGKKDFKMILKWRKAARELLGIEKEEEPVVE
FT                   TTHLTEEEQIQSEVQALQEKQRLSQKREKRKKNEMKQKELTRMQMNMLTPMDIGVESAE
FT                   LGRESLFNLKSAEKTGILDKLAKGKRRMVFTQGELAQDNDVHIADDAPLADRDDAAEAD
FT                   ELESQLNSMYQNYKEKKAEKDAKYRAKQARGGDDNEWTGFGDEDSEHSSAVEDDHVSED
FT                   ENSDLSDSDDDEAINRLIAKMKNKEGENGLSSKAQALFNQSIFEGVEADLPAPEEPVNA
FT                   SVTAHVERLESLGKNQGDENNLSQESSSDSENSDFEVVAREDEDQVMDSDFDSDDENQS
FT                   QKEKHAEEIDIATVEAMTLAHQLALGQRTKHDLVDEGYNRYAFRDTENLPEWFLEDERP
FT                   HSKINRPITKEAAIAIKEKMKALNARPIKKVAEAKARKAMRAVARLEKIKKKAGLINDD
FT                   GDKSEKDKADEIAKLMRKVTKKQKQKPKVTLVVATGKNRGLSGRPKGVKGKYKMVDGVL
FT                   KNEQRALKRIAKKHHKKK"
FT   gene            complement(<57703..>58947)
FT                   /locus_tag="KLTH0F00726g"
FT                   /old_locus_tag="KLTH-ORF7796"
FT   CDS_pept        complement(57703..58947)
FT                   /locus_tag="KLTH0F00726g"
FT                   /gene_family="HOG000115465" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7796"
FT                   /product="KLTH0F00726p"
FT                   /note="similar to uniprot|P25580 Saccharomyces cerevisiae
FT                   YCL052C PBN1 Essential component of
FT                   glycosylphosphatidylinositol-mannosyltransferase I required
FT                   for the autocatalytic post-translational processing of the
FT                   protease B precursor Prb1p localizes to ER in lumenal
FT                   orientation homolog of mammalian PIG-X"
FT                   /db_xref="GOA:C5DK02"
FT                   /db_xref="InterPro:IPR013233"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK02"
FT                   /protein_id="CAR23803.1"
FT                   /translation="MNTSRKNDKTRVTILFEDAEDLQQNSVNALDSIVIKGRGQLVQRR
FT                   ATSELPHNINKSFKTLRITWKSPESPGISAIAPPLSSGLNIYVSGDSERTPGAIRSAKY
FT                   DLLHSNDYDDSLISRFLPKDFNLTELRLKDRDYDIVVDDKIHVNEYYAIKDGFNETLRY
FT                   EEAYGRLEVGLFFAEPSDQLDANLNGLRCTWSFTGQIDKCQKTYLFYQQAHNMSINSTT
FT                   VVEQVGPVGLHPTVRVDLRGETSSEHCRHFMYLAAPTGLFIDKFQSSPIFVAGADDLEL
FT                   PEYKIGDDTWGFESLFSLKPGQLNDIQLHTRYVKPRARGGFKHIHYSPIVFRACDTGNM
FT                   EVQNNPFYTRSLGLESFFTNDTVFQHFHSATLSVSVPAANTNDFQAVWLVTSMCLVLSV
FT                   AYLLIKVYTRQNSQR"
FT   gene            <59375..>60589
FT                   /locus_tag="KLTH0F00748g"
FT                   /old_locus_tag="KLTH-ORF7795"
FT   CDS_pept        59375..60589
FT                   /locus_tag="KLTH0F00748g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7795"
FT                   /product="KLTH0F00748p"
FT                   /note="some similarities with uniprot|P25579 Saccharomyces
FT                   cerevisiae YCL051W LRE1 Protein involved in control of cell
FT                   wall structure and stress response inhibits Cbk1p protein
FT                   kinase activity overproduction confers resistance to
FT                   cell-wall degrading enzymes"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK03"
FT                   /protein_id="CAR23804.1"
FT                   /translation="MMDADRLKVPSSGEPLAPGDCTPSRRGHRHKRSFAISQDLDFLRQ
FT                   PPGTPQEKPTHQTSPPVQHSDMSPRFFMSEESTFSHDVPNAIIDLDDALTTKPQSFTSH
FT                   RRAESAPANLILPFKIEPSKPPAQPLRIEEEDSESDNEYVLHDSLMSPLRAKSQSPFLK
FT                   SPSASTKSPQPARRSQYNNNALKINKQKERYLNYSKQLPAAGSQIQNQCCPQEPSSTSL
FT                   SSDLTSEATTPAATVNTPNTPIFSVLKFSGRSPSPRKTFNFESQVYDLPSTDSAVSDDG
FT                   KDADDGNTLTFTVTNATYEPMHRRSKSVAACEASEGLRIPKEILLGEPGGSVDLSKTVT
FT                   DPKGEAAPSSKLEKPFKASVSGSYENRSVSDSAVVNDKISGSHSRRRGKLNILSSIFSR
FT                   LKSSK"
FT   gene            complement(<60934..>61320)
FT                   /locus_tag="KLTH0F00770g"
FT                   /old_locus_tag="KLTH-ORF7793"
FT   CDS_pept        complement(60934..61320)
FT                   /locus_tag="KLTH0F00770g"
FT                   /gene_family="HOG000188221" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7793"
FT                   /product="KLTH0F00770p"
FT                   /note="similar to uniprot|P00128 Saccharomyces cerevisiae
FT                   YDR529C"
FT                   /db_xref="GOA:C5DK04"
FT                   /db_xref="InterPro:IPR003197"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK04"
FT                   /protein_id="CAR23805.1"
FT                   /translation="MPQTITSIVKMGDFILRSPALSKVVVPVAQQFVKFAGYRQLGLKF
FT                   DDIIAEENDIAQTALRRLPEDEGYARAFRMIRAHQSELTHHLLPKSQWVKPEEDTLYLT
FT                   PYLLEAEAEAKEREELDNLQLTTK"
FT   gene            complement(<61554..>62507)
FT                   /locus_tag="KLTH0F00792g"
FT                   /old_locus_tag="KLTH-ORF7792"
FT   CDS_pept        complement(61554..62507)
FT                   /locus_tag="KLTH0F00792g"
FT                   /gene_family="HOG000248604" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7792"
FT                   /product="KLTH0F00792p"
FT                   /note="similar to uniprot|P16550 Saccharomyces cerevisiae
FT                   YCL050C APA1 and similar to uniprot|P22108 Saccharomyces
FT                   cerevisiae YDR530C APA2"
FT                   /db_xref="GOA:C5DK05"
FT                   /db_xref="InterPro:IPR009163"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019200"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK05"
FT                   /protein_id="CAR23806.1"
FT                   /translation="MAQDLATKVRETYANAAKNGYVHFFQSDSKKLKDPETGVQYMVTH
FT                   APSLLKKPERGDKEAEKRNPFAEPEPELTVCEDLFGEGEYKLLLNKFPVVPEHLLLVTK
FT                   EFKPQTSTLSPKDLITAYKLLQELDDEDEMVRNVVFYNCGASSGSSQDHKHLQMFKLPE
FT                   KFTLFQDRLCNGKEHYVPNVRTEPLQDSKLSFAHFAVPLPDEKEVDEELLAMTFVSLLQ
FT                   RTLTFFQDWTNEKPELETGYNVLLTKEWLCVVPRSASKSKELNIGLNATGYAGLVLVKH
FT                   EDVWEKLQENPHLIDKLLLECGFPNTAGQSSNEYHY"
FT   gene            <62916..>63986
FT                   /locus_tag="KLTH0F00814g"
FT                   /old_locus_tag="KLTH-ORF7790"
FT   CDS_pept        62916..63986
FT                   /locus_tag="KLTH0F00814g"
FT                   /gene_family="HOG000194691" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7790"
FT                   /product="KLTH0F00814p"
FT                   /note="similar to uniprot|Q04430 Saccharomyces cerevisiae
FT                   YDR531W Pantothenate kinase (ATP:D-pantothenate 4'-
FT                   phosphotransferase EC 2.7.1.33) catalyzes the first
FT                   committed step in the universal biosynthetic pathway
FT                   leading to CoA."
FT                   /db_xref="GOA:C5DK06"
FT                   /db_xref="InterPro:IPR004567"
FT                   /db_xref="InterPro:IPR011602"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK06"
FT                   /protein_id="CAR23807.1"
FT                   /translation="MGQNIEFQENQWNSTGLLTIAVDIGGSLAKLVFNPRNCRTLIFET
FT                   VETEKITEFMQLIHRIIKEYNSGDQATTRIIATGGGAYKFNDLLRSEFPRVIEIARLDE
FT                   MECLIKGLDFLIHEVPEEVFTYNDLDGEHVVVPEHAKVYPYMLVNIGSGVSISKVDSPT
FT                   KFTRVGGSSLGGGTLWGLLSLITGARTYDEMLDWAHSGDNTNVDMLVGDIYGTDYGKIG
FT                   LKSTHIASSFGKVFQRGTHAATADGVLSERPSQTSTEEIETRSRKFSNSDISKSLLYAI
FT                   SNNIGQIAYLQAKVHNVPNIYFGGSYIRGHLMTMNTLSYAINFWSNGKKQAFFLKHEGY
FT                   LGAMGALLTFQDRSST"
FT   gene            complement(<64053..>65141)
FT                   /locus_tag="KLTH0F00836g"
FT                   /old_locus_tag="KLTH-ORF7789"
FT   CDS_pept        complement(64053..65141)
FT                   /locus_tag="KLTH0F00836g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7789"
FT                   /product="KLTH0F00836p"
FT                   /note="weakly similar to uniprot|Q6Q537 Saccharomyces
FT                   cerevisiae YDR532C Protein of unknown function that
FT                   localizes to the nuclear side of the spindle pole body and
FT                   along short spindles forms a complex with Spc105p"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK07"
FT                   /protein_id="CAR23808.1"
FT                   /translation="MADDPTINGLELQLNAAEEHATALTEEALQNQDLHYKEVVEQLKR
FT                   SVEQLVEDNESLFTAVDLPPEVDPTCISGRILDLAQLTQQLKSTHLQQETLDNFLRYTI
FT                   SSTDILQLESESDERYASVSRAVSQLQDNDIIQLDSEVDQIKQDIRKAGQTIADQREAL
FT                   NELCLETGNLADECHTLLSELEEATRTREMVEKQAAVEVTNDHPVEEMYASWQSLKEEL
FT                   QQESHLRRHLNQLKQSKASLEAILGTKNGNEHKDTNVMQEYASYDAFIRFWISKFTNKE
FT                   MENLEVFPRSNKFQFTHRGTDVVISLGPRGISRVELYGKGIPLEKIAAARKDVNEEASR
FT                   GEELYMSINRIIDKIKEHTTVS"
FT   gene            complement(<65935..>67287)
FT                   /locus_tag="KLTH0F00858g"
FT                   /old_locus_tag="KLTH-ORF7787"
FT   CDS_pept        complement(65935..67287)
FT                   /locus_tag="KLTH0F00858g"
FT                   /gene_family="HOG000057087" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7787"
FT                   /product="KLTH0F00858p"
FT                   /note="similar to uniprot|Q04418 Saccharomyces cerevisiae
FT                   YDR527W"
FT                   /db_xref="InterPro:IPR013929"
FT                   /db_xref="InterPro:IPR013930"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK08"
FT                   /protein_id="CAR23809.1"
FT                   /translation="MDLLGDIVEKDVSEAPALHEAPPTGFPALYQPEKVSSWKVRLQQK
FT                   NKQKRTSQTSKRERDTPAKRAVEEPVIPPETEAQRIHQENVTRMRSMTPEQLEQERREL
FT                   LESLDPAVLHGLLKRAARREEPASLQESMKTVKAPLFAEVEGAPGTWVGGSREFSDLPH
FT                   LDDAAVDKALGIPETKAKHVKFQDQDDESRAEFPGDEEECFPEPLPDDDMAPQEYQFVQ
FT                   QMDHMNNEDLLKDVHFIRPNTVDNDFEALDINDPSFDEKLHKKYFPDLPKESDKMAWMK
FT                   PVSSAKPTGLIEDVTQCRFDFQGSLVPPDREIKSTQDGLHHHSEEPELAGYTIVELQHL
FT                   SRSTFPAQRCIAIQTLGRILYKLGKQSYNQLIPEVDAGTYEEMGGAEAILNHIYGMFWD
FT                   LCKVSMVIESLTDAADENSTKNLSVRNYAIDALWLWKEGGGDFRTGKNENK"
FT   gene            complement(<67565..>67795)
FT                   /locus_tag="KLTH0F00880g"
FT                   /old_locus_tag="KLTH-ORF7785"
FT   CDS_pept        complement(67565..67795)
FT                   /locus_tag="KLTH0F00880g"
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7785"
FT                   /product="KLTH0F00880p"
FT                   /note="similar to uniprot|P56508 Saccharomyces cerevisiae
FT                   YDR525W-A"
FT                   /db_xref="GOA:C5DK09"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK09"
FT                   /protein_id="CAR23810.1"
FT                   /translation="MHARDWFLVFLSIFVPPIAVGLKRGFFTKDTLLNLLLFLLGYLPG
FT                   LIHALYVISKHPYPSVGGSLTQPNDGYGSLN"
FT   gene            complement(<67984..>68829)
FT                   /locus_tag="KLTH0F00902g"
FT                   /old_locus_tag="KLTH-ORF7783"
FT   CDS_pept        complement(67984..68829)
FT                   /locus_tag="KLTH0F00902g"
FT                   /gene_family="HOG000112175" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7783"
FT                   /product="KLTH0F00902p"
FT                   /note="similar to uniprot|P32460 Saccharomyces cerevisiae
FT                   YIR030C DCG1 Protein of unknown function expression is
FT                   sensitive to nitrogen catabolite repression and regulated
FT                   by Dal80p contains transmembrane domain"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK10"
FT                   /protein_id="CAR23811.1"
FT                   /translation="MRIVLSSADRTPPATMRILLVNPNSTEAMTQAAGARVQAYLASAY
FT                   GAAAASLNVSLFTAPPDAPRMIDGEDASRESAAKCLPLLCRRAEPDALQYFDTFDGVLI
FT                   ACFSDHPLVHMLQQRAERATQVTCIFHASLTACLARAGARFSIITSNDEWVALLDAAAA
FT                   RLLGAEPPFASSKAPFKGTVASSVPVLDLHDPANLHAIAKRIYEENVVRLDTSTVILGC
FT                   AGFSGMEAALSQEITKIAAQRDPGRTLHVTLVDSVISGVETLALMCRLRQDYDSNMQQI
FT                   "
FT   gene            <70601..>73144
FT                   /locus_tag="KLTH0F00924g"
FT                   /old_locus_tag="KLTH-ORF7771"
FT   CDS_pept        70601..73144
FT                   /locus_tag="KLTH0F00924g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7771"
FT                   /product="KLTH0F00924p"
FT                   /note="some similarities with uniprot|Q04412 Saccharomyces
FT                   cerevisiae YDR524C AGE1 ADP-ribosylation factor (ARF)
FT                   GTPase activating protein (GAP) effector ARF GAP with
FT                   effector function(s)"
FT                   /db_xref="GOA:C5DK11"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK11"
FT                   /protein_id="CAR23812.1"
FT                   /translation="MGSNTSLLARCGDARPGLVAVEPDGGEASLKFTLVDYQLALQACA
FT                   APTRYRLTVRHSGPASDLRCGARNVRGSPSYMPLPVQYLSAGDPNLVSASVSIAGLLES
FT                   PGLYTVEAVLCKDTVFSAAVLIERPQKSKSAVLPTATQSHTKPQAEQTSQPAHSSSTES
FT                   VPRTEASLQKPGMPPSPRGSPAPFTFPPDGPQFRTLIAQCEGIVPQLRTDLKMCLERSS
FT                   RVCDLLAAATKELTGLISNLQSLDTFSPSLSPHFHKTVTALRSSLSSQSQSLSRLACLL
FT                   QNHFNTPAHTYVTSLDSKQLASRHKIYHDQAKLFYSYMGKNLSSADSANLSKKIQFELH
FT                   RLDFFIYLTGLFNGPAARKLIYEWSRFPSSVFPNSSSSALLLQETAQYQSDFKARKAQM
FT                   NAQREKISRSRSFSDFSAQVSTQSHKVFKEGILWTYKGHGKSSGWHKQWVVLKDSTLSE
FT                   YSDWKTQGKKLSHPPLSLTFACIKRHESGNYNAFEIITTTGVTRAFRAESKSDLDQWVQ
FT                   LLQIAVGLGTQTPSPEEESDTLTPLSIVASVDNCNKICCDCGGTSQVEWISINLLCVIC
FT                   IKCSAVHRSLGSHISKVRSLKLDSFTSKEILELLKFVSNKNLNSIYEAELPKRQVTSDS
FT                   SNEERTAFISDKYVKKRYVSPLQEQEPEAVQKRLHHNLIKSIHLNSIYLLQQCLAQGVD
FT                   INSVKLDNGETVFQYSLQHYMGTKTEPIFFITEFLLLNGLQVGRLPRDASSLSKTEYNY
FT                   WKSKAETNGVYSTKPLVRSATTRETFKSMARIDTSGPSPPQSRQASSASETSDSGSKRW
FT                   SIGGAMTLSSPVSASLSTPKSRNIKFPKLHGGKSH"
FT   gene            <73412..>74950
FT                   /locus_tag="KLTH0F00946g"
FT                   /old_locus_tag="KLTH-ORF7768"
FT   CDS_pept        73412..74950
FT                   /locus_tag="KLTH0F00946g"
FT                   /gene_family="HOG000234203" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7768"
FT                   /product="KLTH0F00946p"
FT                   /note="similar to uniprot|P08458 Saccharomyces cerevisiae
FT                   YDR523C SPS1 dispensable for mitosis involved in
FT                   middle/late stage of meiosis required for spore wall
FT                   formation serine/threonine kinase homologous to Ste20p
FT                   expressed in middle/late meiosis"
FT                   /db_xref="GOA:C5DK12"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK12"
FT                   /protein_id="CAR23813.1"
FT                   /translation="MTKTSTVTGLDTFVKSYKSHKSKTTDAAVVMNEKPSRLYEIKECV
FT                   GKGSFGDVFRATHRQTGEVVAIKIINLEETQDDIDVLAQEIYFLSELRAPFVTTYFKTF
FT                   VEDVSMWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKKIHRDI
FT                   KAANILLTDDGEVKLGDFGVSGQIMATLKRTTFVGTPYWMAPEIIAKKDNGYNEKADIW
FT                   SLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLIKDPDLR
FT                   PSAAELLGHKFLNKASWRGSGTLKREVDLVKALKKRTNYFKEPRHSVEDNVYPADGSMH
FT                   LQNWNFETTKTSTTRKSELVCHRPSIEKRKPVAKLQIVEELSPKTETSHISAMGSPNVD
FT                   TPTTNATSPSMGHYNHEKDLDISMGLHEGEAIKKDIRPVDCKELNYFKHIILYSFNRVL
FT                   ERARSGDTKLDVTRLRDIFEEAEGSQPGLSEAFVEEVYIRMEEIKGYIVETSFQ"
FT   gene            <75236..>76672
FT                   /locus_tag="KLTH0F00968g"
FT                   /old_locus_tag="KLTH-ORF7765"
FT   CDS_pept        75236..76672
FT                   /locus_tag="KLTH0F00968g"
FT                   /gene_family="HOG000057088" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7765"
FT                   /product="KLTH0F00968p"
FT                   /note="similar to uniprot|P25380 Saccharomyces cerevisiae
FT                   YCL048W SPS22 Protein of unknown function redundant with
FT                   Sps2p for the organization of the beta- glucan layer of the
FT                   spore wall and similar to YDR522c uniprot|P08459
FT                   Saccharomyces cerevisiae YDR522C SPS2 Protein expressed
FT                   during sporulation, redundant with Sps22p for organization
FT                   of the beta-glucan layer of the spore wall and weakly
FT                   similar to YBR078w uniprot|P38248 Saccharomyces cerevisiae
FT                   YBR078W ECM3 GPI-anchored protein of unknown function and
FT                   weakly similar to YDR055w uniprot|Q12355 Saccharomyces
FT                   cerevisiae YDR055W PST1 Cell wall protein that contains a
FT                   putative GPI-attachment site"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK13"
FT                   /protein_id="CAR23814.1"
FT                   /translation="MKSSNIIAALLPLMCASASNAYLVQKVLDFNGVHKRPHAVTVGTL
FT                   NLEKRDTAPAFQSLQDEWSAEVTSQDAARFEKSSVIAELCKKGDHNIETANQLFELQRE
FT                   CKTVMGTIHINDFVDPVIDLGALQSIIGDFVIENLPEVVRIQGQNLVSVGGTLKINGLT
FT                   SLTSIHLPALHHFNALECTVAPTLTSLTLAPNISHAKRVTISDTSLVEINMLENSEDLE
FT                   LLNINNNRYMEHLRASVKRVHEQLSISSNSRELQVDFPDLQWANNVTVRDVLAASFPRL
FT                   TSVNHSLEMIENDFDSFEVPLLESVGGTLGVILNSKLNHVDFGNVSVIHGGLMIANNSN
FT                   IAKINFLPELKEIGGAIHFIGNFQETEFPKLRLVRGSALLQSTSSTFDCAKWTTPSGGN
FT                   SIIRGGRIACTAGQRRKTARVNQDGKLLEHQETQFDSPAETQKETNLGSSIIDKTSLSA
FT                   FAWSLSFGWIAALICLVATY"
FT   gene            <77084..>79441
FT                   /locus_tag="KLTH0F00990g"
FT                   /old_locus_tag="KLTH-ORF7763"
FT   CDS_pept        77084..79441
FT                   /locus_tag="KLTH0F00990g"
