(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_7

ID   LACTH_7; SV 1; linear; genomic DNA; STD; FUN; 1720065 BP.
XX
AC   CU928171;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome G complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1720065
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1720065
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1720065
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="G"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0G"
FT                   /db_xref="taxon:381046"
FT   LTR             2467..2880
FT                   /locus_tag="KLTH0G00110t"
FT                   /old_locus_tag="Klth0G.LTR.1"
FT   gene            complement(<2815..>4154)
FT                   /pseudo
FT                   /locus_tag="KLTH0G00132g"
FT                   /note="no similarity"
FT   gene            <5908..>7284
FT                   /locus_tag="KLTH0G00198g"
FT                   /old_locus_tag="KLTH-ORF5091"
FT   CDS_pept        5908..7284
FT                   /locus_tag="KLTH0G00198g"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5091"
FT                   /product="KLTH0G00198p"
FT                   /note="similar to uniprot|P38731 Saccharomyces cerevisiae
FT                   YHL040C ARN1 Transporter member of the ARN family of
FT                   transporters that specifically recognize siderophore-iron
FT                   chelates responsible for uptake of iron bound to ferrirubin
FT                   ferrirhodin and related siderophores"
FT                   /db_xref="GOA:C5DLF7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLF7"
FT                   /protein_id="CAR24618.1"
FT                   /translation="MQLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGA
FT                   VLYNVGFCCVNIVLLVVMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWS
FT                   WGIGFWAFSFPLASLPFICCMVYMIYTTRKSDQWKLFNQEKPLNEAKLLTRVMRIFHQV
FT                   DFIGTLIFSVALGCVLVPLTLAGGYSSKWSHSDSIVPLVVGSVLFVFYIVWESFMASYP
FT                   ALPFKLLKDRGIWIPILAGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVT
FT                   TVASPFFAVLLRWTGRLKWYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGLGR
FT                   TFTQFPLLTTMQARAPHTKMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLG
FT                   SNGLATAAYASPYTFIISYPWGTSERLAVVLAYKNVQKDTPLKSKIDNDAEIEMTTSEV
FT                   "
FT   LTR             complement(7541..7756)
FT                   /locus_tag="KLTH0G00220t"
FT                   /old_locus_tag="Klth0G.LTR.2"
FT   mobile_element  complement(8030..11474)
FT                   /mobile_element_type="transposon"
FT                   /locus_tag="KLTH0G00242s"
FT                   /old_locus_tag="dnatranposon.5"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            <13142..>14021
FT                   /pseudo
FT                   /locus_tag="KLTH0G00264g"
FT                   /old_locus_tag="pseudo-Klth0G-13142-14021"
FT   LTR             16301..16565
FT                   /locus_tag="KLTH0G00286t"
FT                   /old_locus_tag="Klth0G.LTR.3"
FT   gene            complement(<16891..>16963)
FT                   /locus_tag="KLTH0G00308r"
FT                   /old_locus_tag="Klth0G.tLys.CTT.33"
FT   tRNA            complement(16891..16963)