FT                   /gene_family="HOG000001072" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7763"
FT                   /product="KLTH0F00990p"
FT                   /note="similar to uniprot|Q04411 Saccharomyces cerevisiae
FT                   YDR520C Hypothetical ORF"
FT                   /db_xref="GOA:C5DK14"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK14"
FT                   /protein_id="CAR23815.1"
FT                   /translation="MTEPKNFHLPTDHEPTIHLNTDGNYVKKVRQEDSRSYNRSETEAA
FT                   RKPRKKRKTYSCEVCRKFKTRCDFEPLVGRCHRCSVLKIQCSLTKEREEEILAAIETSS
FT                   SVALPTSGVSSSEVSSKDSLVSHPVATTLNNRLNKLESNLNRLNSKLDLLVLLAQGSNS
FT                   AAANSVSNLAGDRKAGSAVGIADLSTNRGDLLGSKPLHNRLDDSDDQLTDEAVSAFKDF
FT                   SPPPPRPPQRLDLNGLKLQEPPLKLISDIDERLFPTKVESERDRIAKTQRPFVVARVNF
FT                   LKFFDQHEQLCLDLSRDFLVKSHFWIIPGGIKEIDRSYVEKHLFISSVFAIIAMGFDEN
FT                   NKYEEEQEIMYPLVERLLTNTLTMFEKLTDHDIEAILYCSMFNVSRKSKRHRQMKLNSL
FT                   VLTNFAISSLLNIIDFHKIKERVLSDKYDSLDLYHLRILNSLTACRLQYSIGYGNFMMS
FT                   DDLLKDFNNLTARFPQATFGDDIKISEINLSEIVNNIFLNFKTYFKEFTISFKNCLHNN
FT                   QFALGSQENLNNGVGSSNDTLAFPELEYWLKNWDELLSKDGGGVLLFAFNYYYIMICRS
FT                   FLTEFYEEYHSDLHYFKCILKTMKNYCFQLLDGFLKLPSSLIKGAPVITVHQLVYACLT
FT                   LCDFLHFFDASERQQILNLCTKIYWHLHTIGEKLNEATENVGKIINSLIDTGKKKVHVG
FT                   SDPFSLTEKPKHARKAHSILKKHTVSDSQNSPHSVESSSSHNSGIESATGAGFNMPDVG
FT                   QFNSFEDFFQDFFENLKPTTQNIFSSMNQTPK"
FT   gene            complement(<79475..>80266)
FT                   /locus_tag="KLTH0F01012g"
FT                   /old_locus_tag="KLTH-ORF7761"
FT   CDS_pept        complement(79475..80266)
FT                   /locus_tag="KLTH0F01012g"
FT                   /gene_family="HOG000246797" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7761"
FT                   /product="KLTH0F01012p"
FT                   /note="similar to uniprot|P25576 Saccharomyces cerevisiae
FT                   YCL047C Hypothetical ORF"
FT                   /db_xref="GOA:C5DK15"
FT                   /db_xref="InterPro:IPR004820"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019450"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK15"
FT                   /protein_id="CAR23816.1"
FT                   /translation="MLYRSPEGGKCLQILKRFQESISAFEIFHGQRHLDKCRRVLVLDS
FT                   SFNPPHMGHYTLVERAVKYYGSTDLQVILLLSINNADKEIKPASLDKRMDMMCIMADLL
FT                   SKNSLPVSVGITKYAKFFEKSTAISKELGHSPKISYLVGFDTIVRVFDSKYYAPLSVAD
FT                   ALRDFMSETEFFCLTRDGETAVQQQLQYPGDIAKGVYEPNIPKSWHSKVVVEKGNEFFS
FT                   HVSSSSLRKTLYDPNKDVSASVPPEIYHYIKNQFPYDIFKH"
FT   gene            complement(<80327..>80752)
FT                   /locus_tag="KLTH0F01034g"
FT                   /old_locus_tag="KLTH-ORF7760"
FT   CDS_pept        complement(80327..80752)
FT                   /locus_tag="KLTH0F01034g"
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7760"
FT                   /product="KLTH0F01034p"
FT                   /note="similar to uniprot|P32472 Saccharomyces cerevisiae
FT                   YDR519W FPR2 Membrane-bound peptidyl-prolyl cis- trans
FT                   isomerase (PPIase) binds to the drugs FK506 and rapamycin
FT                   expression pattern suggests possible involvement in ER
FT                   protein trafficking"
FT                   /db_xref="GOA:C5DK16"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK16"
FT                   /protein_id="CAR23817.1"
FT                   /translation="MLFKNLLCFLSLSSLSSISMAGSLTELEIKTIEEVPASECTIKAS
FT                   KGDLVSVHYSGSLLGSEEVFDSSYGRGVPIKFELGAGQVIKGWDQGILDMCIGERRELR
FT                   IPSQLGYGSRGAGGVIPPNADLFFETTLVDIRRRDEL"
FT   gene            complement(<80904..>83219)
FT                   /locus_tag="KLTH0F01056g"
FT                   /old_locus_tag="KLTH-ORF7759"
FT   CDS_pept        complement(80904..83219)
FT                   /locus_tag="KLTH0F01056g"
FT                   /gene_family="HOG000057089" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7759"
FT                   /product="KLTH0F01056p"
FT                   /note="similar to uniprot|P25574 Saccharomyces cerevisiae
FT                   YCL045C"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR011678"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK17"
FT                   /protein_id="CAR23818.1"
FT                   /translation="MALSFNVWTIYLRVDRNSLASLKQPRLLVFTLCPIMLGAFRSFIG
FT                   ITLLVVIKGLFVEAIFSDEAYHIDWQLSNVGPYQCVLPASATESNDQLLVLSTFNNGTM
FT                   ISWLNKTSGELLERLPLGYRVADAMIEHNDLFLKLEDGSINAVDSMNGFSLDHPPTEFS
FT                   SSCNPDLSTIRFEDGKIKIMDHDTDLQIFSIDMPQDFKGIKYFRSDKENTLDLMYSTVG
FT                   GKYTFTSVSDLTSTQTWTRDESLANIRAYTYVSSADPNLAQMFTELSQEGSMNVLEAYQ
FT                   FRVKQTLNRLKNYLLEKKFSVGAIVKEFLEDEDEATLHQKDVSFGLLKYLIVATEEGKI
FT                   AVLDVRDGRQLWNYESGLKDILNIEALRSDTEVVIFTKSGPSLTFDITRIETEPYLLTN
FT                   TNMAPVHSVEKISENGAFLFKRPGGGRFLLENPLNPITQDLYLLDHNSKELNAFIYQNE
FT                   AITETWKTKVDEQEEIVAFSSRGEEHVANLGIVLGNRTVLYKYLYPHLAAYATKNEENV
FT                   LTIRIIDTVSGELLHTSFHEDEVDFNFPINLVFGEHWCVYTYFSTKPVPEQKIAVIELY
FT                   ESLVANERVSEPLTEVNALENIQRPQFIQKAYLYPEVIKNIGLTKTKLGITTKSIILEL
FT                   ENGQVTILPKFILSARRVEESQLSADDKKEFMVMPYLSAIPINDQAVLTHNRVLLTGPD
FT                   SHLLSIPTDLESTTLVCTLGHDLFCTRVFPSSQFDKLSPSFEKGKLMATVIGLLLICFF
FT                   LRPLVDTKKLKLKWLVKD"
FT   gene            complement(<83274..>84608)
FT                   /locus_tag="KLTH0F01078g"
FT                   /old_locus_tag="KLTH-ORF7756"
FT   CDS_pept        complement(83274..84608)
FT                   /locus_tag="KLTH0F01078g"
FT                   /gene_family="HOG000057090" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7756"
FT                   /product="KLTH0F01078p"
FT                   /note="similar to uniprot|P25573 Saccharomyces cerevisiae
FT                   YCL044C"
FT                   /db_xref="InterPro:IPR013911"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK18"
FT                   /protein_id="CAR23819.1"
FT                   /translation="MFSQELQSFHLCSVKKHRMLFSIFNITNPLVSSLHYGSPLRFICS
FT                   LMGLYSPPDGSKAPNAPALAQKEAPDKPNDGALIKFYPRPSLGLRFWGPLVPASDNREG
FT                   LWTLVGIQTVFGLLCLRRSRSIGSSIVKREISKIPSLNRFSVTRGSMYVSEHGPTAFGS
FT                   TNSFSRRGSNLWGFLRSTKFIALRKSLYLVGGTLLLSQSLLEACRLQILKYDPWYEEAR
FT                   SVREKQFFNNIIKYYHEGIDPTKFKVKDASNGAVLPLSSPEVKQSVAFARATLEADSWF
FT                   TSWFGPIEYKPMSFTEYLDRLEYHLEMTDFIRNGRNNDAASQLLGRPLSHGTAELEELI
FT                   QKNRSSRKKIGNLMESAPRQSMPVVSGQRQSSLKGILLDPNIQSSEDIDLDETWSAFNP
FT                   WLDLALETSLSIKFLPTVLMADDATGDSSIDHSSEDDSNDPKPNY"
FT   gene            complement(<84685..>86250)
FT                   /locus_tag="KLTH0F01100g"
FT                   /old_locus_tag="KLTH-ORF7754"
FT   CDS_pept        complement(84685..86250)
FT                   /locus_tag="KLTH0F01100g"
FT                   /gene_family="HOG000162459" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7754"
FT                   /product="KLTH0F01100p"
FT                   /note="similar to uniprot|P17967 Saccharomyces cerevisiae
FT                   YCL043C PDI1 Protein disulfide isomerase and similar to
FT                   uniprot|P32474 Saccharomyces cerevisiae YDR518w EUG1"
FT                   /db_xref="GOA:C5DK19"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR005788"
FT                   /db_xref="InterPro:IPR005792"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK19"
FT                   /protein_id="CAR23820.1"
FT                   /translation="MQLSRNLFLGISALAAALGNAQQEATAPEGSAVVKLTSENFADFI
FT                   KEHPLVLAEFYAPWCGHCKTLAPHYVEAAATLESKNIPLAQVDCTTEEELCMEHGIRGY
FT                   PTIKVFRNHQVDAPSDYQGGRTASAIVSYMISQSLPPVSILEGEEAADDFKDLLAESSG
FT                   AVIVDGGVEGLNETFHELAELFRDDFTFVQYNGSDAKQKLSVYLPKQDAPIVFEGKNAS
FT                   ISHLVDWVQVETKPYFGDINGETFQSYMDSNVPLAYFFYTSPEERASYEDFFSKLGKEH
FT                   RGKINFVGLDASAFGRHAQNLNMKEQFPLFVIHDTVSNLKYGLPQLSEEEFSSLTKPLE
FT                   LKTKDIAKFIKSFISGKVEPIIKSEEIPEKQESSVFRIVGKTHEDIINDETRDVLVKYY
FT                   APWCGHCKRLAPVYEELANVYVTDKDAQDKVLVANVDATLNDVNVDLEGYPTLILYPAG
FT                   NKSTPVVYQGARDMESLMNFIQENGHHEINGTAILESKKAQEAKEADEEAEAIEEESVE
FT                   HDEL"
FT   gene            complement(<86725..>87819)
FT                   /locus_tag="KLTH0F01122g"
FT                   /old_locus_tag="KLTH-ORF7753"
FT   CDS_pept        complement(86725..87819)
FT                   /locus_tag="KLTH0F01122g"
FT                   /gene_family="HOG000057091" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7753"
FT                   /product="KLTH0F01122p"
FT                   /note="similar to uniprot|Q04410 Saccharomyces cerevisiae
FT                   YDR517W GRH1 Golgi localized protein component of the
FT                   spindle assembly checkpoint homolog of human GRASP65 which
FT                   functions in postmitotic reassembly of Golgi stacks"
FT                   /db_xref="InterPro:IPR007583"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK20"
FT                   /protein_id="CAR23821.1"
FT                   /translation="MFRIAKNLVRTFEQSVSDTIGAGTQLDSYFESVPPNLLSPGNNTN
FT                   ELLHGLRVLACDESQVQLQSFFDYIIGIDDQPLPLSQNQHGYLYPDFGSITRLLNAACG
FT                   SSVKLNLWSGKGGVYRDEYIRVERKKNVEDVPLDGSRDVVFQEFDALGFAVQWTPLTAA
FT                   TYTYHVLELSDPTGPAAQAGFVPQEDYVVGCQEGLLATGGETLLQDILRSHAGQDLVLY
FT                   VFNAVSDCIRPVTVHVGHDGRLGCNMGYGFLHRIPAPFRQEPASAVEASFADAPMSDQS
FT                   FVPAGSSNIGIPQPSTDIQPTSTSQFIVPNPTHKRKQKHHKVAAATSIQDYFQEGKDPS
FT                   PAFSTKSSSTPPPPPPVKNQDTTK"
FT   gene            <88845..>90329
FT                   /locus_tag="KLTH0F01144g"
FT                   /old_locus_tag="KLTH-ORF7748"
FT   CDS_pept        88845..90329
FT                   /locus_tag="KLTH0F01144g"
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7748"
FT                   /product="KLTH0F01144p"
FT                   /note="highly similar to uniprot|P17709 Saccharomyces
FT                   cerevisiae YCL040W GLK1 Glucokinase catalyzes the
FT                   phosphorylation of glucose at C6 in the first irreversible
FT                   step of glucose metabolism one of three glucose
FT                   phosphorylating enzymes expression regulated by non-
FT                   fermentable carbon sources"
FT                   /db_xref="GOA:C5DK21"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK21"
FT                   /protein_id="CAR23822.1"
FT                   /translation="MSFDKVHQEKQRRLSKAVEEVCDELTLTSEKICELTHFFIESMEK
FT                   GLGESKEDASYRGLPMIPTYVTGKPNGTESGVLLAADLGGTNFRICSVDLQGNHKFALQ
FT                   QMKSKIPDEFLEDDTVTSDDLFGYLARRTLAFVKKYHPEYLQNKEELKLGFTFSYPVDQ
FT                   KSLASGTLIRWTKGFKIKDTLGKDVVQLYQESLEEQGLSMVRVVALANDTVGTFLSHCY
FT                   CSENTGSLTSGEIVEPVMGCIFGTGTNGAYMEKIENIKKLPEEVRQELLQSGKTHMCIN
FT                   TEWGSFDNDLKHLPTTKYDIDIDQKFSSNPGFHLFEKRVSGMFLGEILRNVLLDLFNKR
FT                   FIFTQYTAEEKLPHRLKTPFELSSEVLSHIEIDDSSQLRETELSLLQSMRLPTTYDERI
FT                   AIQNLVRAISRRSAYLAAVPIAAILMKTGALNQRYHGEVEIGCDGSVVEYYPGFRSMIR
FT                   HALALSPIGPEGERKTHLCIAKDGSGVGAALCALVA"
FT   gene            <90708..>92939
FT                   /locus_tag="KLTH0F01166g"
FT                   /old_locus_tag="KLTH-ORF7745"
FT   CDS_pept        90708..92939
FT                   /locus_tag="KLTH0F01166g"
FT                   /gene_family="HOG000057092" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7745"
FT                   /product="KLTH0F01166p"
FT                   /note="similar to uniprot|P25569 Saccharomyces cerevisiae
FT                   YCL039W"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK22"
FT                   /protein_id="CAR23823.1"
FT                   /translation="MPVEYQSSEERERRDCFFVPPYFKGKNSRCSSAGAPACTSSAIQS
FT                   LPQASFDKTQLTKLLIDTLHEMGYTESAKTLQKESGGVRVESGSVQKLFSAVRLGQFEE
FT                   IDLQMLANLPLKNRALGTLPFPQSNTHSFQAGQENSESTTGNEDEENAMKIDNIISKNT
FT                   DWSRFFTNMQNEHKILESVVQEMGDLDAPALSGLLDMIEILVLINKQVFLELMFDQQES
FT                   SLAVLFLRTVFRKFIQLWEVILMSQESTYALTPDALLKQMTSVLTSPLNLAEMSDVWPG
FT                   SVERARQTLIDSISNYVDPNELVPRGRLLTLLSQAIKYQSSQNLLNFEDEDDENSFIQE
FT                   GASTYNLLQDNASSSNRINFQFEIQLCFSVGEIWYLEFSPDGKYLAAASADSSTDQKVH
FT                   IYDVENEFRVYKILGGNDQCVLYLSFSPDSRYLVSCPFNEEAKIYDIHKKGEPSDINSE
FT                   FDDDSAPAEIIQPEDSFSLSSDETSGTTAAPRIWCCSWFHTERNKGRFALGSPDRDVII
FT                   YDLGTKSIISRLSRVTNATAASSHEQFPRVHDLKITPDDRYLILMAHEFFVDAYDISQL
FT                   PPVGRQGELPADLSSFHLSRVSRLNVGKRMTCLTIPQTKSSESALNSLVLINVQPHELQ
FT                   LWDFKEQILVQKYFGQRQLQFIIRSCFGYENKVIASGSEDGKIYVWDRIHGNIVGVING
FT                   HTSERDPPPNTANTFGRNCNIVAWNPANKNMFASGGDDGSIKIWSVGHS"
FT   gene            complement(<92980..>94491)
FT                   /locus_tag="KLTH0F01188g"
FT                   /old_locus_tag="KLTH-ORF7743"
FT   CDS_pept        complement(92980..94491)
FT                   /locus_tag="KLTH0F01188g"
FT                   /gene_family="HOG000034115" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7743"
FT                   /product="KLTH0F01188p"
FT                   /note="similar to uniprot|P25568 Saccharomyces cerevisiae
FT                   YCL038C ATG22 Protein required for the breakdown of
FT                   autophagic vesicles in the vacuole during autophagy
FT                   putative integral membrane protein that localizes to
FT                   vacuolar membranes and punctate structures attached to the
FT                   vacuole"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK23"
FT                   /protein_id="CAR23824.1"
FT                   /translation="MSYQAVTSDEEDQNRPEREVKTLNNIRGWYLYCFSSEPFIVSAVS
FT                   TYVPLLLEQFARINGVLVKDHSVKCGSSDEKCVLGLLNNSVFIDTSSFALYTFSASVLF
FT                   QAVLVISISGLVDMWNSVKFRKNVLIAFGVCGALSTIAISQLSSSQYYSLALLSILANC
FT                   CYGVVNVVGNSLLPGFVRDLIDYNSHFKNSTVEDVTSVTSGRGSGVGYIGALIVQVCSI
FT                   FLVRMSKAHDNIQVAVLLVGIWWLAWQFPLTWLLQDIIPPLIEDEQLQIRPSPKYLTYG
FT                   WKSLYEALKHARLLRDVMIFLLGWFIISDSITTINSTAILFAKTELKMGTLGLIMVSIL
FT                   SLLSGIAGAFLIPQVLSYQLKQPPQRMMMSIIGWASVIPLYGTLGFFFDSVGLKHKGEM
FT                   YMMAIWYGIAMGGLSAVSRTIFSLIIPSGKESTFFSLFSLTDKGSSVLGPFLAGLITDK
FT                   THNIRYSFYLLLFLLLISLPVFGMLNIERGKKEARELGDIQTLND"
FT   gene            complement(<95054..>96409)
FT                   /locus_tag="KLTH0F01210g"
FT                   /old_locus_tag="KLTH-ORF7741"
FT   CDS_pept        complement(95054..96409)
FT                   /locus_tag="KLTH0F01210g"
FT                   /gene_family="HOG000057093" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7741"
FT                   /product="KLTH0F01210p"
FT                   /note="weakly similar to uniprot|P25567 Saccharomyces
FT                   cerevisiae YCL037C SRO9"
FT                   /db_xref="InterPro:IPR006630"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK24"
FT                   /protein_id="CAR23825.1"
FT                   /translation="MSATVENTKDDIKEAQQVPEVPAEEVKTAKQPVLTPAPVPTSSPW
FT                   KAVPSATAAQTASSSRKWPSAQEAVEKLERREKQAPGAPVLKSTGKEKWVPMKASIVVS
FT                   GSKKLGGGGYNGANVAAKKQAGKKSRKNGPSTAKPRKQVQPQPVKDERELKDESTQSSN
FT                   EADEATVASKDALEPSDAAAVASQAPESAFGDSAKKNGFHRRPHDSNQNGNYPRRRYHQ
FT                   GAPKEGHGPFKSNQPYSSFPQKPNSAPFRQHNPNRSYNPGYRHKYQPRHSSGAFYGPQP
FT                   PHPFVAVNNVARQIEYYFSAENLAKDNYLRSQFTEDGFAPLSLIAKFYRMVNLSFGGDE
FT                   TLILGALREIVANDTATVDVAEVQEETERNVGKFYVRSKNWEQWISKPEDEAENKADDQ
FT                   STQKDTKQKIILKGDVLDAFKIEPPVFEAPQANDEPQPNAEPTTGTESEAEP"
FT   gene            <96822..>98216
FT                   /locus_tag="KLTH0F01232g"
FT                   /old_locus_tag="KLTH-ORF7736"
FT   CDS_pept        96822..98216
FT                   /locus_tag="KLTH0F01232g"
FT                   /gene_family="HOG000057095" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7736"
FT                   /product="KLTH0F01232p"
FT                   /note="similar to uniprot|P25370 Saccharomyces cerevisiae
FT                   YDR514C Hypothetical ORF and similar to YCL036w"
FT                   /db_xref="GOA:C5DK25"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK25"
FT                   /protein_id="CAR23826.1"
FT                   /translation="MLRNCTRKPAKRLKVDTGRQKSVMSFSSHETEIYVRGENVPRNRS
FT                   SVSAYLKAAAGVKNVIGPKKSQMREQSFFKELVKVEYQPVPSRTQFIENYVKEFHKKYQ
FT                   DQMALSHQQLESKLRLAKEQYQSLQQSLGAPPAEQAADGSDAKEDQKLIKLLRKIENEH
FT                   SPKITDSPGSPNAKYVADSVRMLASQRTICFSVDVEAYERNTNVVTEIGISVFDPRESM
FT                   YSTVGNFRTFHLIVGESLRLRNGRFVCDVKDCFLLGESYVMPLSSCVEFIQTLLNYYMV
FT                   PHTPQERTWHRAFVGHNVKGDLKWLFSIGVNLPANIGHDTLSLDPKLERISILDTEKLY
FT                   RVMYGSKGSSLGKILRLFKIPHAYLHNAGNDAYFTLKLLLHMCDVNYRRRLQMDDFYAV
FT                   TATVEEWSRREKNKGSVNSHGKGNHEFTEYRSRRKQSLHTEFGGCRWFASASDALVGTP
FT                   KPCEYE"
FT   gene            <98944..>100686
FT                   /locus_tag="KLTH0F01254g"
FT                   /old_locus_tag="KLTH-ORF7730"
FT   CDS_pept        98944..100686
FT                   /locus_tag="KLTH0F01254g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7730"
FT                   /product="KLTH0F01254p"
FT                   /note="some similarities with uniprot|P39712 Saccharomyces
FT                   cerevisiae YAL063C"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK26"
FT                   /protein_id="CAR23827.1"
FT                   /translation="MVSAKLVYGLLASSALAQAAQTYKVPIQYESELEVSYYFREDNDL
FT                   VSITSDAGGLVVTVDADNACDVLQSGMVVYRVDDGSASTLLTWDRYHVFHLENSAGQEL
FT                   TWSSVNAQSCGAVSSSSLSSTVTLSTTYQLSSGVASSTGSGSGSITATDSGSTTASGAS
FT                   SGASTASGSASGSASISGSTSGSTSGSASGSASGTVSSGSTVSTSGAPSGSATKSIPGY
FT                   TSSVVTVTESGVVTSYTTYCPISTVPASSTEWQSSVITATENGVVTTYTTYCPISSETA
FT                   TQAPEKTKVVTTTESGHESVYTTTYPASQEKTVVTTTENGVVTTYTTYCPLSSETGTAA
FT                   PQETKVVTTTENGQQTIYTTTCPASQETEIVTTTKSGHESVYTTTGPAPATGATSAVTT
FT                   VVQPTTIVKTITSCSGGVCSTQSATETSQVTSVVTVSKSYAAASSTETSATGVESTPAT
FT                   GAESTPATGAESTPATGAESTPATGAESTPATAATGTAAGSSPATGAATTGVESSASAP
FT                   TGAAETGSGTAAPAATGTAASGSGSGASATPTAVSVSEYAGSAAKLGSSGVFVAVVAMM
FT                   ASLL"
FT   gene            complement(<101034..>101450)
FT                   /locus_tag="KLTH0F01276g"
FT                   /old_locus_tag="KLTH-ORF7724"
FT   CDS_pept        complement(101034..101450)
FT                   /locus_tag="KLTH0F01276g"
FT                   /gene_family="HOG000095204" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7724"
FT                   /product="KLTH0F01276p"
FT                   /note="similar to uniprot|P25373 Saccharomyces cerevisiae
FT                   YCL035C GRX1 and similar to uniprot|P17695 Saccharomyces
FT                   cerevisiae YDR513w TTR1"
FT                   /db_xref="GOA:C5DK27"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK27"
FT                   /protein_id="CAR23828.1"
FT                   /translation="MEYSRTLTLVALVFTLFIIRRFFGSGFSKMASPQTVQHVRSLIKD
FT                   NKIFVAAKTYCPYCNATLKLLFQDKKLRKDQVLLLQLDTMKEGSEIQEALTEISGQRTV
FT                   PNIYILGEHIGGNSDLQALEASGKLDELLEKALA"
FT   gene            <101766..>102758
FT                   /locus_tag="KLTH0F01298g"
FT                   /old_locus_tag="KLTH-ORF7722"
FT   CDS_pept        101766..102758
FT                   /locus_tag="KLTH0F01298g"
FT                   /gene_family="HOG000057096" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7722"
FT                   /product="KLTH0F01298p"
FT                   /note="similar to uniprot|P25369 Saccharomyces cerevisiae
FT                   YCL034W LSB5 Protein of unknown function binds Las17p which
FT                   is a homolog of human Wiskott-Aldrich Syndrome protein
FT                   involved in actin patch assembly and actin polymerization"
FT                   /db_xref="GOA:C5DK28"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK28"
FT                   /protein_id="CAR23829.1"
FT                   /translation="MGFLTDHPHTAVTDTIERVCSSEQFTLEVELASLIQQIRAGKSDY
FT                   ENGNNQIEAARCLRKKLKYGNRLQQARALELMNLFVSQRIKFPEMYNDAKLLDRLRVIA
FT                   MQSGTDGSGQRYHPRIIKKCVAYILGWSAFLDEQGPSRSYEGLDALARKVKSKYTTKPA
FT                   GSRRRKGFMSDKADASIMSADDRYGIPHIDMTKEAPKIRLLISDSLATAVSLKNTLMTL
FT                   PRTVNSTDDEEATARFVQARAMRRKVLRYLQLVTEGEFLGSLLHANEELVASLSAYDEL
FT                   SGNLFEEESLLSENDDDEDDDEVSYLSSALSTQPERCDSNDPFGDQNRI"
FT   gene            complement(<102876..>103376)
FT                   /locus_tag="KLTH0F01320g"
FT                   /old_locus_tag="KLTH-ORF7720"
FT   CDS_pept        complement(102876..103376)
FT                   /locus_tag="KLTH0F01320g"
FT                   /gene_family="HOG000243424" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7720"
FT                   /product="KLTH0F01320p"
FT                   /note="similar to uniprot|P25566 Saccharomyces cerevisiae
FT                   YCL033C Hypothetical ORF"
FT                   /db_xref="GOA:C5DK29"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK29"
FT                   /protein_id="CAR23830.1"
FT                   /translation="MIRSTARIFRGFAGTRSIVVSRLIYKRSFSISFVTRMSENWNPNL
FT                   TTEQLLVLRDKHTERPHTGAYLNNKDTGVYNCANCEAPLYKSETKFDSHCGWPAFYEEV
FT                   KKGAITYHTDYTMGMKRTEICCANCGGHLGHVFEGEGWKERLGLPVDARHCVNSASLNF
FT                   KKQ"
FT   gene            <103495..>103752
FT                   /locus_tag="KLTH0F01342g"
FT                   /old_locus_tag="KLTH-ORF7719"
FT   CDS_pept        103495..103752
FT                   /locus_tag="KLTH0F01342g"
FT                   /gene_family="HOG000057097" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7719"
FT                   /product="KLTH0F01342p"
FT                   /note="some similarities with uniprot|Q04406 Saccharomyces
FT                   cerevisiae YDR512C EMI1 Non-essential protein of unknown
FT                   function required for transcriptional induction of the
FT                   early meiotic-specific transcription factor IME1 also
FT                   required for sporulation"
FT                   /db_xref="InterPro:IPR021475"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK30"
FT                   /protein_id="CAR23831.1"
FT                   /translation="MSTKYPSTMSCTEAFDQLSACYSVGGQFRNYYRYGEFNACTRQLE
FT                   KFKFCVLHGTDPVKIQQWYRDQAKFNAMHRGSSDEIWEER"
FT   gene            <103936..>104844
FT                   /locus_tag="KLTH0F01364g"
FT                   /old_locus_tag="KLTH-ORF7718"
FT   CDS_pept        103936..104844
FT                   /locus_tag="KLTH0F01364g"
FT                   /gene_family="HOG000057098" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7718"
FT                   /product="KLTH0F01364p"
FT                   /note="similar to uniprot|P25344 Saccharomyces cerevisiae
FT                   YCL032W STE50 Protein involved in mating response
FT                   invasive/filamentous growth and osmotolerance acts as an
FT                   adaptor that links G protein-associated Cdc42p-Ste20p
FT                   complex to the effector Ste11p to modulate signal
FT                   transduction"
FT                   /db_xref="GOA:C5DK31"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR015316"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK31"
FT                   /protein_id="CAR23832.1"
FT                   /translation="MSTNASAVEANMNEEVLNWGIDEVSIWCAQKLALDGGRRDKFQAN
FT                   LKEHGIDGQVLLDLELEDCKQLTDNDSSLAVQLKLEVNRLRAQKQTQEDEILAVLTQLY
FT                   STVSEKLQDFQSQYARLRLDVLEVVKKDPHASFPPIQLNTQHQQPQHDYFEGQKIVTPG
FT                   SSNNTFVRQAPARSHSNSTSQQTLGIGGSTTSTPGVAPQQTPSGGSGTEPLKHMRASKE
FT                   DSCERVLKSAMKRHNLSEQDWRQYVLVICYGDQERILELDEKPVLMFKNLKQQGLHPAI
FT                   MLRQRGDFEEVGGGLTPGGRL"
FT   gene            complement(<104933..>105892)
FT                   /locus_tag="KLTH0F01386g"
FT                   /old_locus_tag="KLTH-ORF7716"
FT   CDS_pept        complement(104933..105892)
FT                   /locus_tag="KLTH0F01386g"
FT                   /gene_family="HOG000000892" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7716"
FT                   /product="KLTH0F01386p"
FT                   /note="similar to uniprot|P25368 Saccharomyces cerevisiae
FT                   YCL031C RRP7 involved in rRNA processing"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK32"
FT                   /protein_id="CAR23833.1"
FT                   /translation="MKRRVNWSTRSLNNARYTEPQPTYKMSARVDSMKNGFLVIPFKLP
FT                   QSQKLEEHSEEACHYMFIKKHQSKSELEQNCLFLVNLPLLTHLENLKQGFGSIMSQYGS
FT                   VAHVAQLLHHDEFGLSEVDLSSLTSDLMSTGDAEEKRYTPRNTALLQFVDAASVDNAWS
FT                   ALRKYSQERKQSKIVTWNFDSPSMATFINFYKPLDLDYLKEDVYSHMALFEQREQQAQE
FT                   QAQSSIVDEDGFTLVVGKNTKNLNSIRKKILNKNPLLKHEKIVKPPTMVDKKAKQDFYR
FT                   FQIRERKKQEISELLKKFKQDQEKIKEMKSKRKFNPYA"
FT   gene            complement(<106050..>106442)
FT                   /locus_tag="KLTH0F01408g"
FT                   /old_locus_tag="KLTH-ORF7714"
FT   CDS_pept        complement(106050..106442)
FT                   /locus_tag="KLTH0F01408g"
FT                   /gene_family="HOG000039506" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7714"
FT                   /product="KLTH0F01408p"
FT                   /note="some similarities with uniprot|Q02562 Saccharomyces
FT                   cerevisiae YDR511W ACN9 Protein of the mitochondrial
FT                   intermembrane space required for acetate utilization and
FT                   gluconeogenesis has orthologs in higher eukaryotes"
FT                   /db_xref="GOA:C5DK33"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK33"
FT                   /protein_id="CAR23834.1"
FT                   /translation="MVKATFNLKVHASMAVARARRSSRQHIPLLPPLQLYRRILREHQN
FT                   LPAPQRELGDQYVKNEFKLHKDTSNPLHIVGFLASWQDYLHIISKGEWQEGTMSSEVID
FT                   KMSPDQVNQLYTLMKEVEGLHNEKPE"
FT   gene            complement(<106971..>109406)
FT                   /locus_tag="KLTH0F01430g"
FT                   /old_locus_tag="KLTH-ORF7713"
FT   CDS_pept        complement(106971..109406)
FT                   /locus_tag="KLTH0F01430g"
FT                   /gene_family="HOG000243914" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7713"
FT                   /product="KLTH0F01430p"
FT                   /note="similar to uniprot|P00815 Saccharomyces cerevisiae
FT                   YCL030C"
FT                   /db_xref="GOA:C5DK34"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016298"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK34"
FT                   /protein_id="CAR23835.1"
FT                   /translation="MGFPILPFFTSSEELKTVAGSKPYLGLTGQALLDLTKVSVDDAIA
FT                   FIENNSAYKFVCGLLGASNTLSDDDVVRLLNNGVSVLFLQDCSMAAPLVQLGVPKERLA
FT                   VLEGATYTCNFGVVQKFSTSQIVEASALSTDKLADALFSSLKTDRDDKLYTTLVVDTHE
FT                   RCLGLVYSSKESIKQAFEQQVGVYYSRSRNEIWVKGLTSGNTQKLVNINIDCDGDALKF
FT                   VVVQEGKKSDFCHLNTTSCYGEFQQGLVGLEGLLRQRLENAPEKSYTRRLFSDPELLTA
FT                   KIKEEAEELTEAADKKEVAWEAADLFYFAMVKLVASGVSLDDVERNLHVKHLKITRRKG
FT                   DAKEKFLQKKPSEESKAEAAAETVDDGSISLNVVSDQDKKGVSEALSRPIQKTADIMHL
FT                   VNPIVERVRNEGDKALLEFTQKFDGVKLDSPVLEAPFPKEYFEGLTDEMKEALDLSMEN
FT                   VRKFHEAQLQKETLEVVTQPGVVCSRFPRPIEKVGLYIPGGTAVLPSTALMLGVPARVA
FT                   ECQEIVFASPPRKSDGKVSPEVVYVAQKVGASKIVLAGGAQAVAAMAYGTESIPKVDKI
FT                   LGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEKADADFVASDLLSQAEHGV
FT                   DSQVILVGVALSEKKVAEIQDAVHRQALELPRVDIVRKCIAHSSIILCDSYETAFDMSN
FT                   DYAPEHLILQIENAQDYVKLVFNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQYSG
FT                   VNTSTFQKFITSQVVNPQGLENIGRAVMSVAKVEGLDAHRNAVKIRMQKLGLLPESFQ"
FT   gene            complement(<109643..>110863)
FT                   /locus_tag="KLTH0F01452g"
FT                   /old_locus_tag="KLTH-ORF7708"
FT   CDS_pept        complement(109643..110863)
FT                   /locus_tag="KLTH0F01452g"
FT                   /gene_family="HOG000057099" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7708"
FT                   /product="KLTH0F01452p"
FT                   /note="similar to uniprot|P11709 Saccharomyces cerevisiae
FT                   YCL029C BIK1 Microtubule-associated protein component of
FT                   the interface between microtubules and kinetochore involved
FT                   in sister chromatid separation essential in polyploid cells
FT                   but not in haploid or diploid cells ortholog of mammalian
FT                   CLIP-170"
FT                   /db_xref="GOA:C5DK35"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR023092"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK35"
FT                   /protein_id="CAR23836.1"
FT                   /translation="MENYEKKIGSFIQIPNVGRGQLKYVGAVEGKPGIFVGVDLLANIG
FT                   KNDGTFRGKRYFDTEYTQSGLFIQLQKVASLIDLATGSASRRETLGDAHGGSRRSASLT
FT                   DPRSPTPIRANSRQSSAVFSDTMDIDHEDRRVLSAPGRDLELKIQQQNQELSQYKKVLS
FT                   EQRIVLEEIQPAIDDYEEKLQQMEAQVSSLEAQLSKERETQRRQKQYFETEHEQLLSVV
FT                   EELHTEIRENEKRMLNAAQPSQPSDLSELTAENEALRNELEDLKAQQAASAVTAKKWEK
FT                   EREQLKLQIDSLSSEYQYVNKELRDAHEKLKVSQESQSDLSEIEQLKLQLEAANAKIQE
FT                   LEQGSPRPTTPALTTGSDPIERESESLPLYIPKKADRAAGRPKWCALCERDGHNSVDCP
FT                   YENDQLF"
FT   gene            <111050..>111286
FT                   /locus_tag="KLTH0F01474g"
FT                   /old_locus_tag="KLTH-ORF7706"
FT   CDS_pept        111050..111286
FT                   /locus_tag="KLTH0F01474g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7706"
FT                   /product="KLTH0F01474p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK36"
FT                   /protein_id="CAR23837.1"
FT                   /translation="MDSPVICVSLSDTLNACEALSEFYRDYSGNFGFQARKGFYISNDS
FT                   VALVLAVRGNSNGPKAVQKKHCERSCHSKKPAD"
FT   gene            <112409..>113776
FT                   /locus_tag="KLTH0F01496g"
FT                   /old_locus_tag="KLTH-ORF7703"
FT   CDS_pept        112409..113776
FT                   /locus_tag="KLTH0F01496g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7703"
FT                   /product="KLTH0F01496p"
FT                   /note="some similarities with uniprot|Q8TFP8 Saccharomyces
FT                   cerevisiae YCL028W RNQ1"
FT                   /db_xref="GOA:C5DK37"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK37"
FT                   /protein_id="CAR23838.1"
FT                   /translation="MPNYACHVLHSLLSMWPKPASLTYFSSWHLFRERFEKLECTRLQL
FT                   RFNTWSSDTDQAKQNYRMNVDQLINQAQQLFEQGRHQEAVESLTTATKQDPSPNQQSYI
FT                   EETINKIGQHVVNNGDESGTRGIGGSLMSAFMGGQGNSGYGGSQSQLSKLALLSTILGS
FT                   SNKNSGSFNLGSVASMFTGSGKQNTQNYGNNNYGNNNYGNPQNNYGYNNGGNQSGSGSG
FT                   LSSLAGKLFGGKHSSQQNNTPPPPPPQQQQQSGSFGSLASMTSSFLGGGKQSNHGNQVP
FT                   PPQQYGNPQQGSYGQMYNSGSQGQQQGQYGNYGEQGNYGPPGGHRPQGNHGPPGGFGSQ
FT                   GGNFGGRQGNSGSHENFGQGGGYGQTGRHEQQGRFENQDNFGSQGNYGQGGYGQQNNFS
FT                   ESGFEGRRGGQASEYYQGQQSGSGQGYQRPSDNQNQESSGQGFSFAGNFVPGNGRN"
FT   gene            complement(<113886..>115841)
FT                   /locus_tag="KLTH0F01518g"
FT                   /old_locus_tag="KLTH-ORF7700"
FT   CDS_pept        complement(113886..115841)
FT                   /locus_tag="KLTH0F01518g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7700"
FT                   /product="KLTH0F01518p"
FT                   /note="some similarities with uniprot|P36110 Saccharomyces
FT                   cerevisiae YKR013W"
FT                   /db_xref="GOA:C5DK38"
FT                   /db_xref="InterPro:IPR001283"
FT                   /db_xref="InterPro:IPR002413"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR018244"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK38"
FT                   /protein_id="CAR23839.1"
FT                   /translation="MKYSSIAGLCMAVAAVSAQTTTTDDFTATAIDLTLTKPGATGSSG
FT                   VTSAPSSSATGSSAAPSGSSVAPSGSSSVPSGSSAAPSGSSAAPSGSSGVPSGSSAAPS
FT                   GSSAAPSGSSAAPSGSSVAPSGSSSVPSGSSGVPSGSSAAPSGSSAAPSGSSAAPSGSS
FT                   AAPSGSSSVPSGSSAAPSGSSAAPSGSSAAPSGSSSVPSGSSAAPSGSSAAPSGSSGVP
FT                   SGSSAAPSGSSAAPSGSSAAPSGTSSVAPSSSAISSGSSSVPSGSIITSGSSSAPVSSS
FT                   VPSSSFSLSSSAPNSVWYSNTSSTYPSTTGGLTSLPITSDSSSSPSSSESSTTDSSSSD
FT                   AISTVASSSDVSSSLASSSAVSSVVVSSSDVSSSAPSSSVASSSAPSSSVASSSAPSSS
FT                   VASSSDTSSILASSSAASSVAVSSSAASSSAPSSSAATSSSATSSSSLLAASASNAAMT
FT                   TITGSSVTSSSVASSTTASATTTLDAATASAILSEHNAKRSLHSNTPDLTWDDSLSAWA
FT                   YAYAESLSGTSYDPCSGNLVHSSTRNNQGENIGFGTVSDPNTLVDYWYDEIQYYDYDNV
FT                   TGITHDGQEVGHFTQLVWASTTKVGCAVIQCDTMAKYGQNSQYLLCEYTPAGNIYNGTP
FT                   GQDEFSFFKENVQRLK"
FT   gene            <117357..>119114
FT                   /locus_tag="KLTH0F01540g"
FT                   /old_locus_tag="KLTH-ORF7692"
FT   CDS_pept        117357..119114
FT                   /locus_tag="KLTH0F01540g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7692"
FT                   /product="KLTH0F01540p"
FT                   /note="weakly similar to uniprot|P11710 Saccharomyces
FT                   cerevisiae YCL027W FUS1 Membrane protein localized to the
FT                   shmoo tip required for cell fusion expression regulated by
FT                   mating pheromone proposed to coordinate signaling fusion
FT                   and polarization events required for fusion potential
FT                   Cdc28p substrate"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001655"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK39"
FT                   /protein_id="CAR23840.1"
FT                   /translation="MPASATSSTASQTLLLQPSVKGTVVESVYVEVYVLPGQTKPFSSS
FT                   TASVRTLSILNRYQSATSDSSASRTSRTSQQTRSTQTLLQLMQSASSSTTLVQSASVSP
FT                   ASSEIVDKISAGQNASSATIALSIGLPLGIFCLAFFLIFALLWLRRRSAVRPPQDPFAK
FT                   SPADVASNHQTPWKRFVDRCLAPKESTHSHSFHSNAGATIKYKISTVNPQATSPGALPS
FT                   YSEHVQTPQKVALPFNRSSSSHRIEAFLYTKPPGLKSIQSTLETTSAASDNPFDNSHQL
FT                   PNGGKWTYESPLSRWFLTKSLYLQDQVKQPLKSSNVKLKELNILSRVSKNKIQSPYPDE
FT                   TSPILSDTDRLSESKTSYASSQLDPLVYRSSSLKYTERKKPTGLTNIRAVSSAQRSPAG
FT                   PHPQPSAAEVDIKPQFIRKTNSESSSFLDSSRVKNACTYKSSAPPNDRKKRRNNKKLRI
FT                   HLDQIARKPLPLTPKPLLSGKKSGSLLKHAFMHKPLAGASDGLAQDEVYIVIRNYSPRL
FT                   MDEITVQVGEHVKLLAKHTDGWCLVEKCDSSGNPLCEASSDQQEIGGEFYLNESRGIIP
FT                   GVCLNKVTS"
FT   gene            complement(<119234..>119821)
FT                   /locus_tag="KLTH0F01562g"
FT                   /old_locus_tag="KLTH-ORF7689"
FT   CDS_pept        complement(119234..119821)
FT                   /locus_tag="KLTH0F01562g"
FT                   /gene_family="HOG000089187" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7689"
FT                   /product="KLTH0F01562p"