FT                   /locus_tag="KLTH0G00308r"
FT                   /old_locus_tag="Klth0G.tLys.CTT.33"
FT                   /note="tRNA-Lys (CTT) cove score=77.79"
FT   gene            <18023..>18096
FT                   /locus_tag="KLTH0G00330r"
FT                   /old_locus_tag="Klth0G.tIle.AAT.1"
FT   tRNA            18023..18096
FT                   /locus_tag="KLTH0G00330r"
FT                   /old_locus_tag="Klth0G.tIle.AAT.1"
FT                   /note="tRNA-Ile (AAT) cove score=71.40"
FT   LTR             18839..19255
FT                   /locus_tag="KLTH0G00352t"
FT                   /old_locus_tag="Klth0G.LTR.4"
FT   gene            <20341..>20422
FT                   /locus_tag="KLTH0G00374r"
FT                   /old_locus_tag="Klth0G.tSer.AGA.2"
FT   tRNA            20341..20422
FT                   /locus_tag="KLTH0G00374r"
FT                   /old_locus_tag="Klth0G.tSer.AGA.2"
FT                   /note="tRNA-Ser (AGA) cove score=80.04"
FT   gene            complement(<21210..>22325)
FT                   /locus_tag="KLTH0G00396g"
FT                   /old_locus_tag="KLTH-ORF5071"
FT   CDS_pept        complement(21210..22325)
FT                   /locus_tag="KLTH0G00396g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5071"
FT                   /product="KLTH0G00396p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLF8"
FT                   /protein_id="CAR24619.1"
FT                   /translation="MELISSRYSVVDGFLIASQQNGTKVIIDHETCCLSLNKAEKDLIS
FT                   AKKLRDLSRYRKSKSKLVACESQLLFEIVTAAPQVFIQNSNYTREANKGNNIKYTQSLL
FT                   VIPAFFFSDVKKYFFFSQGSKGLQFQTGDTPTRPLVEEREDLFTNLELKKPKFSIHDLD
FT                   VLRCYKIDQDLYAQECFSLLSFFQTKTKMSSQDVLTLETALPIFDKNLKNFDLDHCIMN
FT                   KITDTVALLHFVLVNIGIFSFGHSPFLGKLSGAPIRSRIGRSYNLEVKSRYLGKLFQSD
FT                   IQSYEMDGLICLLLQILAFRTDEYSDPSQILEVREAGDFCNRLAALIIWIGYAVFAESA
FT                   DSVISSANCKHNSSLKSLIRVYQKVKAQCDT"
FT   gene            complement(<23130..>24836)
FT                   /locus_tag="KLTH0G00418g"
FT                   /old_locus_tag="KLTH-ORF5069"
FT   CDS_pept        complement(23130..24836)
FT                   /locus_tag="KLTH0G00418g"
FT                   /gene_family="HOG000193384" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5069"
FT                   /product="KLTH0G00418p"
FT                   /note="similar to uniprot|Q12198 Saccharomyces cerevisiae
FT                   YLL058W Hypothetical ORF"
FT                   /db_xref="GOA:C5DLF9"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLF9"
FT                   /protein_id="CAR24620.1"
FT                   /translation="MTEIEFGQPLPSNLEYAVSFGIPTWESAIGYVEKNPDYISKMVTG
FT                   YPRYFPQPAIQKLCDHFLQKFGEGSEGCRPFPSAKSASNCLEYVKSVSGPQSKARMEVE
FT                   TFYLNDNGKDAGEDSYQLAITIAAIFASEDELETVKEYWKLTGECVSSRLAVFVNKFLE
FT                   KLPADSKLSQNETGTDIQLLKRTGEEAKVLLRNRIANNHCNPFGEKREVVDKRPILDAT
FT                   KDVYLVSSGMSAVFTARKLLTHWEKNKNRKPLSHKNRDFHDKQHPVCETAAVFGFPFKD
FT                   TKVIMEKFGKCQFFGFGDSRDLAGLRSLLKGGKERILGVFLETPSNPMLNMPDLKQLRN
FT                   MANEYGFFIVVDDTIGGLNVDVLPYADIVCTSLTKLFSGSSNVMGGSIILNPKSALYSC
FT                   ALQYFRGGEFEELLWLEDAIILEANSRDFEERTTRTNENTMKLIQEVLLPEEGKIFKKV
FT                   YYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEEDAKKFYNSLTVFKGPSNGTNFTL