FT                   /note="similar to uniprot|Q96VH4 Saccharomyces cerevisiae
FT                   YCL026C-B Hypothetical ORF"
FT                   /db_xref="GOA:C5DK40"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK40"
FT                   /protein_id="CAR23841.1"
FT                   /translation="MSPAAAPFLEALVARRTIYALKPELPSGVELKDVKDIVQTIIKHT
FT                   PTSFNTQGNRAVILTGESHRKVWDHVYNSIPIENFKKRPLSARDEAFGTVVFMVNNQQT
FT                   KEMQQNFPAWADLFPEFVAHSSGSAQISAWTALEKIGLGAHLQHFNELVASALPEDAIK
FT                   EEWVVQGQLVFGLPDAPAGEKTFIENEVKVFE"
FT   gene            complement(<120227..>122017)
FT                   /locus_tag="KLTH0F01584g"
FT                   /old_locus_tag="KLTH-ORF7688"
FT   CDS_pept        complement(120227..122017)
FT                   /locus_tag="KLTH0F01584g"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7688"
FT                   /product="KLTH0F01584p"
FT                   /note="similar to uniprot|P48813 Saccharomyces cerevisiae
FT                   YDR508C GNP1 High-affinity glutamine permease also
FT                   transports Leu Ser Thr Cys Met and Asn expression is fully
FT                   dependent on Grr1p and modulated by the Ssy1p-Ptr3p- Ssy5p
FT                   (SPS) sensor of extracellular amino acids"
FT                   /db_xref="GOA:C5DK41"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK41"
FT                   /protein_id="CAR23842.1"
FT                   /translation="MSKQPADSAGIGLQDLKSNTGSESIEKVSLPASDYQYHDGQVLSR
FT                   FQRLTNSFKRAGEHGRGGDVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVG
FT                   NGKALHNGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGF
FT                   SVAWVYCLQWLCVLPLELVTATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEA
FT                   EFFFNTCKVLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIHHFKGIIAT
FT                   MVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSD
FT                   ELMGSGGSATHASPYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSE
FT                   QHYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWI
FT                   CICVSHIRFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTD
FT                   KLDANNFFENYLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDA
FT                   EYEESIRNSGWLSRVAHFWC"
FT   gene            complement(<122821..>124635)
FT                   /locus_tag="KLTH0F01606g"
FT                   /old_locus_tag="KLTH-ORF7685"
FT   CDS_pept        complement(122821..124635)
FT                   /locus_tag="KLTH0F01606g"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7685"
FT                   /product="KLTH0F01606p"
FT                   /note="similar to uniprot|P48813 Saccharomyces cerevisiae
FT                   YDR508C GNP1 High-affinity glutamine permease also
FT                   transports Leu Ser Thr Cys Met and Asn expression is fully
FT                   dependent on Grr1p and modulated by the Ssy1p-Ptr3p- Ssy5p
FT                   (SPS) sensor of extracellular amino acids"
FT                   /db_xref="GOA:C5DK42"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK42"
FT                   /protein_id="CAR23843.1"
FT                   /translation="MKGFEMKNIKSPEDGVVESFDSVEVVKETSPRSEGSRDGLFHRFV
FT                   DSFKRPEEEYNGGDGIHSTHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATG
FT                   IGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPAL
FT                   LVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFI
FT                   GAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRGNNGIN
FT                   RFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLG
FT                   FLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSS
FT                   RILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISG
FT                   LSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWV
FT                   AISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDA
FT                   EIMQSEQLEEKEQLRHASWTKRAAEFWC"
FT   gene            <125692..>126309
FT                   /locus_tag="KLTH0F01628g"
FT                   /old_locus_tag="KLTH-ORF7680"
FT   CDS_pept        125692..126309
FT                   /locus_tag="KLTH0F01628g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7680"
FT                   /product="KLTH0F01628p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK43"
FT                   /protein_id="CAR23844.1"
FT                   /translation="MRGPEESRLEVITRKGVYPVLLRALIFELCGRLLFYVFCITADRQ
FT                   GTQPLNPLQTMVRTQTLGTTMISAVTSREWCSDVRVFGNSTRRASTRLGAVLTQTIGYE
FT                   SPRSRARVTASITISAQVLCSGLSYVVMCGCSTTLAFGRHCRAGRRLLSLHTRVPLAFK
FT                   LALWPSHSSLSVSVTPGPENFAVHAHITLQDIIYSFFPLVAK"
FT   gene            <126388..>126672
FT                   /locus_tag="KLTH0F01650g"
FT                   /old_locus_tag="KLTH-ORF7679"
FT   CDS_pept        126388..126672
FT                   /locus_tag="KLTH0F01650g"
FT                   /gene_family="HOG000207495" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7679"
FT                   /product="KLTH0F01650p"
FT                   /note="highly similar to uniprot|Q12306 Saccharomyces
FT                   cerevisiae YDR510W"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK44"
FT                   /protein_id="CAR23845.1"
FT                   /translation="MSEPQQESKPDIKPETHINLKVSDGSSEIFFKIKRTTPLRRLMEA
FT                   FAKRQGKEMDSLRFLYDGVRIQADQTPEDLDMEDNDIIEAHREQIGGAL"
FT   gene            <127277..>130771
FT                   /locus_tag="KLTH0F01672g"
FT                   /old_locus_tag="KLTH-ORF7677"
FT   CDS_pept        127277..130771
FT                   /locus_tag="KLTH0F01672g"
FT                   /gene_family="HOG000057100" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7677"
FT                   /product="KLTH0F01672p"
FT                   /note="similar to uniprot|Q12263 Saccharomyces cerevisiae
FT                   YDR507C"
FT                   /db_xref="GOA:C5DK45"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK45"
FT                   /protein_id="CAR23846.1"
FT                   /translation="MSTHSRQNSVVKSTLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQH
FT                   ESTGQQAAVKIVSKSIFGNQSNSSTIVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYD
FT                   VWETNSSLYMVLEYVEKGELFNLLVDRGPLPENEAVRFFRQIIIGISYCHALGIVHRDL
FT                   KPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWS
FT                   CGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQDLIAKILTVDPA
FT                   ARIKSRGILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVDGTIDDTIIGNLVVLWH
FT                   GRDRNEITNKLKEPGANLEKTFYALLFRFKHDSQQEQLKQQRRSQAMQVSPKKTGLRKS
FT                   NSRRSINSTTPKKKTRAPVISASSSHKRPVSFSRLSYSNGSNTDHNTPNSSGKRSSVNL
FT                   SSNKRISALINPNSSPTPASKRASLRELDPSAPPIPVDMLKDYNKAAPKANRKSSRISK
FT                   RLSFLPGNKRGSITTKLIATYAKISEDNDWEYIEKETKRTSADFATLCDEIFEHEKYEQ
FT                   IRREKEELERRVREAKEQEERERRQREEEERRQREEELARQREFEEERYHRQREVQENI
FT                   DREMALLKEGYETSSGVDPNKNRSVSAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSL
FT                   ETRPKSRLDPGIYTLEEVPNSDIKDGGRDLKTEKTILETIRRSKFLGSSFDINKELARE
FT                   RRLKEERAAALKQRKKEDRVVSNATGNYSENGYEPQTLPKNAAATKISNDAGSDPRKIS
FT                   EVQVPQFTRRSRHFTASNKRLSVLSMYSTKASFTNLADHLRGKTDLQSINGSPPSTSRM
FT                   EPETEFMFESVDGEGKETADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPP
FT                   PQSVEDPNGIKLPSLPPLDKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKE
FT                   AAEAKPEEQKQVPPKDVESAPAPLNKVMKKNTEAEKNQPNQPAPNAVKKNNKSFFRRFS
FT                   GKSDDEKRPGEYDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSS
FT                   DNMLSLRSTLFEISIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKALVFNN"
FT   gene            <130898..>132805
FT                   /locus_tag="KLTH0F01694g"
FT                   /old_locus_tag="KLTH-ORF7671"
FT   CDS_pept        130898..132805
FT                   /locus_tag="KLTH0F01694g"
FT                   /gene_family="HOG000057101" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7671"
FT                   /product="KLTH0F01694p"
FT                   /note="similar to uniprot|Q04399 Saccharomyces cerevisiae
FT                   YDR506C Hypothetical ORF"
FT                   /db_xref="GOA:C5DK46"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK46"
FT                   /protein_id="CAR23847.1"
FT                   /translation="MLLRWAPNLLLGAFALADTKLYELGISKGVSKEGKQVISLNGKND
FT                   TVGPIIRVNSGDTLNLLVNNDICNANDYEQYGELYCDTSIHFHGVVLNNNGADLGVLHD
FT                   GVPGVSQYSIPSGMSYWYNFTIPENLCGTYWYHSHSSVQYGDGLRGIFLVDCDYRQKYI
FT                   ERVIAKLEADGTDGTLLENLPPQGAKVPVQEVVMAVTDWYSKSSVEILSQVMSPYGGPD
FT                   PSVEGSMMNGDTGSVKFEVAEGVEYVALRVINTGMSGTNVLHVEGHRLCVIETDGVLTK
FT                   PYMIDTLSIAVGQRFTVLVKLNKEAPARVVHGCGKMMGYVTKTHWLLRPGQVAGDDYVG
FT                   RVVHLPGLDKNEMYKQFVPLEGELLPEPSQQLSLDYEFDGDEAREPFGTTMYTVNGDTM
FT                   QEFMPDGVLIEGARGVREPIPLHGGGVVEIAINSIDHMTHPWHMHGHTFQVVSVGRKRD
FT                   GPLYFDNPESPAMKRYLADVAEWQDKVPMTRDTINIPGRSYAVIRLRADNPGFWLLHCH
FT                   VEWHMAKGLGVVFAEGDALVSAVSKPFARQSDAAGASTALPEPSSTADAAATPTVSAVR
FT                   AISTAADAPASSAAPATSQQQPSPEAAMPAASASKGKVLAIYLLIMCTLNVAIWLFFFR
FT                   "
FT   gene            <133903..>136104
FT                   /locus_tag="KLTH0F01716g"
FT                   /old_locus_tag="KLTH-ORF7663"
FT   CDS_pept        133903..136104
FT                   /locus_tag="KLTH0F01716g"
FT                   /gene_family="HOG000142001" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7663"
FT                   /product="KLTH0F01716p"
FT                   /note="similar to Saccharomyces cerevisiae YLR177W
FT                   Hypothetical ORF and weakly similar to YDR505C
FT                   uniprot|P50896 Saccharomyces cerevisiae YDR505C PSP1 Asn
FT                   and gln rich protein of unknown function; high-copy
FT                   suppressor of POL1 (DNA polymerase alpha) and partial
FT                   suppressor of CDC2 (polymerase delta) and CDC6 (pre-RC
FT                   loading factor) mutations; overexpression results in growth
FT                   inhibition"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK47"
FT                   /protein_id="CAR23848.1"
FT                   /translation="MSSSTKIDGYKSANGEIMESKRAELSAELPSINSTTSLSDNLALR
FT                   NYYDKLLFKNSSGKSLTDLPGQAAGARPAERPVERRNVDFISGFGAPRSVQMTPSNSEP
FT                   LHMPLFQVGGERSLGMFNGVPGSGVPGSGVPGSGIPGSGVPGAALPGTGVSFSFGNPLP
FT                   FAPGAATAAAATSRNNSVGSSGSSGSTILTSPTSYYAALTQQSLSPTGALSPITSAGTA
FT                   NFLGLDLQSQQMLQPQQQQQQQQQQQQQYLQQKQQQYMQQNPFNADRRSSYISDSLIHS
FT                   HANPELRVHAGLPTNLEQLYNATAAPKLRYTQMPQKHQSVPKVNYKPPAGAPLTGGVAG
FT                   GNPGSQQIENGLILVNGQQLMASAELQKLYHDCGSNYFSSDEACQFLDRVKTLLSGAEN
FT                   SEMAANIGRFLSFLKSSNLNYNPQSDAFVSGNENRRNSSTSAYLHYKPLVLVALKNGKL
FT                   ELLSMPQSANMSMCRQDLVVIDGDRGKDLALVVEPHVELDLALFINFLKKKIHFDSLIT
FT                   NRDQHFPNSQFIRALVDSIHGHTDELNSKLYDVIELTQLIIPSKQVLRFATSWEVTTNL
FT                   HNKFQDELKALHIALLKLKSLNSGLNHHQHQQQRPNLNIKILNAEFQFDRKKLTFYYVC
FT                   QERNDFRELIKELFKFYKTRIWLCAIPNNLDIESKYYDNQLKELKMYQEMMQHCAGEDL
FT                   LDKGRSSGFVVAPALSSIALDNFQIGVYKELVNELFAPK"
FT   gene            complement(<136381..>137007)
FT                   /locus_tag="KLTH0F01738g"
FT   CDS_pept        complement(136381..137007)
FT                   /locus_tag="KLTH0F01738g"
FT                   /gene_family="HOG000237655" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0F01738p"
FT                   /note="similar to uniprot|P14306 Saccharomyces cerevisiae
FT                   YLR178C TFS1 Carboxypeptidase Y inhibitor (putative) lipid
FT                   binding protein supressor of a cdc25 mutation and to
FT                   YLR179C uniprot|Q06252 Saccharomyces cerevisiae YLR179C
FT                   Protein of unknown function, transcription is activated by
FT                   paralogous transcription factors Yrm1p and Yrr1p along with
FT                   genes involved in multidrug resistance"
FT                   /db_xref="InterPro:IPR001858"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK48"
FT                   /protein_id="CAR23849.1"
FT                   /translation="MNYAINVTQASSDSLTTHKIIPDVVQDKSFKPQGLLAVEYSAAAP
FT                   VAMGNTLTVEETQSKPKFHFTLDPKSEFKIRDADLFTLVMTDPDAPSRTDKKWSEFCHF
FT                   VAADIRLATETSRSTSSAVPDFIASELSGGKTLVDYHPPGPPKGTGKHRYVFLLYKQPG
FT                   DSSAFTKIADRPNWGFGSPATGVHKWASENHLELVAANFFFAESK"
FT   gene            <137634..>138617
FT                   /locus_tag="KLTH0F01760g"
FT                   /old_locus_tag="KLTH-ORF7655"
FT   CDS_pept        137634..138617
FT                   /locus_tag="KLTH0F01760g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7655"
FT                   /product="KLTH0F01760p"
FT                   /note="weakly similar to uniprot|Q04396 Saccharomyces
FT                   cerevisiae YDR503C LPP1 Lipid phosphate phosphatase
FT                   catalyzes Mg(2 )-independent dephosphorylation of
FT                   phosphatidic acid (PA) lysophosphatidic acid and
FT                   diacylglycerol pyrophosphate involved in control of the
FT                   cellular levels of phosphatidylinositol and PA"
FT                   /db_xref="GOA:C5DK49"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK49"
FT                   /protein_id="CAR23850.1"
FT                   /translation="MPHGVRTAQQSKLHKSRDCSFKRYSRLPTRRAYARDKGAARTQIT
FT                   TPHHAFPQPQPPLNPSNMPPSLKSAVAYVAGFVPLYAACVVLIAALGFSEFHMAPRLSR
FT                   QVRTDDPAIKKSFVAHETVTPVQCLFLAFPLPVLVLAGWCTVGSDSLVSRYQRRSFARL
FT                   ARPDWVPAKFHLFHISCVALALALGINGVLTNGFKLLLSNARPDFLARCQPADPLALYV
FT                   SVAQCTQPDKLVLYEGLKSTPSGHSSFAVAGLGFLYLWLARHTCVSRLRHVWCPLLCVF
FT                   VMASRVVDHRHHWYDVLTGGALGLAVCVGVWRTLMREEPQANLLPA"
FT   gene            <139467..>140615
FT                   /locus_tag="KLTH0F01782g"
FT                   /old_locus_tag="KLTH-ORF7647"
FT   CDS_pept        139467..140615
FT                   /locus_tag="KLTH0F01782g"
FT                   /gene_family="HOG000245710" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7647"
FT                   /product="KLTH0F01782p"
FT                   /note="highly similar to uniprot|P10659 Saccharomyces
FT                   cerevisiae YDR502C and to uniprot|P19358 SAM1 S-
FT                   adenosylmethionine synthetase catalyzes transfer of the
FT                   adenosyl group of ATP to the sulfur atom of methionine one
FT                   of two differentially regulated isozymes (Sam1p and Sam2p)"
FT                   /db_xref="GOA:C5DK50"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK50"
FT                   /protein_id="CAR23851.1"
FT                   /translation="MAKTFLFTSESVGEGHPDKICDQVSDAILDACLREDPLSKVACET
FT                   AAKTGMIMVFGEITTKAQLDYQKIVRDTIKQIGYDSSDKGFDYKTCNVLVAIEQQSPDI
FT                   AQGLHYEQALEDLGAGDQGIMFGYATDETPELMPLTIMLAHKLNIAMADARRDGSLPWV
FT                   RPDTKTQVTVEYKQEEGRWIPLRIDTVVVSLQHADEISTEDLRSEIQKKVVEKVCPADM
FT                   LDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASAVGGGAFSGKDYSKVDRSA
FT                   AYAARWVAKSLVNAGICKRVQVQFSYAIGIAEPLSLHVDTYGTSSKSDEEVIEIIKRNF
FT                   DLRPGVLVRELDLARPIYLPTASYGHFTNQEYPWEKPKELKL"
FT   gene            complement(<140897..>142075)
FT                   /locus_tag="KLTH0F01804g"
FT                   /old_locus_tag="KLTH-ORF7645"
FT   CDS_pept        complement(140897..142075)
FT                   /locus_tag="KLTH0F01804g"
FT                   /gene_family="HOG000057103" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7645"
FT                   /product="KLTH0F01804p"
FT                   /note="similar to uniprot|Q07057 Saccharomyces cerevisiae
FT                   YLR181C VTA1 Protein involved in endosomal protein sorting
FT                   binds to Vps20 and Vps4 and may regulate Vps4function has
FT                   coiled-coil domains mutants show class E vacuolar-protein
FT                   sorting defects"
FT                   /db_xref="InterPro:IPR006745"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK51"
FT                   /protein_id="CAR23852.1"
FT                   /translation="MGLPTSIKRELKLSGDFEFAVPVIGYYIKLHLVEELLGLAERTDE
FT                   VVSTATQLLDKIEGFKQNAEDDAVKQLLENQTKAKTYFLNFALSLYNEQLSKIQQGTIN
FT                   QDLSRALWCCIDLFGAFLGLWGKSEATEDEVQQSQKRIKYCKVYLSKLARGELKPVRPT
FT                   QENAPDNKDVDSLLSELRKVEGDGEEEDDEEEEEISQQGEGKTEEEREGPGPETEGKDP
FT                   ENSNLDPESVNEFIKSLEEDPSLGDPSESKELELRDSQPEQEQERRDTEELIRKMRELD
FT                   NDAEEQSDTELQPGGEEPKFELPSAPTDIGARPAFIDSDDEPEKVATAPSKVVQQPTHF
FT                   KPEDLKKMWNREDQISEVQKRAKFAISALNYEDIKSAKEELAKALELLNDIQ"
FT   gene            <142334..>144325
FT                   /locus_tag="KLTH0F01826g"
FT                   /old_locus_tag="KLTH-ORF7641"
FT   CDS_pept        142334..144325
FT                   /locus_tag="KLTH0F01826g"
FT                   /gene_family="HOG000057104" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7641"
FT                   /product="KLTH0F01826p"
FT                   /note="similar to uniprot|P09959 Saccharomyces cerevisiae
FT                   YLR182W SWI6 Transcription cofactor forms complexes with
FT                   DNA-binding proteins Swi4p and Mbp1p to regulate
FT                   transcription at the G1/S transition involved in meiotic
FT                   gene expression localization regulated by phosphorylation
FT                   potential Cdc28p substrate"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK52"
FT                   /protein_id="CAR23853.1"
FT                   /translation="MDIREYEHHYDLNGQATVVKLVRDLNKDSFLVDALVPLLASAANV
FT                   EKSNGDWRNLVLQKFGILVERDGQGNEWISRGKTWELLKILNLHDAYRDVFEEPGDTDE
FT                   DDNSARFDGETREKRSLKGTTHQLGSPLKKLKPAEAFQTVRTFSHDLDLASPLAVQLAK
FT                   KPLKTFQPEERVKLEHLLQHILFPDDQSIQFETALRNLEETYPQTRLNLDIPIDEHGNT
FT                   SLHWLCSIANVRLTKDLIHTGADRLLGDMSGESALVKAVKSVNNYDSGTFEELLDYLYP
FT                   CLILLDEMGRTVLHHIVITSGMPGCASAAKYYLDILMGWIVKKQAREVAGDADIIMTTV
FT                   DLKWFISHVLNARDINGDTCLNIASRLGNVSIVEALLDYGADPRISNNSGLRPVDFGAG
FT                   ASKIEASTANADNGATVTALGPDSAVLINNIQSLINTISQDYDMEIKQHKEQLKKLHSE
FT                   LKTQRELLSSSRDRLAQARQLRDEHTQLTEQVSNIQQAIGEEDASFKKVSDELGINDES
FT                   LDMAEFDADEPFRIEFIYEFLEKKLEAEYSGDLEKFLGNASLDELTAQLMEESSGQEES
FT                   IPPAVLLRARICAYEKNEESLNKSLESVHQKQADLEGRFRRVLSLCLKIDEDKVDDMLD
FT                   GLLQAISTEDPEDIDTDEMQSFLSKHNV"
FT   gene            complement(<144487..>146034)
FT                   /locus_tag="KLTH0F01848g"
FT                   /old_locus_tag="KLTH-ORF7639"
FT   CDS_pept        complement(144487..146034)
FT                   /locus_tag="KLTH0F01848g"
FT                   /gene_family="HOG000001128" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7639"
FT                   /product="KLTH0F01848p"
FT                   /note="similar to uniprot|Q04383 Saccharomyces cerevisiae
FT                   YDR501W PLM2 Plasmid Maintenance and to uniprot|Q06266
FT                   YLR183C Saccharomyces cerevisiae TOS4 Transcription factor
FT                   that binds to a number of promoter regions, particularly
FT                   promoters of some genes involved in pheromone response and
FT                   cell cycle; potential Cdc28p substrate; expression is
FT                   induced in G1 by bound SBF"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK53"
FT                   /protein_id="CAR23854.1"
FT                   /translation="MPGQFPPSSPIAACPADPDDPFYQPSEKHSPSTLKFFHKKIAPVD
FT                   HEYPTPHPSSTLGRSSSPVKARDSHVLGSQTHSDYELEQDLRRELSSRGSASVRPIQIP
FT                   LNSRLETRLSIGRKQAACDIVLPRHKNISRLHAFVTYYPESREVKLECKGSNGLIVAFP
FT                   LKLDLDLTVCSHPEKAFRLMRSKPEQQLSSREVVKNAKLTSFVLLEGESVLMPYIDGTL
FT                   IDFRHAECELAVYEPLGDSDDDSQNATETEDELQPLQITSDDFEPRTPDNEVVHIPLHT
FT                   AFPPKLHVKERLLSLEPQPLLAEPATPLQHKDTKDTTLEEHKESFGGAVEIEEPKTPQR
FT                   QTLDSHFEKQDPQTPLLKTEANARRRKLASPSPEKTHKRKNQQKVSPLSAEEILLNVSS
FT                   RGVDVLELQHILANHLAFSNVQQVPFTQLRDVNSTVSTLAPKELRALLEAERCIGVIYR
FT                   QGKDAAGKPLDEEYYYDVENDSDENRRQLVSALKGGRSNLRSCRRVHKQYFWKKPAK"
FT   gene            <147495..>148723
FT                   /pseudo
FT                   /locus_tag="KLTH0F01870g"
FT                   /old_locus_tag="pseudo-Klth0F-147495-148723"
FT   gene            <149177..>150085
FT                   /locus_tag="KLTH0F01892g"
FT                   /old_locus_tag="KLTH-ORF7624"
FT   CDS_pept        149177..150085
FT                   /locus_tag="KLTH0F01892g"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7624"
FT                   /product="KLTH0F01892p"
FT                   /note="similar to uniprot|P47137 Saccharomyces cerevisiae
FT                   YJR096W"
FT                   /db_xref="GOA:C5DK54"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK54"
FT                   /protein_id="CAR23855.1"
FT                   /translation="MTHSIDINRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQ
FT                   EGYRHIDTAVVYENQKQAAQGVHRFLEETGTPREEVWFTTKLWNTQQGRDATPRALEEI
FT                   AADVKEFIGYVDLLLLHSPLTDAQRRLETWAVLERAVQEPASSALEIRAIGVSNFGVRH
FT                   LQELLEVATVKPVVDQLELHPWLPRAELRAFLRENGILAEAYSPLTQGVRLQDPELLAL
FT                   EAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVLPAKTDSWKVSLDQELWDAL
FT                   DKPDSHDVATWGQKDPTEYTV"
FT   gene            <150478..>151115
FT                   /locus_tag="KLTH0F01914g"
FT                   /old_locus_tag="Klth0F.mRNA.53.p"
FT   CDS_pept        join(150478..150484,150856..151115)
FT                   /locus_tag="KLTH0F01914g"
FT                   /gene_family="HOG000111076" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0F.mRNA.53.p"
FT                   /product="KLTH0F01914p"
FT                   /note="highly similar to uniprot|P49166 Saccharomyces
FT                   cerevisiae YLR185W RPL37A protein and to uniprot|P51402
FT                   Saccharomyces cerevisiae YDR500C RPL37B protein, components
FT                   of the large (60S) ribosomal subunit"
FT                   /db_xref="GOA:C5DK55"
FT                   /db_xref="InterPro:IPR001569"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018267"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK55"
FT                   /protein_id="CAR23856.1"
FT                   /translation="MGKGTPSFGKRHNKSHTLCNRCGKRSFHIQKKTCASCGYPAAKMR
FT                   SYNWGAKAKRRRTTGSGRMGYLKNVSRRFKNGFQTGVAKPQSA"
FT   gene            complement(<151241..>153382)
FT                   /locus_tag="KLTH0F01936g"
FT                   /old_locus_tag="KLTH-ORF7616"
FT   CDS_pept        complement(151241..153382)
FT                   /locus_tag="KLTH0F01936g"
FT                   /gene_family="HOG000057105" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7616"
FT                   /product="KLTH0F01936p"
FT                   /note="similar to uniprot|Q04377 Saccharomyces cerevisiae
FT                   YDR499W LCD1 Essential protein required for the DNA
FT                   integrity checkpoint pathways interacts physically with
FT                   Mec1p putative homolog of S. pombe Rad26 and human ATRIP"
FT                   /db_xref="InterPro:IPR018622"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK56"
FT                   /protein_id="CAR23857.1"
FT                   /translation="MDDWDDDDEDDLIEALSKKPPREPSFGSTQSFQRTQNDPKGTETQ
FT                   SAVAVSAEEAKDIEMKLLKAQGEASMLRDKLALFEAEKERERKTQTQKQKELELQHQHE
FT                   LDLIKADLQKAEDEKKFLAFSGRSSHRSPGRHAAANTPEASSGESVSAATKKRKLEEPP
FT                   RRYITLKPNRIVSDEVDLFVNSAISHRLAGSRLSTLEILNNIYLGHVKDFKFKILDIAG
FT                   DGPVGKGIFDMLMSHIRSPLKLDQFIEILLECLAMLIKEISQHEKECDTAVPFLVALMH
FT                   HCITFRPSAIHTMALKDLFNFMVDLIRTHRSVLKRPLRKSDLELDVGPDIFQYEFIRIL
FT                   TVLYAFDVLEDGLKIVQSLPVSFQAAFMDDAFRGAVDDISRYSLTISYQPVINVIHNTV
FT                   EMFNCIANMLLEAPELKEKVPVRWWDNIINRLYHILNKGTSNTARNELELSTLHLFDEI
FT                   NIFGLIRNIGDNHNGQLISLLVKENEPWHLPRVIMRDFPKEQGITNRATDVEWWAVNMK
FT                   IGIVKLFEKLAIAYRDGPVERNMLKVLARLLAQTQEVLLTVLLGEDSENIHVYYEFFSQ
FT                   TLKLIYHMWKSGQWELRLLREAEAELTVCLWRVVFGTTHEGSRVEMAEHKTLADRFDEL
FT                   RLQQDAELYEDAFENEVPDFVAEETRAQSFSRLKEIMGIGAEETTRQMAKTMLEGITSM
FT                   EDADALYMAMQAGSAELGP"
FT   gene            <154767..>155525
FT                   /locus_tag="KLTH0F01958g"
FT                   /old_locus_tag="KLTH-ORF7612"
FT   CDS_pept        154767..155525
FT                   /locus_tag="KLTH0F01958g"
FT                   /gene_family="HOG000193819" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7612"
FT                   /product="KLTH0F01958p"
FT                   /note="highly similar to uniprot|Q06287 Saccharomyces
FT                   cerevisiae YLR186W EMG1 Protein required for the maturation
FT                   of the 18S rRNA and for 40S ribosome production associated
FT                   with spindle/microtubules nuclear localization depends on
FT                   physical interaction with Nop14p may bind snoRNAs"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK57"
FT                   /protein_id="CAR23858.1"
FT                   /translation="MVEDSKVRDALKTGEKKSLPASLVPQAPMVLTSRDKVTQRMIVVL
FT                   SMASLETHKISSSGPGGDKYALLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDSPI
FT                   NKAGKLQVYIQTSRGVLVEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLLKVI
FT                   KNPITDHLPTKCRKVTLSFDAPVIRVQDFIEKLDKDESICVFVGAMARGKDNFADEFVD
FT                   EKIGLSNYPLSASVACSKFCHGAEDAWGIL"
FT   gene            <155740..>157611
FT                   /locus_tag="KLTH0F01980g"
FT                   /old_locus_tag="KLTH-ORF7610"
FT   CDS_pept        155740..157611
FT                   /locus_tag="KLTH0F01980g"
FT                   /gene_family="HOG000115701" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7610"
FT                   /product="KLTH0F01980p"
FT                   /note="similar to uniprot|P53835 Saccharomyces cerevisiae
FT                   YNL279W PRM1 Pheromone-regulated multispanning membrane
FT                   protein involved in membrane fusion during mating predicted
FT                   to have 5 transmembrane segments and a coiled coil domain
FT                   localizes to the shmoo tip regulated by Ste12p"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK58"
FT                   /protein_id="CAR23859.1"
FT                   /translation="MPFKPYLELRGRISQVWLNQHTLIFTLAAVKLAFFSASLKQAIER
FT                   SKQSILSSCDSADYFYTQFVGVAPTYMCQFGNYLVQQSIKESIKTSLAAVSLLVYAGEK
FT                   LSTFLFDFYFGTYICLATSAVDGAVSVATNTTEKVLDFVNGTVETLGEDLNSGLSDISE
FT                   AINKVVGALNDVESFFKGSDSTDITSQFKSVNLTIEKLRDFQIPSSIDSKLEALSNSTP
FT                   NFDTVINKTHSEISKPFELVRSKITALNVSKIMVQSQGLYVPSNSSNSSSLGPCASSKP
FT                   DIVKFYAGLSNAISVALIVLALALALAAIAATMPSLWEESRKWRKLIKLQRDVNQAKID
FT                   YAYLKNGHCPDAIESYQKVYERWSTAFGAWLAPRISNSEHVQQKVRWCVAYAMSPRALT
FT                   ILAVSITGVVVCICQFILIAALRRAATGDGVQQLTSSSLSYANASLHNDMSVWATSANQ
FT                   YINSTSSSLNSELFGWVNTTTTAVNATVNSAIDDIDTTLADFFNGTLLYKPMTSVVRCT
FT                   IENKLYKIQSAMTWLNEKLQISLPLVDQATLSATLNRELSTQNSASSSNAALQVGQKIV
FT                   QNAQTLILAILHQYRTATLFELGVSLVLFAVWILQWLIAITYCIMFT"
FT   gene            <158021..>161119
FT                   /locus_tag="KLTH0F02002g"
FT                   /old_locus_tag="KLTH-ORF7606"
FT   CDS_pept        158021..161119
FT                   /locus_tag="KLTH0F02002g"
FT                   /gene_family="HOG000057106" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7606"
FT                   /product="KLTH0F02002p"
FT                   /note="similar to Saccharomyces cerevisiae YLR187W SKG3
FT                   Protein of unknown function; green fluorescent protein
FT                   (GFP)-fusion protein localizes to the cell periphery,
FT                   cytoplasm, bud, and bud neck; potential Cdc28p substrate
FT                   And to YNL278W uniprot|P53836 Saccharomyces cerevisiae
FT                   YNL278W CAF120 Part of the evolutionarily- conserved CCR4-
FT                   NOT transcriptional regulatory complex involved in
FT                   controlling mRNA initiation, elongation, and degradation"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK59"
FT                   /protein_id="CAR23860.1"
FT                   /translation="MRSPTKGLLAPPKTFQKSDDKNSRSRSSSFSRLFSSGSSDNSPRR
FT                   QVPPLQEISTSAIPPELVPIVTLLSAQSHRRYHEGVFLILKDLNSDGSPATRTWKEVYG
FT                   VLIGNQLALWDARLLAENGQRPEDLMEATSKPTYVNFTDASFRPLDHKEAVIAEGKKQL
FT                   QNTIVVSTTLKNRYFLQFSDKEAFTQWHAALRLSAFEFTALQEAYTGAFLSTKGAKLGD
FT                   IRVILADTKFDYEDWVSVRFGAGMPWKRCYAVVSQPSKKSKSKLICGEINFYENEKKTK
FT                   KVKAMTTVKDACAVYALYPSSPVLIDTSTMIKLEGKVSFGKKDAPTLTDIFIMPEKHYA
FT                   VPGYDTIIRFLIPIMNAFQLYGRPKRLIADRNNLDSLLFGLPTLPHVHFLQLQDIMPLA
FT                   SSASNMEWSILDWRNHIKALLLKKIDQGYTGCGSSEGLTGALASPAIGSNDLFDSSPLP
FT                   TSPLLASVSRLPSENKTEFGSIKSNLRNAATTDNIDGNTSKSGLHDSSSKASDDKGFVT
FT                   ETAPSATQVSRNGGSFEDVSDDKKQSRKKLTPTIDIQDSNFSEFEREALKPKTSEALGF
FT                   RKSELSTIYDKYSQMPFGDSAGQPPSLPIDRDNRDSFGAYNDYIGSPKVKNLDISNLRD
FT                   SNSTDQTDLSRVHDFSGEGGRRSFADSFQSGEPAPAEERSVKDDVLEDFYSLSQQISKM
FT                   GLDSQDRASFSASKANVNDDFNFEASETNDSIGALDNVFDPDYLEQNQMLDNESNYTAN
FT                   ESKSQYSGDNTNLSYQPLQRDQAQPSYGGEGFTYSQKLPKQRAANHVVTPTSPQFYPNH
FT                   PVENQNAGSAERLGKMKHSPAYPNLNTVNTQTNGSPSHRRNPVPPPPQGAQYSPNNMQH
FT                   RRPGPQGVPSGAPRPVPQQYPQQVPQQAFQQVPRAMSKPVPQQVPYSNRPYVPAGAPNA
FT                   YGRPNPPAQYPPTGAVPLGQPGNPRGPGYAMGPHPQARPMRHTASQTMNQAAPQVFSQS
FT                   IPHPNSKLQAKSAQPSPRAGGFSQFMPATANNPNPYSANPYTS"
FT   gene            <161423..>163627
FT                   /locus_tag="KLTH0F02024g"
FT                   /old_locus_tag="KLTH-ORF7599"
FT   CDS_pept        161423..163627
FT                   /locus_tag="KLTH0F02024g"
FT                   /old_locus_tag="KLTH-ORF7599"
FT                   /product="KLTH0F02024p"
FT                   /note="similar to uniprot|P33310 Saccharomyces cerevisiae
FT                   YLR188W MDL1 Half-type ATP-binding cassette (ABC)
FT                   transporter of the inner mitochondrial membrane mediates
FT                   export of peptides generated upon proteolysis of
FT                   mitochondrial proteins plays a role in the regulation of
FT                   cellular resistance to oxidative stress"
FT                   /db_xref="GOA:C5DK60"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK60"
FT                   /protein_id="CAR23861.1"
FT                   /translation="MKLSTFGLSGLIGNARLPILRAGIGRPSLLLQVRSLHNGKTSFER
FT                   QLAAMLQNRTIMRQVRWQHSNASKPSTTLTSEEQNSSSWKDIKRLFQLARPESKSMFFA
FT                   LVLIILSSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKL
FT                   ILGLTLPQFYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLD
FT                   NNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAP
FT                   PLAVMALVYGRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVR
FT                   QVYQVGLKEALTSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYT
FT                   GSSLFGMSSFYSELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAY
FT                   PTRRQHVIFEDLSLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIAD
FT                   FNLRKYRRLVGIVQQEPMLFNGTILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSS
FT                   FPDGLQTMVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVIARTLH
FT                   SRTTRGKTTISIAHRVSTIQHSTRVIVLGRNGGVVETGTFDELASNTDSQLNKLLRKEE
FT                   EPVQPGEITNAPHRPEGSDQRPEGPSDGAATFELAPVTKA"
FT   gene            <164010..>165473
FT                   /locus_tag="KLTH0F02046g"
FT                   /old_locus_tag="KLTH-ORF7598"
FT   CDS_pept        164010..165473
FT                   /locus_tag="KLTH0F02046g"
FT                   /gene_family="HOG000246301" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7598"
FT                   /product="KLTH0F02046p"
FT                   /note="similar to uniprot|P08465 Saccharomyces cerevisiae
FT                   YNL277W MET2 L-homoserine-O-acetyltransferase catalyzes the
FT                   conversion of homoserine to O-acetyl homoserine which is
FT                   the first step of the methionine biosynthetic pathway"
FT                   /db_xref="GOA:C5DK61"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK61"
FT                   /protein_id="CAR23862.1"
FT                   /translation="MIEYPVRESSLKGVDPESLEATNPYVKLVKNQRIVEVPELELESG
FT                   VVLKNFPIAYKTWGELNERGDNVIVVCHALTGSSDVSDWWGPLLGPDLAFDISRFLVVC
FT                   LNSMGSPYGSFSPMNINAQTGEPYGPEFPLCTVRDDVRAHRIVLDSLGVNSIACVVGGS
FT                   MGGMLALEWSVTFGKAYVKNMVALATSARHSAWCISWSEAQRQSIYSDPNYLDGYYSHE
FT                   NPPVVGLAAARMSALLTYRSRNSFENKFSRRSPSVAQQEKSNKQSVKLKPSNLQEHNLS
FT                   IHNDGHRRSIAQERKSSVSSDTSSNDSLRSVSSSTSTSSVVTLSKNSRAIKPAQTYFSA
FT                   QSYLRYQGKKFIDRFDANCYISITRKLDTHDLARERFEYEEDLDRVLNSIEQPSLVIGI
FT                   KSDGLFTYSEQEYLAANIPNSRLEKIDSPEGHDAFLLEFKLINELIINFLKENAKEITE
FT                   SPPRLWQDLGEREIVKNSLFGEAEEVTNW"
FT   gene            complement(<165601..>169410)
FT                   /locus_tag="KLTH0F02068g"
FT                   /old_locus_tag="KLTH-ORF7596"
FT   CDS_pept        complement(165601..169410)
FT                   /locus_tag="KLTH0F02068g"
FT                   /gene_family="HOG000034145" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7596"
FT                   /product="KLTH0F02068p"
FT                   /note="similar to uniprot|Q06321 Saccharomyces cerevisiae
FT                   YLR189C ATG26 UDP-glucose:sterol glucosyltransferase
FT                   conserved enzyme involved in synthesis of sterol glucoside
FT                   membrane lipids involved in autophagy"
FT                   /db_xref="GOA:C5DK62"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002213"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK62"
FT                   /protein_id="CAR23863.1"
FT                   /translation="MPGEKPDTDEISEVEQRPATVVESPKRRWRRSMPPVGRMYQSFTS
FT                   FASSNRNSSDGGSSNPVFSDEDSSGPHGGEDKDQEHDLAIPCGMAKSIVGLLTTASVYA
FT                   GMGDIEQAESICEGEESDASDDSGPTDRSEAFERSEPSKNPGTPEVNKDDEVEGPASSS
FT                   PSDVTVGADENSEANDSNPISETPSQISKKDTLFEISVVPNSDLQSIMTSSSNSRQSKI
FT                   YRKLISKFGLNEDEDQFVLTCPCWLLKDLLIQGHTVLTTRHLLFFAFLPKSTGATKMSG
FT                   NLSTVSGRLRGRWTRHWAVLKDHTLSFYNSPKDLYFPILTIDLRYATKVELSKHNGEAT
FT                   GDFRIFTEGKTFKFRADSNYAARSWCSALKKQVFATQNSENDSMSVKIPLANIIDMDEQ
FT                   LVVAQSVTLRIRVLESSQSFAVDDYFFMFLNKKDLKLKETINTLLLELDRVSPEELGST