FT                   ACPYVHLAHHFELEEVSTFGAHSSLVRVSVGLENTQWLLNAFSSVINLLRK"
FT   gene            <28632..>30089
FT                   /locus_tag="KLTH0G00440g"
FT                   /old_locus_tag="KLTH-ORF5063"
FT   CDS_pept        28632..30089
FT                   /locus_tag="KLTH0G00440g"
FT                   /gene_family="HOG000162670" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5063"
FT                   /product="KLTH0G00440p"
FT                   /note="similar to uniprot|P04807 Saccharomyces cerevisiae
FT                   YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
FT                   phosphorylation of glucose in the cytosol predominate
FT                   hexokinase during growth on glucose functions in the
FT                   nucleus to repress expression of HXK1 and GLK1 and to
FT                   induce expression of its own gene"
FT                   /db_xref="GOA:C5DLG0"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG0"
FT                   /protein_id="CAR24621.1"
FT                   /translation="MVHLGPKKPPMRKGSMIDVPKNLMEQIQSLEEQFTVSGEKLKEVT
FT                   KHFVGELNKGLSKKGGNIPMIPGWVMEFPTGQETGDYLAIDLGGTNLRVVLVRLLGNHK
FT                   FDTTQSKYKLPDHIRTSSSEELFSFIADSLKTFVDEEFPEGVTEPLPLGFTFSYPCSQD
FT                   KVNEGFLQRWTKGFDIEGVEGEDVVPMLQEQLVKRKIPIDVVALINDTTGTLVASMYTD
FT                   AETRMGCIFGTGVNGAYFDVVSDIEKLEGRLPSDITSDLPMAINCEYGSFDNELVVLPR
FT                   TKYDIIVDKQSPRPGQQSFEKMTSGYYLGELLRLILLDLQQQGLIFEGQDLTKLQKPYV
FT                   MDTSYPARIEEDPFENLEDTYDIFKNELGVETTGGERKLIRRACELIGTRASRMSMCGI
FT                   GAVCTKRGYKTAHIAADGSVFNKYPEFKERAAAGLRDIFDWEPRQNIEEYPIVIVAAED
FT                   GSGAGAAIIAALTQKRLAAGKSVGVAK"
FT   gene            complement(<30407..>31204)
FT                   /locus_tag="KLTH0G00462g"
FT                   /old_locus_tag="KLTH-ORF5060"
FT   CDS_pept        complement(30407..31204)
FT                   /locus_tag="KLTH0G00462g"
FT                   /gene_family="HOG000196008" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5060"
FT                   /product="KLTH0G00462p"
FT                   /note="similar to uniprot|P32496 Saccharomyces cerevisiae
FT                   YFR052W RPN12 Subunit of the 19S regulatory particle of the
FT                   26S proteasome lid synthetically lethal with RPT1 which is
FT                   an ATPase component of the 19S regulatory particle
FT                   physically interacts with Nob1p and Rpn3p"
FT                   /db_xref="GOA:C5DLG1"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="InterPro:IPR006746"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG1"
FT                   /protein_id="CAR24622.1"
FT                   /translation="MPTLLELVKSLNTAFVNGDNSSCQKLLSPVKIELIKSHLLVPDFS
FT                   KAQENERYLEDLNVAKRVLEIGALCSLRNADFEAYENFFSQLRVFYFSGIPRLAESENK
FT                   SKLISLYLLLLLSQGDVTKFHSELEFLGKRLGSLEEDAFLSYPIKVEKWLMEGSYQRAW
FT                   DLLKSESKIEEFNVFTQTLMDAIREEIGRNTELAYHKLPLFNVKALLFFESEKDTEQFA
FT                   LARGWKVSGGCIVFDEEEVADDHHQTSIVEKALDYAINLESIV"
FT   gene            complement(<32295..>34040)
FT                   /locus_tag="KLTH0G00484g"
FT                   /old_locus_tag="KLTH-ORF5058"
FT   CDS_pept        complement(32295..34040)