FT                   TIANETGESPLVDEDTQKGSHPERRGRSRSTSKKLFKRVLSPMSRSPGHSLSMSISIPF
FT                   STKSSHTGKGRLRAVTDGFSRKLPTGNVEEHVSVKHPADIEVEPSNEDQEVVPKETAAN
FT                   ESVPDPADEGKGRNFRLASWTPKPIKNMGNMWNAHPVHYETEGPDMFPGDDPYLTTPKE
FT                   QSIAAKRFRSHFSLDGTESLHAAYYTYLNKNIPVYGKLYLGASVVCFRSLIPGTKTKMI
FT                   LPIKDVENCYKERGFRFGYFGLVLVIHGHEELFFEFSLQSSRDDAEFAMLKLLDAVKPR
FT                   LDGVSAAKTNVKNGNTESSSGRNKQLTEAAKLRMLEDKINAEGYDLPMMIEENPYFKTS
FT                   ITPKKSYKFGLLTIGSRGDVQPYIALGKGLVREGHHVTIITHAEFGEWIESYGLGFIEI
FT                   AGNPAALMSLMVQHGSMNVGLLRDASSQFRGWIKDLLDTSWSACQGLDILIESPSAMAG
FT                   IHIAEALKIPYFRAFTMPWTRTRSYPHAFIVPDQKRGGNYNYFTHVLFENILWKGIGGQ
FT                   VNKWRVEKLGLEKTNLYMMQQNKVPFLYNISPSIFPPSVDFSEWVKVTGYWFLDSKDDY
FT                   DPPVELVKFIEKARASNKKLVYIGFGSIVINDPKEMTRAVVDAILDADVFCILNKGWSD
FT                   RLDNDIKKNAEQEVFPDCIYNSGSVPHDWLFPKVDAAVHHGGSGTTGATLRAGLPTVIK
FT                   PFFGDQFFFAGRIEDIGAGISLKKLNSKSLSRALKEVTTNSRIINKAKQIQQEISKEDG
FT                   VSVAISCIYAELAYARSLVVAKAKGTQSDAKDPSSPEENTWFLV"
FT   gene            complement(<170047..>171369)
FT                   /locus_tag="KLTH0F02090g"
FT                   /old_locus_tag="KLTH-ORF7592"
FT   CDS_pept        complement(170047..171369)
FT                   /locus_tag="KLTH0F02090g"
FT                   /gene_family="HOG000215232" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7592"
FT                   /product="KLTH0F02090p"
FT                   /note="similar to uniprot|P40015 Saccharomyces cerevisiae
FT                   YER019W ISC1 Inositol phosphosphingolipid phospholipase C
FT                   hydrolyzes inositolphosphosphingolipids activated by
FT                   phosphatidylserine cardiolipin and phosphatidylglycerol
FT                   mediates Na and Li halotolerance contains a P loop-like
FT                   domain"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK63"
FT                   /protein_id="CAR23864.1"
FT                   /translation="MSDVDAGADIKFLTLNTWGLKYVSKFRKERLREIANKLAGRSMAL
FT                   PLHGLEEDSGSDDYDVVALQEIWCKSDWEYIEETCRHRYPYRRIFYSGIIAGPGLAILS
FT                   KIPIESTFLYRFPINGRPSAFFRGDWYVGKSVSVTLLKPTSSSSNALAILNSHMHAPYA
FT                   QSGDAAYYCHRSCQAWDMSQMANLYKKAGYAVVIVGDLNSKPGTLPHKFLTKETGFVDS
FT                   WEQLHGKQDLVRISKLDPLLQIKQGGTTCDSILNTWRSMRRPDEACRLDYALVDPSRLQ
FT                   TLEACVRFTERIPEIGSFSDHFAYNCKLRLLPRNAAAAGGSKETRERILEKMNIYDEML
FT                   QVIENYKRVSRWQKLWRSAHFWIAVFCIVVVHVVITFTSNRAGWSSVFWAFFLTVTTAS
FT                   GLIDGLISFLFGRSELRALEEVSTEVRDAKLNAHRALDGKV"
FT   gene            <171589..>172328
FT                   /locus_tag="KLTH0F02112g"
FT                   /old_locus_tag="Klth0F.mRNA.100.p"
FT   CDS_pept        join(171589..171793,171847..172328)
FT                   /locus_tag="KLTH0F02112g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0F.mRNA.100.p"
FT                   /product="KLTH0F02112p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK64"
FT                   /protein_id="CAR23865.1"
FT                   /translation="MQIEHFAELRHEMESFQTKLTAALEERKLTLLRAVEGYLQDVQQL
FT                   EARQQESNNRLKQLKSQERALEQEIEISERERDETIAKAEVYKARKQQIDSERAVLTRD
FT                   SQELRKLLLQKQDEIQNKRIILQKQQQKDSLDAKAYEELLGLRIEAPEPEILKFIFNRV
FT                   SEFEENASCEIAIDLSQASYKIIHSAPRLEAGAVTDLELKLSSDGDLGSFLKESRAQLI
FT                   TEYSRQ"
FT   gene            <172432..>173496
FT                   /locus_tag="KLTH0F02134g"
FT                   /old_locus_tag="KLTH-ORF7587"
FT   CDS_pept        172432..173496
FT                   /locus_tag="KLTH0F02134g"
FT                   /gene_family="HOG000210016" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7587"
FT                   /product="KLTH0F02134p"
FT                   /note="similar to uniprot|P25625 Saccharomyces cerevisiae
FT                   YCR044C PER1 Vacuolar membrane protein that seems to be
FT                   involved in Mn2 homeostasis mutant is dependent on
FT                   activation of the unfolded protein response pathway for
FT                   viability"
FT                   /db_xref="InterPro:IPR007217"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK65"
FT                   /protein_id="CAR23866.1"
FT                   /translation="MLCLWVFLTLSGLVQRTLGSPGDWLDEFIDCKELCEASIPCAGFE
FT                   GIEIPSGASAEITYFTEASAIQKYFLFWDCKSNCDYQCQQVVTQIRIAEGEKVVQFHGK
FT                   WPFKRLFGMQELFSTLFSVANFFPHYRGYKLLQRELSRLPARKRSRFILKKYLYVAIAG
FT                   MLAWTSSSIFHFRDLEVTEKLDYFFAGATVLSGFHGILIRILRLDKSDQFRHAVTAAVL
FT                   LIFSLHVLRLYLDWSYTYNMRFNVLFGLLQYILLLTLAYKNYRQLKAGKLPRKSHHPPR
FT                   ENLYFELCVVPVALVVGTALAMSCELFDFFSYSWQIDSHAIWHACTVLPSWKLYDFFLH
FT                   DFHYLDACEDSSSD"
FT   gene            <173860..>175536
FT                   /locus_tag="KLTH0F02156g"
FT                   /old_locus_tag="KLTH-ORF7584"
FT   CDS_pept        173860..175536
FT                   /locus_tag="KLTH0F02156g"
FT                   /gene_family="HOG000197283" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7584"
FT                   /product="KLTH0F02156p"
FT                   /note="similar to uniprot|P53838 Saccharomyces cerevisiae
FT                   YNL275W"
FT                   /db_xref="GOA:C5DK66"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK66"
FT                   /protein_id="CAR23867.1"
FT                   /translation="MTLRGGLVSKAPREMFGFWSEDRAKLSQTEEDTDDTQSNLRTKFP
FT                   KPFAGIAHDLRDRLPVYWSDWSDSWDYRVIPSVIETFFNNLLPAIAFAQDMFDRTDHSY
FT                   GVNEVLLASTVGGVVFGLLAGQPLCIVGVTGPITIFNYTVYEVIKPLHTNYFGFMFWVC
FT                   IWSMIFHFLLAIFNAVCLLQYVTTFPCDVFGLFNNVVYMEKGIQILVRQFKKNGKVDLS
FT                   AGFASTVVALLMTMFGLSSKLITKTPFFSHRIRTFIADYSTALSVVFWSGFIHFGGFLS
FT                   DIDFQKLPITKSFIPTSHLRDRTTWLAYEAISTRDIFIALPFGLVLTTLFYFDHNVSSL
FT                   MAQRYQYRLKKASTFHYDFALLGATTGVSGILGIPAPNGLIPQAPLHTESLLVRDKRGE
FT                   VVRCVEQRFTNTAQGLLTLATMSRPLLVCLGQIPQAVLSGLFFIMGLNNLLHNAILGRI
FT                   MLLITERDKRDLRNLIYKVPLPKVLIFLSLSLAGFAAEFAISNTIAAIGFPLILLLTVI
FT                   VSLFFPKWFSPEDLKILDEGVAEEFTLKNLQVSSLTGTSAT"
FT   gene            <175709..>176068
FT                   /locus_tag="KLTH0F02178g"
FT                   /old_locus_tag="KLTH-ORF7583"
FT   CDS_pept        175709..176068
FT                   /locus_tag="KLTH0F02178g"
FT                   /gene_family="HOG000000903" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7583"
FT                   /product="KLTH0F02178p"
FT                   /note="similar to uniprot|P25361 Saccharomyces cerevisiae
FT                   YCR043C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK67"
FT                   /protein_id="CAR23868.1"
FT                   /translation="MIPEPVDPGLLREHAFYDSGDLGVVLSKDTYTEFGGFKSIFKYGL
FT                   GYFNYASGLDREVHERSLAYMLKFHILQHFGLYCCITMVALVVSFIALSQVQGNAMGRN
FT                   KKAEKDGDDVYYVKV"
FT   gene            complement(<176232..>177281)
FT                   /locus_tag="KLTH0F02200g"
FT                   /old_locus_tag="KLTH-ORF7582"
FT   CDS_pept        complement(176232..177281)
FT                   /locus_tag="KLTH0F02200g"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7582"
FT                   /product="KLTH0F02200p"
FT                   /note="similar to uniprot|P53839 Saccharomyces cerevisiae
FT                   YNL274C Putative hydroxyisocaproate dehydrogenase"
FT                   /db_xref="GOA:C5DK68"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK68"
FT                   /protein_id="CAR23869.1"
FT                   /translation="MSKPVVLRLGAVKYAQEAWEKLAKIADVVTIEDSTTRPEFLKMCQ
FT                   DPNSAVSKAQIVSRTFASVQQTGRFDKELAQKLPSSVVAVCHNGAGYDQIDTSDFADRK
FT                   IQVSNVPELVNNATADTHVFLMLGALRNFEYGRRLMLENKWPSGGAAAGAPVGHDPEGK
FT                   VVGVLGLGGIGRAIVERLKPFGFKKFIYHNRNRLSPELENGCEYVSFEQLLEQSDVVSI
FT                   NIPLNAKTRHIIDEAAISKMKDGVVIVNTARGAVIDEKALIAALKNGKVRSAGLDVYEH
FT                   EPQVPQELLDLPNVCGVPHMGTHSVETIKIMEEFVVENVKSVINSGKVLSIVPEMKNDA
FT                   WAKDQKPLV"
FT   gene            <177818..>182149
FT                   /locus_tag="KLTH0F02222g"
FT                   /old_locus_tag="KLTH-ORF7578"
FT   CDS_pept        177818..182149
FT                   /locus_tag="KLTH0F02222g"
FT                   /gene_family="HOG000157894" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7578"
FT                   /product="KLTH0F02222p"
FT                   /note="similar to uniprot|P23255 Saccharomyces cerevisiae
FT                   YCR042C TAF2 TFIID subunit (150 kDa) involved in RNA
FT                   polymerase II transcription initiation"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK69"
FT                   /protein_id="CAR23870.1"
FT                   /translation="MQEATSPPSAIPSFQRPRTASGFRANSSNQSAKDSLSAHTAMAPL
FT                   KATPRASGSSQLFLAAPEAAFKIAHQRVFVDVDLANHSLVGYTEIILIPLSDRLEFVTL
FT                   DCKQMNVTGVIVENRRCDNYIHDDPYRWYAEKYSKGQLLDSPLYRCNSVEQSHFLRNKF
FT                   SELNHASESTDSNRSQLTIRIPPSVKITLQDANAVSFTPITPSIRTPAQDTIYSPITIR
FT                   INYELHNPTTGLQFDTSREQALWNACTTNTELNSSASHWLPCVDTLEEKCTWELEFSIP
FT                   KKVRDIGTSNIVGATQPRRHRRNPNTPGRDNEHDTDSGIDNIDNDGHDADNRNQNEDDD
FT                   EEMDEEDEEDNPLNREMVVCCSEFSSGKEVPHPTDLSRKVASFQIFNPVAPHHIGWAVG
FT                   PFQTWVLPQVKAQEEPEEDPDEPYAPVQNQEDEERDVIPIQIYTLPSPDVDERTILNST
FT                   LVTHEILDFYSKEFGSYSFTSYCLLFLPSIAGDHMDFAGATFCNTRLLYPPEVIDPTFT
FT                   TTDKLTWALAAQWAGVNVTPLDMNDMWCCIGMAGYMALQFSKHLMGLNEFKYRVKLLSE
FT                   QVVEQDWEKPPMADSFTQASMPISSLSKQLQFIKLKAPIVLYILDRRMTKTERSFGMSR
FT                   VLPKIFLQAMSGDLPNSTLSTAHFQHVCERVNKNKLENFFKEWVYGSGVPIFRITQRFN
FT                   KKRMVVEMGIRQCQVQELGLGKTVGDEGFSSSAMNHLCSPNKNLTPVFTGSMTIRIHEA
FT                   DGTPYEHIVELKDTFTKLDIQYNTKYKRLKRRRKINKTAKQEGKDPTPAENPDVLVAED
FT                   ENEDIVLVNCLGDVLLSAKDCNQWNLTDPMVTSEGDEFQQQNEAFEWIRIDADFEWVCK
FT                   IHINQPDYMFASQLQQDRDVEAQIDSIRFFEDVVVNSNVNSMVYSSILTRTVMDERYFY
FT                   GVRIEACRALSRFIMQQPNTDNFSGGARHLIKIFQYYFCYENSNIPFDNDFSDYQRYFL
FT                   QKAIPQLLAEVRNQNDVCPRYVKRFLLDILRYNENGDNSYYDTHYVVTLITSVVTSALQ
FT                   DPEDASFYQDLLHELRRFKNLDQWIPSYQLLVTKCIMIQHLRLAIDGFYVFDDIANILE
FT                   YTVKEKLNSTSETSFHATEGLQDLLLTSFEVLLVDGGIKNKEALKLFFEYMLLHPDPYV
FT                   RTQLISVLVDSIDFIATKRYLEDLDDDIDSIHTTINLPSGMESGKLGDSNIIIENYSAE
FT                   ASSKRETQMRASIGGLITLMRRRFASYAPLKQIIWDSLHSPLTSVYQKKCLFDVIRVIY
FT                   KLQDNFYVTLPIPRDRRLVAKNIGNGIVKIRREGILKINLAPKIKINSKRKPPVSTKSS
FT                   SVKLKLNLPNSKKSSTPSRRQSNPSVNSSPLPRKKQKIVRSSVTKIGSLPLRFVKISSS
FT                   RGTVDVSAAQFNENVTIVKSNARALVMKIKMPRGSKKEEDS"
FT   gene            <182354..>184459
FT                   /locus_tag="KLTH0F02244g"
FT                   /old_locus_tag="KLTH-ORF7572"
FT   CDS_pept        182354..184459
FT                   /locus_tag="KLTH0F02244g"
FT                   /gene_family="HOG000093382" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7572"
FT                   /product="KLTH0F02244p"
FT                   /note="similar to uniprot|Q12232 Saccharomyces cerevisiae
FT                   YOR154W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK70"
FT                   /protein_id="CAR23871.1"
FT                   /translation="MVVIGRILHLLVLFRASACFTSEPQEISTSSSAGQSELSSFLSKE
FT                   SRGTSTTQQSSAEVPQTQYDQHSVSTVSVTSSGNFTQTSSSLDKDTYIENSAYSPPDES
FT                   GSASRSLQGTKSSLVAIAEAQESDFNETDTTFLSFDEWKKEKLGEESLQKAKPPARVNR
FT                   PVDSSVYKGEAMGDDFEIDVGLFTSSKQDLNEEPEGKLYKDKFNYASLDCAATIVKTNS
FT                   EASGANAVLHENKDKYLLTPCSASNKFVVIELCQDILVEEIVMANYEFFSSTFSKVRFS
FT                   VSNSYPPKNGWKVLGEFDAANTRNLQKFGISNPLIWARYLRVEVLAHHGNEFYCPISVI
FT                   RVHGKTMMDDFKLDESNSLYSEDAVEQASPEGQLKECRQEKLAPHNLSESMLRECQFPQ
FT                   FPQADNVSILSKLDFLSTQCPAVLPHLKFDQFLKDINQSVCDTKIHQPQLDISTSAPSS
FT                   STEESIFKTIMKRLTLLESNSTLSLRYIEEQSMLLSKAFASLERNQAKKFQSLVQAFNQ
FT                   TIVSNLGDINFFTQQLRESSIKLLEEQKLANDQFTSETFHRLESMKKDAIFQRRLSYTM
FT                   LFAFVILLVYVLLTKEAYIDEYMEDDGWYLNSPPLKKFKDNFLRRAGKSTDDRRSLVFC
FT                   TSRDYSENDEKSDVSASTSSASLYDEFATKVAHEMDGNVLSYRKPTTSLEEEDIDIDEA
FT                   LSEGSSR"
FT   gene            complement(<184716..>186182)
FT                   /locus_tag="KLTH0F02266g"
FT                   /old_locus_tag="KLTH-ORF7569"
FT   CDS_pept        complement(184716..186182)
FT                   /locus_tag="KLTH0F02266g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7569"
FT                   /product="KLTH0F02266p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK71"
FT                   /protein_id="CAR23872.1"
FT                   /translation="MNGVEERARRAKILAQLESQACEHSLEDYRADVQGYLWDLEFQNR
FT                   ADPTMIESQPELEWYMRPYLIDFLIELHGYFRLRPETLFLACSIADRYLSKRMVYKKHY
FT                   QLVMTTALWIAAKYEDKKSRTPLVRELVALCRDAYDSTMFAQMELHMLSTLGWNVGSVA
FT                   SVYGSLSLFLGMDIFSGSPAGQAGVAVLSDLAGFLAELSMYEKDYMYFSTAVQALSAVL
FT                   VASKVLNNTAMADFIYCSLAHQQGPVRCGTLCAHSPKEQLPLLRLDEQTLEDIRQCSLL
FT                   FVNDLYKTKTLNKPLPAALLHKYSRSSFEPFLERFTSCNMNSFITLTQLTQAVGSSDQT
FT                   LLRQSTRSLTDICIGLLIPPTTADVANSRLALHTFDGSTPCGDENAGRAVFRRSSSACN
FT                   TLGVPSAPQLSMQTLDVRCSSPAASTVSANSVFSSGQSTLSQSSASSPMLLTSRKQFPI
FT                   RMNSFSSVYSHHPNQRVLTRFDSTESTMAE"
FT   gene            <186895..>188037
FT                   /locus_tag="KLTH0F02288g"
FT                   /old_locus_tag="KLTH-ORF7565"
FT   CDS_pept        186895..188037
FT                   /locus_tag="KLTH0F02288g"
FT                   /gene_family="HOG000057107" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7565"
FT                   /product="KLTH0F02288p"
FT                   /note="weakly similar to uniprot|P25381 Saccharomyces
FT                   cerevisiae YCR045C Hypothetical ORF"
FT                   /db_xref="GOA:C5DK72"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK72"
FT                   /protein_id="CAR23873.1"
FT                   /translation="MRLFMAALFGLRAAGAVRFVAELGDTASVEEVLGEQYAATVAGGG
FT                   VGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAPNHLARLS
FT                   QKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVAT
FT                   GDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHASKLAAVTK
FT                   RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGALTIGS
FT                   IDVARNDALAPFTNFAECVDLFTAGVDVATLGLDHSSEHHLSGTSISAGVASGLVAYYM
FT                   SIGHYGMDAVNKIKLLSLPNVIPNLQQRSPETRNAILQNL"
FT   gene            <188430..>192074
FT                   /locus_tag="KLTH0F02310g"
FT                   /old_locus_tag="KLTH-ORF7562"
FT   CDS_pept        188430..192074
FT                   /locus_tag="KLTH0F02310g"
FT                   /gene_family="HOG000057108" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7562"
FT                   /product="KLTH0F02310p"
FT                   /note="similar to uniprot|P53840 Saccharomyces cerevisiae
FT                   YNL273W TOF1 Protein that interacts with topoisomerase I"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK73"
FT                   /protein_id="CAR23874.1"
FT                   /translation="MSTLGSSQIPEATGEFGSPQRSAEDGQPVVDNSSQILKARIALLA
FT                   TAIGGPDHSSEVDPPPYVIGDDCLACLKDLKRWFKLVDDKQSRWDVAAAAAQYNILTED
FT                   LLPILINWDKAHCDAIKKAKKKGGTPEDYLGNKSYHHKIALNALQLMVLMTWPLILTDQ
FT                   STQNQVAHYSELKKSQVKYKKAILSVENGRVLRSAIRLAVEVIKTEKRLRTPKDNVVLR
FT                   LVLNFFRNIVAIEPSDLTISSKKSLSKGINSTDMLPPSVSRDDISLSAVVGAFQTNKVF
FT                   KFLLTLSSSINQEFDAAFINVPLLELIFFLIKNASHSTFFPAGGKTSSKPNQKNEGLGQ
FT                   TQVGSELSRLLKKEREMKKTVVRNTSTRHSRFGSLLSIQTSEHQRLTVSGGQNILDGDF
FT                   ALQKMDSRKKWNKRSVMKDEHVEGLASNFLNFNEEARYWDNATALVLKEFVDDFIEVGF
FT                   NSLLRSVTDYFTTEEDKMVVVHQIQYLLFYSWFLKYQRLAKQSDPKLNFQPVMFALRDT
FT                   ACILVSQILRKAVEQKVWAVVHAGMIAFNEIMSTLATMGPEDEDIAQYVKGQILQEERI
FT                   KLLSSLPRTASNHSTSYIRSCVSLVHTLLRMLESDSIESKEPQESNKNAKGRDGTFSLI
FT                   EAERIAEEEGIEIEEALEIMEQRFRKASLDYNKVQRAFSVETTVKTYISFLQRFRDLED
FT                   GDIKKAIQFLYRVFAGVKEESLLYRIDFMILLKDLLGPTGLSMASRSRKHVVKFADFYM
FT                   ARFKERLKASPSWFVSILFPTIHDREAGHYQKYGEKLMANQNQIVLPSSKFIEAEELIG
FT                   LSASALLDFKFGVLVSSLIDNEKRECVEALKQALTRTCNVLKSWLLNEVSRGDEFGHTS
FT                   KEFFEPEDAFVKRSTYRDPDFRALLQLCGYEVPQSVKGKCVLIPSTPIPEIESSITLLV
FT                   KYLTNAFDTPNGLPSSSYLTRPNTQGAEDDSYYFTNDGIQTEAEQDDTGNQDQYFKALE
FT                   SDALTNNLHSTRGVALKKRKKATRKDNAKPKTNKQNSNPRKSEREPSTNSEPSNKRQNI
FT                   TSAEYISDSDDSSDESMHSIFYENEMYMRFLLDKHGGLLPPDKFALFSVFSNERIKNGG
FT                   LTTNDYSSLFGGPIPSLEGLKRSEGLEAPQTVSGKINNDLHDREVPRLLANQQKHLHGS
FT                   SPTGSEVIQPLSNHPLLSDASDKDDEEVSKTPAQTRKRQRVMFEDDDE"
FT   gene            complement(<192112..>193521)
FT                   /locus_tag="KLTH0F02332g"
FT                   /old_locus_tag="KLTH-ORF7558"
FT   CDS_pept        complement(192112..193521)
FT                   /locus_tag="KLTH0F02332g"
FT                   /gene_family="HOG000188354" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7558"
FT                   /product="KLTH0F02332p"
FT                   /note="similar to uniprot|P39981 Saccharomyces cerevisiae
FT                   YEL064C AVT2 Putative transporter member of a family of
FT                   seven S. cerevisiae genes (AVT1-7) related to vesicular
FT                   GABA-glycine transporters"
FT                   /db_xref="GOA:C5DK74"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK74"
FT                   /protein_id="CAR23875.1"
FT                   /translation="MSKDPFNEPFIQGRGSHDQRGPLGDNFELSSFDRSTEVRPERLSV
FT                   DSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVLLS
FT                   LLVDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIGD
FT                   TIPHVLRAFFSGHDNLFHRNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMVVIVV
FT                   IVVIKGPGTDSAYKGSFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTPSLKR
FT                   FDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFNMLT
FT                   TFPLEIFVLRDVIKDLMFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLTTCNLGAL
FT                   FELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISSTQTIISY
FT                   INGGDQKHCET"
FT   gene            complement(<193705..>195906)
FT                   /locus_tag="KLTH0F02354g"
FT                   /old_locus_tag="KLTH-ORF7553"
FT   CDS_pept        complement(193705..195906)
FT                   /locus_tag="KLTH0F02354g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7553"
FT                   /product="KLTH0F02354p"
FT                   /note="similar to uniprot|P17065 Saccharomyces cerevisiae
FT                   YNL272C SEC2 Guanyl-nucleotide exchange factor for the
FT                   small G-protein Sec4p located on cytoplasmic vesicles
FT                   essential for post-Golgi vesicle transport"
FT                   /db_xref="InterPro:IPR009449"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK75"
FT                   /protein_id="CAR23876.1"
FT                   /translation="MTEEEESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQ
FT                   RESLQNYEDLRQQLEQAESNLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDL
FT                   TASLFDEANNMVADARRETHSVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEE
FT                   ESNDRLKSNQASVAAEDSVASSSESALEKTMNALNGTASPPSPALFSPLLKSLRYDLVL
FT                   YNEFLKFIAALPQCASIRDSTSYSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLM
FT                   IDGSIVVEPVSGINETYRVGHMSSQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPC
FT                   SFCSESRNDILEHGRLYVLKTLQKMENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSL
FT                   KSGAWHLEAVTISKTNNAFSVQTNSVSNSPTLESPPDKMKPDRKSKRMSFMAGLSKTLP
FT                   LKTSYTVESASPCPEQITTPTTNIQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPV
FT                   VAVDRPGNDSIVGDGLVPELGQEARESFSLHNEEEVDNEEGFDFEKMNSTLESAGLEGK
FT                   ETSQTTQTSSGNPTTLDPRTSEGGDAGAKIGASFVQTIADSDTGASSPIQESQTKTART
FT                   VEKKAAVPGSIDLDEQNYAQNVEAPARMVKSRTSEAPNGEGTAENIIELVAESDTKKIT
FT                   GKAPESASSDHAKSRSELPSQSATDDEEAGFDDARSTFS"
FT   gene            complement(<196194..>202124)
FT                   /locus_tag="KLTH0F02376g"
FT                   /old_locus_tag="KLTH-ORF7551"
FT   CDS_pept        complement(196194..202124)
FT                   /locus_tag="KLTH0F02376g"
FT                   /gene_family="HOG000095244" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7551"
FT                   /product="KLTH0F02376p"
FT                   /note="some similarities with uniprot|P41832 Saccharomyces
FT                   cerevisiae YNL271C BNI1 Formin nucleates the formation of
FT                   linear actin filaments involved in cell processes such as
FT                   budding and mitotic spindle orientation which require the
FT                   formation of polarized actin cables functionally redundant
FT                   with BNR1"
FT                   /db_xref="GOA:C5DK76"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK76"
FT                   /protein_id="CAR23877.1"
FT                   /translation="MNRSSNSKSSKAPHNRSASSSSGNGGIFSNLKRLTTGSGNSSVSH
FT                   NTQKLDISDISSPKKINLPDTGEFSHKPLSKQSTLNMASLSAYTDAVGAHNRSASNASV
FT                   GSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNQSMSSASIFSQGSFSNLSKFVGPDGA
FT                   VRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQSEVKK
FT                   FMNSKNASKSSTVVGGSSSAVPDSPSASNFTSSTSPNGSFTGLSRPKISTSSVNTSEQF
FT                   YSSNLGTSSTTTLSQDPSHLSPDYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLE
FT                   AQGQVAIANVILKTCYRESPDNLLGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSAR
FT                   IIVSAIVEGLLSLRVATRRVASELLISLSQWSLPHGFNHVMDALDQESRFCDNVHLQAR
FT                   LITQSASKDPKKGSSIAPTPDGDGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFR
FT                   TSGGENAIMEYAYLTLLLINHLCQTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKV
FT                   DEQLARFDDSTTDDFDALYSQESTGEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQN
FT                   LLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDE
FT                   IARRAILENRDWVKRYEEIKADRDNLKEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVN
FT                   AQLQHELDESKKKLILAKHEHEVELRKTLTAMNSNFEGSHNMRDEKGSENPRPLRPERK
FT                   LAIQKALQAKLEKTSKEINVESKRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSD
FT                   YQKDDIKEPEVSNEDDHKAVSESEEKAQQISALKLEELRKKLASLQQESNDISKFNVEG
FT                   RFHEMFSGQKSLALDRLKKLETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDPKE
FT                   ALNIVEEVSNILSGLDSSKAAEKSNETPLRTATSSDSSEDEMDDKNGDKIAADSTLPTS
FT                   SFLESLSQKYGGAQNSLSNRHSFAGGEINYPGSGYHRKSFMNRVKRTGAVPYLGELSGK
FT                   IGSSSYIKPSEAEENVGIGIMVDEKPLSRRVQEDAAGVSQLESNEEKPALSHDLDKNTT
FT                   HSKPITIGENLAAAKTAGKQQAHEDEGTTEGSSTDKDSHEIASATSAPPPPPPPPMDLF
FT                   AKNGAPVKTDNPDPAVSDTKSAAAPPPPPPPPPIPPMLASSSSGSTSKAGAPPPPPPPP
FT                   PPPPALLSQSSNNGPPPPPPPPPPFGASVSRNKSATPSPMLPQSPSLFDRYPRPSKKLK
FT                   QLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAFAAREIKSLASRKKKDSDKL
FT                   SFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTPSVIDFLSKQEIVEVSNNL
FT                   ARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRLYLELFVNLQTYWSSRMRALKVIT
FT                   TYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVILAVGNFMNDSSKQAQGFRLATLQ
FT                   RLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELEPVVAAVKISIEQVAQDCREFSQ
FT                   SVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEARKKGDLLMDEMKLTLLEFDNLM
FT                   RLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEEEERAYERRKKLVEDQLKRTR
FT                   ESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGPAKSDPSSARKRAVARKRLL
FT                   QGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADTSPTPERRVRDSNATSPAS
FT                   HDTGSSDLTDRARNLLIELRGPESPGVKMSAQHQRLSKLRARRKNDSSSSGSENRLNFV
FT                   GAGQAENSDEQNEPEVLKSKPESANDDDNGEQSDSSDGEFLDA"
FT   gene            complement(<202746..>204413)
FT                   /locus_tag="KLTH0F02398g"
FT                   /old_locus_tag="KLTH-ORF7543"
FT   CDS_pept        complement(202746..204413)
FT                   /locus_tag="KLTH0F02398g"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7543"
FT                   /product="KLTH0F02398p"
FT                   /note="similar to uniprot|P04817 Saccharomyces cerevisiae
FT                   YEL063C CAN1 Plasma membrane arginine permease requires
FT                   phosphatidyl ethanolamine (PE) for localization exclusively
FT                   associated with lipid rafts mutation confers canavanine
FT                   resistance"
FT                   /db_xref="GOA:C5DK77"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK77"
FT                   /protein_id="CAR23878.1"
FT                   /translation="MEMQSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQ
FT                   ERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQS
FT                   LGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLG
FT                   VPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGP
FT                   VGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKT
FT                   VPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNSGTRALP
FT                   DIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFG
FT                   FLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAK
FT                   LMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRL
FT                   IHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA"
FT   gene            <205827..>207692
FT                   /locus_tag="KLTH0F02420g"
FT                   /old_locus_tag="KLTH-ORF7528"
FT   CDS_pept        205827..207692
FT                   /locus_tag="KLTH0F02420g"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7528"
FT                   /product="KLTH0F02420p"
FT                   /note="similar to uniprot|P32487 Saccharomyces cerevisiae
FT                   YNL268W LYP1 Lysine permease one of three amino acid
FT                   permeases (Alp1p Can1p Lyp1p) responsible for uptake of
FT                   cationic amino acids"
FT                   /db_xref="GOA:C5DK78"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK78"
FT                   /protein_id="CAR23879.1"
FT                   /translation="MARKKEACAPCASPGLYCKSSGEAKRPVSSSRQLQSTEQSIHQRC
FT                   CSVPKHPGMTEKNSLHSRARRGSGATAGEPKLKAHSDDFEMYVYSQDEPSTDPLGSDTE
FT                   SGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTV
FT                   VYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQV
FT                   IEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVC
FT                   GGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGE
FT                   AANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQN
FT                   AGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGV
FT                   IVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRD
FT                   DLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQ
FT                   LFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA"
FT   gene            <208501..>211584
FT                   /locus_tag="KLTH0F02442g"
FT                   /old_locus_tag="KLTH-ORF7524"
FT   CDS_pept        208501..211584
FT                   /locus_tag="KLTH0F02442g"
FT                   /gene_family="HOG000248748" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7524"
FT                   /product="KLTH0F02442p"
FT                   /note="similar to uniprot|P39104 Saccharomyces cerevisiae
FT                   YNL267W PIK1 Phosphatidylinositol 4-kinase catalyzes first
FT                   step in the biosynthesis of phosphatidylinositol-4 5-
FT                   biphosphate may control cytokineses through the actin
FT                   cytoskeleton"
FT                   /db_xref="GOA:C5DK79"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021601"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK79"
FT                   /protein_id="CAR23880.1"
FT                   /translation="MSETAPDSDSSDLAPSTSAPGSNQLLLKFINSAHFTLYNNIEYLT
FT                   RYSQNIGIHFYLCQKLLTFPHNELQFYIPQLVQVLLTVETESIALEELLLKLSAENPHF
FT                   ALLTFWQLQALLGDLSTDPSSYAFQVARRVINSLQNVLFNPHKVAAESEKIHENVAPAL
FT                   VLCSMVIGSCALPGLGEFAKPLVQSQGKRQKSYVFKLAKNAMRNLTKNLTLKNTLLNQG
FT                   RSSSNGSHSKESNALVELVDGVTTREDTLFKKPREKPLTSLNFDMIDDVGEKMFQERIS
FT                   NSIKMPKRKSRTTDQSYVHRIYQRSALTGASDSVYEDEYTNSMPDLHKEMTNNRSTSSL
FT                   NSLKSQSGNESEVDDRSIKKVNSDPLADDYHDDTIRIDTMRRRSRQGKDLTTLQLSQLS
FT                   IPKKIRILKSNYFRCETQLAIALESISQRLAQVPSEARLSALRAELLLLNRDLPAEVDI
FT                   PTLLPPNKKGKLHKLVKITANEAQVLNSAEKVPFLLLIEYLRDEMDFDPTTEENENVLR
FT                   RNPGEESFIFDLASITKDANSHAEEITAVNEARNSRSSLRVSSTNEATQVTSEKEVDLG
FT                   DVSVVNLTNHNEAETYRRELMVQSAAKVPVIPNDSTNRNPELQFLNNLEEIRSELEGVE
FT                   FGGPSASSAEDLATQMRISAVMLAQLDKSPQQLHGSTNQIRAKIIASMQEVQDRFGFQD
FT                   LEAIHGMAGQRKLENDLKTGGLQGTKKDMSYLGENWNAKKERIRATSEFGEAENWDLCS
FT                   VIAKSGDDLRQEAFACQMIQAMANIWAKENVGVWVKKMKILITSANTGLVETITNAMSV
FT                   HSIKKSLTQQMVENGELNEKGQIASLKDHFARAYGDPTEFKYSRARDNFAFSLAAYSII
FT                   CYVLQVKDRHNGNIMVDNEGHVVHIDFGFMLSNSPGSVGFEAAPFKLTYEYVDLLGGLE
FT                   AEPYKKFVRLTKDGFKALRKYADQLVSMCEIMQKDNMQPCFNAGEQTSAQLRQRFHLEL
FT                   TEQECDDFVENVLVGKSLGSIYTRLYDQFQLISQGIYS"
FT   gene            <212372..>213523
FT                   /locus_tag="KLTH0F02464g"
FT                   /old_locus_tag="KLTH-ORF7522"
FT   CDS_pept        212372..213523
FT                   /locus_tag="KLTH0F02464g"
FT                   /gene_family="HOG000205225" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7522"
FT                   /product="KLTH0F02464p"
FT                   /note="similar to uniprot|P53230 Saccharomyces cerevisiae
FT                   YGR046W Essential protein of unknown function mRNA is
FT                   targeted to the bud via the mRNA transport system involving
FT                   She2p"
FT                   /db_xref="InterPro:IPR015222"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK80"
FT                   /protein_id="CAR23881.1"
FT                   /translation="MLRLSRVANSVTGLRSNGRAVVLRLNSTHAYGHQKDSFQPIVHGP
FT                   IMSSTGKMRHDVLQDELRLLEQGIKKSDELTSQFTNYRYKFKKLPPNYGSNQLLTIDGD
FT                   LQKDLDGVVAHFRAPIKYAFGYGSGVFQQSGYSKTQDSPQIDLILGVSHPEHFHSLNMR
FT                   QNPHHYSSLRYFGSQFVSKFQEIGAGIYFNPFVDINGQTVKYGVVSMENLLRDIATWDS
FT                   FYLAGRLQKPVKVLKNDLSVQYWNQLNLKAAATLAKHLISQDSKKPLDELEFYTQITAL
FT                   SYVGDIRYKVGGENPDKVKNIVEKNFTQFQEYYKPIYKDVIVNNSHYLPRGFTFENSIQ
FT                   LLESRIFRTSTLQTLKGIFTAGITKSIRYAWAKKLKAMKRKSS"
FT   gene            complement(<213688..>214482)
FT                   /locus_tag="KLTH0F02486g"
FT                   /old_locus_tag="KLTH-ORF7520"
FT   CDS_pept        complement(213688..214482)
FT                   /locus_tag="KLTH0F02486g"
FT                   /gene_family="HOG000205346" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7520"
FT                   /product="KLTH0F02486p"
FT                   /note="similar to uniprot|P53843 Saccharomyces cerevisiae
FT                   YNL265C IST1 Putative translation initiation factor as
FT                   suggested by computational analysis of large- scale
FT                   protein-protein interaction data"
FT                   /db_xref="InterPro:IPR005061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK81"
FT                   /protein_id="CAR23882.1"
FT                   /translation="MCIQRLRYAQEKQQSLAKKARRDVAQLLADGKEQKAHYRIESLIN
FT                   DDVHEELLEVLELYCELLHARIALLCSVQDEADLIENHAENGLNEAARAVVFATLHAPE
FT                   IKELQQAKELLTLKFGNDFTRTIIDEKLGVPDKVLKKCSPRLPDEELITLYLKEIAITY
FT                   EVPFSKLEEASREEAEHEKSPTPTDSSSEDSRPIVAVDNNSLEDGKHAITVKKPRKDSD
FT                   TMGSDLKVPRDMKKDVKVKNNKQNAHDTDLDELKKRFAALRR"
FT   gene            complement(<214785..>217952)
FT                   /locus_tag="KLTH0F02508g"
FT                   /old_locus_tag="KLTH-ORF7518"
FT   CDS_pept        complement(214785..217952)
FT                   /locus_tag="KLTH0F02508g"
FT                   /gene_family="HOG000248222" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7518"
FT                   /product="KLTH0F02508p"
FT                   /note="similar to uniprot|P33339 Saccharomyces cerevisiae
FT                   YGR047C"
FT                   /db_xref="GOA:C5DK82"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK82"
FT                   /protein_id="CAR23883.1"
FT                   /translation="MVEENANENGEEKNIDEEEFYGNLDELRDLIDDENDGRTDGNVTG
FT                   FSDSTASEDEVFDERLLEQDGTHLDAEQLEEKGSIDENHYEDADLLAEFSDYGEFSDDE
FT                   YDEQDFMDAIREANNFKVKRKNKAKKKKESVGKAPKRNVRERVLDPEVAQLLSEANEAF
FT                   VRNDIQVAEHLYNEVIKKDVKNFAAYKTLGDIYQLQGRFNDCCNSWFLAAHLNPSDWEF
FT                   WKVVATLSSDLGHIRQAIYCYTRALRMNSDDWECLYGRSILYKKTNQLGRALEGFQRLH
FT                   NNNPYDGNLLRELAILYVDYNRINEAIELYIKIFEANVQKREALISAAENAVESSGESG
FT                   NESNDDESEDLDEAEEGYKEYSHINWKKIHKKFRCIAFDWSSLNILAELFLKQSGENTG
FT                   IKTIKKCARWIQKREKQTFWDNVNDDSEFDKRRFKNSKFDALSKEEKEKSYILPIDIRV
FT                   RLGLLRLNNKHVLEAMNHFQALYDETFVDITDLFFEVACALTKAERFQEAIEFFAPLLQ
FT                   IPDYCTLEVYKPLSKCYKEVEDYENAKLIFKKLVELAPEDLETKLTLAEIYYHLEDHET
FT                   FNALLLEVVETRKQQATDIRQDVAGLNDQPNQGPEERSTNELGKPLLEDIHIRKTAAKR
FT                   KRTPQDAERERKEREKRITSNVLDKYNRLKIYKEGMEKGQESQTTLWIDTASDLIDVFS
FT                   SVKNFFVKSRSKKFVGVIKRSRKFNKIIDYKIKRLSKLSEGENLLDGLPLLEERVSLTS
FT                   STELRGLTYQQWFELFMELSLVITKLQSVEDGLSVIETAQEVNVFAQDPEKVKMMKFVN
FT                   LAIVLRLEDEDELVENLRGVLNQFQFNRKVFQCFMFCVARGQMSSDILSSTVQQKFFLR
FT                   QLKAYDSIRYGQHVAGQASVTNKKVSNPDKFKSPYLHYIYAMLLYSSKGFLLALQYLNR
FT                   LEPELYEDPMINLMTGLAHLHRSMQRLTASRHFQILHGLRFLYRYHDIRANRYSSTEKQ
FT                   EADYNIGRAFHLLGLFSIATRYYQKVMTEYGDEKLKRHAAYNCILIYNESGNPELANSL
FT                   MEKYLSI"
FT   gene            <218224..>219279
FT                   /locus_tag="KLTH0F02530g"
FT                   /old_locus_tag="KLTH-ORF7516"
FT   CDS_pept        218224..219279
FT                   /locus_tag="KLTH0F02530g"
FT                   /gene_family="HOG000212737" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7516"
FT                   /product="KLTH0F02530p"
FT                   /note="similar to uniprot|P53044 Saccharomyces cerevisiae
FT                   YGR048W UFD1 Protein that interacts with Cdc48p and Npl4p