FT                   /locus_tag="KLTH0G00484g"
FT                   /gene_family="HOG000215243" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5058"
FT                   /product="KLTH0G00484p"
FT                   /note="highly similar to uniprot|P32608 Saccharomyces
FT                   cerevisiae YGL252C RTG2 Sensor of mitochondrial dysfunction
FT                   regulates the subcellular location of Rtg1p and Rtg3p
FT                   transcriptional activators of the retrograde (RTG) and TOR
FT                   pathways Rtg2p is inhibited by the phosphorylated form of
FT                   Mks1p"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG2"
FT                   /protein_id="CAR24623.1"
FT                   /translation="MSAISDSDSETEVVSRNLCGVVDIGSNGIRFSISSKASHHARIMP
FT                   CVFKDRIGISLFEVQYAANSLDKAPIPEDTIKEVSAAMKRFKLICDDFGVPETGVRVVA
FT                   TEATREAINSKEFISAVFESTEWEVELLTKEEEGKIGAYGVISSFNSVSGLYMDLGGGS
FT                   TQISWISCIDGQIKMSDTPVSLPYGAGALSRRMKLEDKRELFLEIKEAYKNAISKIDIP
FT                   QEMIEEARQKGGFDLFTCGGGLRGMGHLLLSKIKEYPIQTIINGFSCSFEEFSSVADYL
FT                   FLKGSLPGPKKIFKVSERRAQQLPAVGLLMSAAFESLPQVKTVHFSEGGVREGTLYSIL
FT                   PREIRAQDPLHVATRPYAPLLAPKYLELLRAAIPEKDVPKIVYSRIAPALCNLAFVHAS
FT                   YPKELQPTAALHVATTGIIAGCHGLSHRARALIGIALCNRWGGDVPEQELEHKKLLEDV
FT                   VLRDGNKVERERIVWWTQYIGTIMYVICGVHPGGNIRDGLFNFNIEQKGDSDKELQNLS
FT                   LDERIASSNSKKREFEVIVRISKDDLKTSASVRARIITLQKKIRKLSRGSSEKVKIGVQ
FT                   FYEDA"
FT   gene            <35079..>36386
FT                   /locus_tag="KLTH0G00506g"
FT                   /old_locus_tag="KLTH-ORF5057"
FT   CDS_pept        35079..36386
FT                   /locus_tag="KLTH0G00506g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5057"
FT                   /product="KLTH0G00506p"
FT                   /note="weakly similar to uniprot|P53060 Saccharomyces
FT                   cerevisiae YGL250W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR018822"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG3"
FT                   /protein_id="CAR24624.1"
FT                   /translation="MVEASDSPAVVSETEVSLKKAPEVIVGSSRSHAEALSTFEKKQRA
FT                   MDGPQKSPEGSRHQSPEPNYFSLQSPEPHSEREVTVDNDDSSKINGEERSKLKQGYQSD
FT                   DDNDSIIDIVSESEVYEAAKQLLSSKPPQIRVNYQGESYLLLGEYDGDNAKEWSSDKII
FT                   CTDSADLHRGCNVAFGRMRLFFQQVHGGLELLSKELSFEFPDLDLVMEEDNMYNKDITV
FT                   NDVVSIFKIIKDNSIKKCEPDVSNHLTINVSTKPRFVSRYNSLVEMLNGDATFSNIKVF
FT                   TNDRSHPVVLDESEQTPNSKDAEVIIMSSEGEEADENEEADDNEADDDETGGEKVNDEE
FT                   AGDEEPRKIELDGMERDGKESFGVHRDGLTPGNGTSVSNPAVLSEELGQHNAFSPKRGA
FT                   EKPEHSGIQMAEVDNSESGDSLKRRRDSVSDGDLFV"
FT   gene            <36584..>38485
FT                   /locus_tag="KLTH0G00528g"
FT                   /old_locus_tag="KLTH-ORF5055"
FT   CDS_pept        36584..38485
FT                   /locus_tag="KLTH0G00528g"
FT                   /gene_family="HOG000203984" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5055"
FT                   /product="KLTH0G00528p"
FT                   /note="similar to uniprot|P43621 Saccharomyces cerevisiae
FT                   YFR051C RET2 Delta subunit of the coatomer complex (COPI)