FT                   involved in recognition of polyubiquitinated proteins and
FT                   their presentation to the 26S proteasome for degradation
FT                   involved in transporting proteins from the ER to the
FT                   cytosol"
FT                   /db_xref="GOA:C5DK83"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK83"
FT                   /protein_id="CAR23884.1"
FT                   /translation="MFSGFGGFGGFNAGFVNIPQKFEDFFRCYPISMMNDRIRKDDANF
FT                   GGKIFLPPSALNKLTMLNVRYPMLFELTVPDTKKVTHGGVLEFIAEEGRVYLPQWMMET
FT                   LGVNPGSLLQIASTDVPLGQFVKIEPQSVDFLDISDPKAVLENVLRKFSTLTVDDIIEI
FT                   NYNSKLYRIKVLEVKPESSSNSICVIETDLVTDFAPPVGYVEPDYRTEHRKSQKPKLDP
FT                   SAQGLGPMSQRIDYATSVKSTSTTRAFVGTGQSLSGRTANKSEERELERPMISLDNEPA
FT                   PLRLPEGQLFFGFPVVLPKKASDSQDENTEESQFQGAGQSLRQSNKRRGKKDHSSPRPK
FT                   APKSPEVIEID"
FT   gene            complement(<219375..>222959)
FT                   /locus_tag="KLTH0F02552g"
FT                   /old_locus_tag="KLTH-ORF7515"
FT   CDS_pept        complement(219375..222959)
FT                   /locus_tag="KLTH0F02552g"
FT                   /gene_family="HOG000057110" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7515"
FT                   /product="KLTH0F02552p"
FT                   /note="similar to uniprot|P53120 Saccharomyces cerevisiae
FT                   YGL140C Hypothetical ORF"
FT                   /db_xref="GOA:C5DK84"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="InterPro:IPR020966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK84"
FT                   /protein_id="CAR23885.1"
FT                   /translation="MGNAKLRGKRVGRFLKRHFPCSRILAQRIFKSTVHATVALIFCLI
FT                   PKVRDRLGNQPSMLPLIAVMVHPGRRVSATIQGAIYCITGLLFGLAYSLLGRFIAQRCL
FT                   GHTWHTVSEGEQYAHNYKSYESALAILAVFETIMLFVHGWMRSVSHHYFHIVFPLFLVV
FT                   HFAFLAPLTQDAGTVAKAFSVPFYLGIALSIFWNLLLFPEFGSTYLGNATVDALNEIHK
FT                   SIDSAVNFFISIDVKKPSDSLYKKESISLAKLIKLKGSIDSKVSNCGLVLDECMYEISY
FT                   SYVPPSELKTVTKTFKELSMYINALVNACQLELILVGRGDRESVNNDLMNIETERELRH
FT                   GDATKLLKVLNKMKGVVFDLHKNMSQSLYMAKVAIACSYDVNLKKVDKSEVFSDEFAAA
FT                   FENNRNIPTDFDFEGAVEGLIAGVIEFDLKAREELIHLDEDLLQPNDEMFLFSSFLMNF
FT                   KETTNSVITLMKETHKVYQKRKVQEAKGALRGKTLWIHFLSNYDAFKTWITGANTSRTI
FT                   TESQSLTGGNIENNYRPPADMGVKRPQGEESALLSQRKPNNVKRLSKDLVLPITKAVEN
FT                   TKRSGSMKTSTRKQSFGNPLIKVMIFCHDFYTRYNFHFRFGLQVTVALMLASFPMFIPK
FT                   AREWYVNYRGAWIGFVCILALEPSVGGTFWVFFLRGVGVILGAAWAYVSYLAGCNQTNP
FT                   YLEVVVTIFGAVPGFYYLLGSPYVKAAIIQIISIYVVMLAAIIPSDNQGSILVNFAKRC
FT                   LAVGYGGGVAVLAQMTMFPMTAREQLNEEISFVAGCISEMQILLASGLEGEPLKSSLTE
FT                   ERFQKCAKISQSAKSALSRASDYKGLTRQEPRLKGEYTELEKVFTQMIYIQRQIIDRMD
FT                   NMILLRKQYGSAIIEELNQMVHSYRRQYVASITALMRAVQEAVLNKTPLPQYLPSARIA
FT                   HRRLVNKVQETLKVKYASQMKSMQPRVLTDLFRDESSDDDEGTNEELFMTTHKRRSTLP
FT                   PHEYIMKEKFLSWNASSAAAEEIIEYVEELVFLTKIIVGVNEFKYGFLSRPLYEDWAAE
FT                   AALKFDKFFEKGAPRKRGAVSKSNKAENNRPTHPLTPTTSRDSDHDTDEFERDMPVALN
FT                   NTPSVKSEASEDLDLARIASRKSGLKKLPSGFRKRAFSISSRNNPEEQINPLSKLRTLG
FT                   KGEIEEESSLESDSDEELPLALKKMILN"
FT   gene            complement(<223080..>224204)
FT                   /locus_tag="KLTH0F02574g"
FT                   /old_locus_tag="KLTH-ORF7512"
FT   CDS_pept        complement(223080..224204)
FT                   /locus_tag="KLTH0F02574g"
FT                   /gene_family="HOG000176881" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7512"
FT                   /product="KLTH0F02574p"
FT                   /note="similar to uniprot|P53844 Saccharomyces cerevisiae
FT                   YNL264C PDR17 Phosphatidylinositol transfer protein (PITP)
FT                   downregulates Plb1p-mediated turnover of
FT                   phosphatidylcholine found in the cytosol and microsomes
FT                   homologous to Pdr16p deletion affects phospholipid
FT                   composition"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK85"
FT                   /protein_id="CAR23886.1"
FT                   /translation="MGLFSKRNVEVRKEYNKSDIIKCNKAIRPRSQRSGKSKRVTGLSK
FT                   EELLVFGNVLKHFQQEGCTFPVQSPRVKDSEHCQKLPEQPLSSWEKCWLTADRILRFLR
FT                   SAKWDQEEAIARLTNTVIWRREFGIIDNEGRFHSSLVEAASSENESGGMLLLGYDRSQR
FT                   PILIVRPGRQNTTTSFAQVQHLIFMVESALVLMPPGVESMTVLIDFQTPAGIPFTRMPP
FT                   ISVSRQVLHLLQKHYPECLGKAILINIPWYGWNFLKLFHPLIDPTTRSKVRYEDAFDDH
FT                   VEETQLENSYGGRLNFTYEHELYWPDLIQLLSERSRVVYKKFLELGGQIGQSEFDLKDV
FT                   SDVVEQPTCDGDQDFSLMSHDHIGDGFPGEKHKV"
FT   gene            complement(<224401..>225249)
FT                   /locus_tag="KLTH0F02596g"
FT                   /old_locus_tag="KLTH-ORF7511"
FT   CDS_pept        complement(224401..225249)
FT                   /locus_tag="KLTH0F02596g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7511"
FT                   /product="KLTH0F02596p"
FT                   /note="weakly similar to uniprot|P52868 Saccharomyces
FT                   cerevisiae YGL128C"
FT                   /db_xref="GOA:C5DK86"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK86"
FT                   /protein_id="CAR23887.1"
FT                   /translation="MDLESVFQDHVNLYELLGIVVEGPEDLAKLSPLQIRRNFRQQALK
FT                   HHPDKNRQVSDSRQKFHQLDIAAKILSDPKLRSAYDQWFIGVFFEQQIANEARQEQTRK
FT                   LYQREMAVKRDRTQGTPNIAVFEEHGQYLRKLKHFKLPYGDWKRMDYSPENTNRKLTKS
FT                   CTLRFELQNHKLLQSKQELGDLMSNALQVRLVDLYYSPRNDYSADSTIVAYAVLPHIND
FT                   TLRVLTEWNVKKPCSDSSPFFSYIEDISPKTQHTSFTFTNQEQLRPYIKERLGRSPVIS
FT                   R"
FT   gene            complement(<225395..>226483)
FT                   /locus_tag="KLTH0F02618g"
FT                   /old_locus_tag="KLTH-ORF7509"
FT   CDS_pept        complement(225395..226483)
FT                   /locus_tag="KLTH0F02618g"
FT                   /gene_family="HOG000201672" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7509"
FT                   /product="KLTH0F02618p"
FT                   /note="similar to uniprot|P53845 Saccharomyces cerevisiae
FT                   YNL263C"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK87"
FT                   /protein_id="CAR23888.1"
FT                   /translation="MISCFTTSKNIESSCLTFTALKGYESIKLEAAPEPRRKEIITDLK
FT                   NQFVNKEMSYNPYAYVADTGAMNVNDRQQHAQHSSSINDPTHQQFHNNLSGPAAPSSEQ
FT                   SQGFSFQDPRSSMAYQLGQSAFSNFIGQNNLNQFQENLTKATGDSSSLSHYFQVSNSYV
FT                   FRKLKTILMPFLHRNWQRVPNASSQGSTSAPSFQVPRVDLNSPDMYIPVMGLVTYILAW
FT                   NFQQGMQGSFDPENLYQRLSTTLASVLLDLFILKMGLYLLVSSKSPTTSITELACYVGY
FT                   KFVPLTLALLLPSKPYLVSLVGKVYLLIAFGVFLLRSVKFNLFVDSGNDVHTVKKSVVK
FT                   KCNYFLFVYGFVWQSVLMWLMG"
FT   gene            <226621..>233223
FT                   /locus_tag="KLTH0F02640g"
FT                   /old_locus_tag="KLTH-ORF7507"
FT   CDS_pept        226621..233223
FT                   /locus_tag="KLTH0F02640g"
FT                   /gene_family="HOG000196287" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7507"
FT                   /product="KLTH0F02640p"
FT                   /note="similar to uniprot|P21951 Saccharomyces cerevisiae
FT                   YNL262W POL2 Catalytic subunit of DNA polymerase epsilon
FT                   one of the major chromosomal DNA replication polymerases
FT                   characterized by processivity and proofreading exonuclease
FT                   activity also involved in DNA synthesis during DNA repair"
FT                   /db_xref="GOA:C5DK88"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013697"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK88"
FT                   /protein_id="CAR23889.1"
FT                   /translation="MASRFRGSSTAKFVKKPPGDRSNGINTAVNTTAQQLVESTKKDEI
FT                   DTLMGFERYTAPQHNGKNVSIEETPGRTGWLVNMHPTLVPQDSGLTKGSALSPTGVSGV
FT                   DFYFLDEEGGGFKSTITFDPYFLVACRDESKTNDVEEYLKKHLEHCLKRVEVVIKNDLS
FT                   MSNHLVGLQRTMLKLTFANTNNLFEARKILRPIVMDNENNQLQRSMYSSNNGTAQDTKM
FT                   LISDIREYDVPYHVRVAIDKDIRVGKWYKVASQGFLEIKEKVAFADPVVLAFDIETTKA
FT                   PLKFPVATVDQIMMISYMIDGDGFLITNREIISEDIEDFEYSPKPEYPGYFTIFNEADE
FT                   LALLERFFEHIRDVRPTVISTFNGDFFDWPFVETRAKINGLDMYEEIGFAPDSEGEYKS
FT                   TYCAHMDCYRWVKRDSYLPQGSQGLKAVTQAKLGYNPIELDPELMTPYAYEKPQLLSEY
FT                   SVSDAVATYYLYMKYVHPFVFSLCTIIPLNPDEVLRKGTGTLCEMLLTVQAFKGDILLP
FT                   NKHTDPIERFYDGHLLESETYVGGHVESLEAGVFRSDIKNHFNIDPEVIDDLLEDLPHA
FT                   LKFCVEVENNCKVEDVVNFEEVRQAVEKRLFDLKDNTKRHELPLIYHVDVASMYPNIMI
FT                   TNRLQPDSVKSDRDCASCDFNRPGKSCDRKLQWSWRGEFFPSKMDEYNMVKRALQNETF
FT                   PNKNKKSYKQFLSFEELSYSDQVAHIKKRLTDYCKKVYHRVKTNEVVERTAIICQRENP
FT                   FYVNTVRSFRDRRYEFKGLAKNWKQKHSSISSEQKHERDEAKKMVILYDSLQLAHKVIL
FT                   NSFYGYVMRKGSRWYSMEMAGITCLTGATIIQMARSIVEKIGRPLELDTDGIWCIIPES
FT                   FPDEFKFNLKNGKKLFLSYPCSMLNYKVHQKFTNHQYQTLVDPVRHKYETESDNSIFFE
FT                   VDGPYRAMVLPTSKEEGKGIKKRYAVFNNDGSLAELKGFELKRRGELQLIKNFQSDIFK
FT                   VFLEGDSLEACYASVAAVANRWLDVLDSKGIMLEDEDLIELICENRSMTKTLKEYEGQK
FT                   STSITTAKRLGEFLGEEMVKDKGLQCKYIISSRPLNTPVTERAIPVAIFSADLALKRSF
FT                   LRRWLADSSLENFDPRAIIDWDYYRERLASVVQKIITIPAALQSIQNPVPRVEHPDWLK
FT                   KRISVNDDKFKQTSLTSFFKSSKVKPLVRDIEDAFEERPISIQNKVGRVTSKKHQKRKN
FT                   MIEEEQENLVLPPTFPSMEEDYIGWLSYQKIKWKIQARDKQRRTQLFGSRSGISERTAL
FT                   GNIMRKHAESYANSTWEILEYRQTSQPGVLDVSVLLDRKIHTLKFKIPKSIYMKFKTNQ
FT                   PSGHGIENCIVEKSPAILPYKSVGSESKTPLYKLTLPEDDYLEEIEKTTSVLNKENVLG
FT                   IYESSITASERAIMELGSAVEFTSSAIGALGKGLQKGFEQKNLHPSSSQRYLEKFSLEV
FT                   GYLLHLSTNIGYEYFILYKGWDANTEVFVLKPSTNAQELNPSSVQSLFKELRAQKSDKL
FT                   DSHYDILRYPDSIDVQSHSFTDLRALYKKLSKSISQMNEEKGAQCLMLLQSPYTQKLRQ
FT                   TIKPFRQMPLVEISSAELALPHLKWQHIVTKKITNHILSLGKWLQNLMNLSRYSNIPIC
FT                   NIRLEKMSFVIDVMYARRLKKDNIVLWWNDVYPLPDHGGSEKDFNPSMASLMSDLDISI
FT                   TNSPSVYDTVVLEIEMSNLTINTVLTSAVINEAEGSDLAESNFSIGGEGEYIGGGALVE
FT                   DSFSGVSLSVLRALLKSLWDDALDENETADSLVHAFIHWVQSADSKLFDYALKYHVHNL
FT                   TKKAILQLVNVCKNLGSEAIYADRGKLLLKTNKVTVESCYAYSQYLIKAIRTAPLFSFL
FT                   DLSITRYWDLLIWMDSFNFGGRACTSIVDSESQDLRAYSQWHIKSFLPRIYQQEFDDWM
FT                   IIILDSMVKAKERHYFDNAQSQRLTQITTGKSNDDEEVDGVLAGFTHRFGQPLIHRVQK
FT                   LFKTQKEYILDPNFSADYAPPNLPGSHLKTHNPLLELVKNLCHIMMLSKTQTLEVRSLR
FT                   KELLKIFEVREFDWESEFKDPSYSLKVSNLACEHCAFITDIDFCKVERKEFLVCEQCQR
FT                   LFNNNLLQEHLVQTLQIELQNYYVQDLKCAKCGKIKDELMSSHCPCSGSWINSISEEAL
FT                   NKKIIVYRRVAEYFAFDIVSATVDELDGSSF"
FT   gene            <233389..>234804
FT                   /locus_tag="KLTH0F02662g"
FT                   /old_locus_tag="KLTH-ORF7504"
FT   CDS_pept        233389..234804
FT                   /locus_tag="KLTH0F02662g"
FT                   /gene_family="HOG000000848" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7504"
FT                   /product="KLTH0F02662p"
FT                   /note="similar to uniprot|P50874 Saccharomyces cerevisiae
FT                   YNL261W ORC5 Subunit of the origin recognition complex
FT                   which directs DNA replication by binding to replication
FT                   origins and is also involved in transcriptional silencing"
FT                   /db_xref="GOA:C5DK89"
FT                   /db_xref="InterPro:IPR020796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK89"
FT                   /protein_id="CAR23890.1"
FT                   /translation="MVINVPSVKFRDYQVDAVSSFVSEDPSFAPPNVVIQGHHSSGKTL
FT                   TMRKFFEYNPQIYNCWLNPIELVSWKPLLQHVARMISSTLANLFPDISCEEQDALEAED
FT                   FYLLIKFLHAVLRSYQLLEKDISLFVVFDGFDQLQELDSELLPKFIKLHELLPPNLRVQ
FT                   LKFIYIVHDTAFLSRYSTYNLPTIIFPRYKHEQVAEILLQKKVSEYIESEKLLCKVVSC
FT                   GLDPEDSTFEQIAENYIKIIIQAFHSYTGNDIVALGDLMDSKWESYVQSITAENINEPL
FT                   SLYRSNIDLYTTTGDTFVAEEEACVETGDSERATAYELSCISKFLLIAAYLCSYLEPRY
FT                   DSKIFSKKSHLRAGRSSYGRRAKMETNPRYLQPSLFPLERLFSIFQAIFPVEEQENHSI
FT                   FHHTEPMRANVEVYENLAELNSLKLITTATPKNVDYLSYKLKWKVNVPWEIITELASSV
FT                   NFDIADYFSGLHY"
FT   gene            <234959..>236029
FT                   /locus_tag="KLTH0F02684g"
FT                   /old_locus_tag="KLTH-ORF7503"
FT   CDS_pept        234959..236029
FT                   /locus_tag="KLTH0F02684g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7503"
FT                   /product="KLTH0F02684p"
FT                   /note="weakly similar to uniprot|P38852 Saccharomyces
FT                   cerevisiae YHR156C LIN1 Nuclear protein that physically
FT                   interacts with Irr1p a component of the cohesin complex may
FT                   link together proteins involved in chromosome segregation
FT                   mRNA splicing and DNA replication"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK90"
FT                   /protein_id="CAR23891.1"
FT                   /translation="MNNDHDGSSDNEAIKEEGFVRKKRKLTVSSDLYDDDSSDNESDDE
FT                   DEGLKTDPSAKITDTAIDNRDQGEDDMFASDSEGTSMNQKNSSEHLPNGNARKWDDKQN
FT                   DVASNGGVQIEAFNLDEESRTGAFDQFGNYTENPSRGDESEAQDYWLDGYNNEGLIQQV
FT                   RAAQKERLKREKLERSKALDQKRVLTLDGALKRLFFFLSADETTLEALGRLNSYRRLFG
FT                   KKTKYPRYEAREGDDSQELRELKIKHTVSAIEFVTDLLDIIERKGITDVYELTRSKVET
FT                   LIKEESLDNQDLDNYETKLWSFKWLTDLATVNESYTNYEMQCWKQEYFADNVIVKFVED
FT                   GDEIRNWIYIECLHFM"
FT   gene            complement(<236068..>236556)
FT                   /locus_tag="KLTH0F02706g"
FT                   /old_locus_tag="KLTH-ORF7502"
FT   CDS_pept        complement(236068..236556)
FT                   /locus_tag="KLTH0F02706g"
FT                   /gene_family="HOG000057111" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7502"
FT                   /product="KLTH0F02706p"
FT                   /note="similar to uniprot|P53846 Saccharomyces cerevisiae
FT                   YNL260C Protein required for cell viability"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK91"
FT                   /protein_id="CAR23892.1"
FT                   /translation="MDFDETLDLEEQFYRDGFEEGRHENLTHNYLEGKQYGLQVGFQRY
FT                   ILIGLIEGVCNAVKSQNVSSAAQKNACLILDMVNKISMGNDEVSVQTYETNIVKIRNKF
FT                   RLLLLALSRYVKEQDSLPSLGLSFQSVEKISKIVAGELSSYVESDAAEVSSQPQNEMW"
FT   gene            complement(<236844..>237065)
FT                   /locus_tag="KLTH0F02728g"
FT                   /old_locus_tag="Klth0F.mRNA.gf.350.m"
FT   CDS_pept        complement(236844..237065)
FT                   /locus_tag="KLTH0F02728g"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0F.mRNA.gf.350.m"
FT                   /product="KLTH0F02728p"
FT                   /note="highly similar to uniprot|P38636 Saccharomyces
FT                   cerevisiae YNL259C ATX1 Cytosolic copper metallochaperone
FT                   that transports copper to the secretory vesicle copper
FT                   transporter Ccc2p for eventual insertion into Fet3p, which
FT                   is a multicopper oxidase"
FT                   /db_xref="GOA:C5DK92"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK92"
FT                   /protein_id="CAR23893.1"
FT                   /translation="MSTQNHYHFNVVMSCEGCSNAIRRVLTRLEPDVSKIDISLEKQTV
FT                   DVYTVLPFETILEKIKKTGKEVKSAKKL"
FT   gene            complement(<237265..>239487)
FT                   /locus_tag="KLTH0F02750g"
FT                   /old_locus_tag="KLTH-ORF7501"
FT   CDS_pept        complement(237265..239487)
FT                   /locus_tag="KLTH0F02750g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF7501"
FT                   /product="KLTH0F02750p"
FT                   /note="similar to uniprot|P53847 Saccharomyces cerevisiae
FT                   YNL258C DSL1 Endoplasmic reticulum (ER)-localized
FT                   peripheral membrane protein required for Golgi-to-ER
FT                   retrograde traffic component of the ER target site that
FT                   interacts with coatomer the major component of the COPI
FT                   vesicle protein coat"
FT                   /db_xref="InterPro:IPR021875"
FT                   /db_xref="InterPro:IPR021876"
FT                   /db_xref="UniProtKB/TrEMBL:C5DK93"
FT                   /protein_id="CAR23894.1"
FT                   /translation="MAQACGIIDQELHCISQQLKRILNDQDAILAGIESDPNLKMEGSA
FT                   RREEPSDVQAILNQDVQLSKKLGALKELNLVANLIDEFKANFELWELENCYYSLQNLHK
FT                   RLEKVDMSLFPIQFQGLLKVHIDSLHVDLLSRIDKVMRQFWDISARSVTFNQKIAVDRD
FT                   DVLLEYDSFSLFLKSCFFSQDHFEPTSWFVATMNMGDAKDKVTNLLATAFNEWVRLQTV
FT                   QEKLKQFLFSANVCLSLKGCTLGASENPGNLDDTLKSFEALVMFMKDVTTAEDTAVILA
FT                   KLGNTLLTEIVKFVKQNSSHLFAPGTNYKNSVVSLNTMLTELSHKGGKSWQYAGRELDN
FT                   LINDDSVINNLMLDKLLQEQISAIRKQFASGDWKNKRAIKVKARKTSLSVLSGERSKAH
FT                   KTGTGTSDDEWAWDHDNVSAEVGEDEDGWGSETEIALDSKEAHDPIVLSKKDAEGENDW
FT                   QNAWDEAASLGDDFDDTMKVTQVPDLFKQIFTDFEAGCEKIGQNKISAVVDYKRNVLLT
FT                   SFMAMCMCRYEEWWQLYHDVDFILSESADARKLYRLHELNSHFVNTHVENLKKTARKIM
FT                   GQQLQNFQASDKSPNWGITIESLLPYIETAALPALLKLRNPRILSGFLEYLYADCLVNE
FT                   ILSWRMISEKNSENLAELINLLLTGTDVRQVETDPKIVHSREKLEIIGRVLTAHLTDIM
FT                   DMFSNGDFYLFSTDEVVQWIVMLFADTGLRRECIDEIRTIREEQGT"
FT   gene            complement(<240125..>240218)