FT                   which coats Golgi-derived transport vesicles involved in
FT                   retrograde transport between Golgi and ER"
FT                   /db_xref="GOA:C5DLG4"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG4"
FT                   /protein_id="CAR24625.1"
FT                   /translation="MVEKPAQESAFRKKRDHQKDRHTPQLARRVSLVLRAESCTFSDFI
FT                   YSHSFAESGSLLFLACYTSLHTRNIYFLNKPKGTHIRQNSQLIVLRFSKHKMVVIAVSI
FT                   VTRQGKPLLSRQFRDISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYKPFDDYYI
FT                   ILITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVITMGYKENL
FT                   SISQINTYLSMESHEEKIQEIIERNKEFEAAEERKRRAKEISRKEQERKMGVSPMGLDA
FT                   TRFQASNDPNISNAYNSYYSQASAAAQQSYLQSQQKAVSPEQVASIGTEVSSSLGLGGR
FT                   GMKLGRKKSLGSHLQPTKQAPAPAASFQIEESEKPANNGILVCVKEVVSAEISREGNVS
FT                   SSELKGSLELRVNDKNLAHAIIRLASHVDVKDKAFQFKTHPNIDKNMFLSSGVVGLRDQ
FT                   KKAFPFNDQSLAVLRWRKVGGADDNSLVPMGVSSWVSPSDSNTGMFDVTLEIEMNENYE
FT                   NPLNDVRFCIPVYTENVHINDDFNDLGASIESVDDENGIIVKIETIAPGTTAAVGLALE
FT                   AEYEDALFPMTVHFSNHAALSSFSKVEVADVISTSEEASQLQFDTISSIRTDDYTIT"
FT   gene            <38715..>39512
FT                   /locus_tag="KLTH0G00550g"
FT                   /old_locus_tag="KLTH-ORF5052"
FT   CDS_pept        38715..39512
FT                   /locus_tag="KLTH0G00550g"
FT                   /gene_family="HOG000181719" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5052"
FT                   /product="KLTH0G00550p"
FT                   /note="highly similar to uniprot|P30657 Saccharomyces
FT                   cerevisiae YFR050C PRE4 20S proteasome beta-type subunit"
FT                   /db_xref="GOA:C5DLG5"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG5"
FT                   /protein_id="CAR24626.1"
FT                   /translation="MNHDPLQWGRPSDEHYGTYNKSIASASPYPSMHTQQPIVTGTSVI
FT                   SMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISGDISDMQHLENLLDEMQ
FT                   TENNYDNEYAEDEEALKPSYVFEYLANVMYNRRSKMNPLWNALIVAGLEDGKPFLKYVN
FT                   LLGVTYSAPSLATGFGAHLALPLLRKIVDSESDVKKTSAEDAEKSIKEAMKVLFYRDAR
FT                   SSRNYSIAIVDSKKGLVLNKDAVVEDMVWGFAKDIKGYGTQNV"
FT   gene            <40280..>41368
FT                   /locus_tag="KLTH0G00572g"
FT                   /old_locus_tag="KLTH-ORF5050"
FT   CDS_pept        40280..41368
FT                   /locus_tag="KLTH0G00572g"
FT                   /gene_family="HOG000248334" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5050"
FT                   /product="KLTH0G00572p"
FT                   /note="similar to uniprot|P22434 Saccharomyces cerevisiae
FT                   YGL248W PDE1 Low-affinity cyclic AMP phosphodiesterase
FT                   controls glucose and intracellular acidification-induced
FT                   cAMP signaling target of the cAMP- protein kinase A (PKA)
FT                   pathway glucose induces transcription and inhibits
FT                   translation"
FT                   /db_xref="GOA:C5DLG6"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG6"
FT                   /protein_id="CAR24627.1"
FT                   /translation="MSAFEINILGASGGPLDGGNQGILLSKAGSDALKKYICIDAGSGL
FT                   RQITSMLIKNAKMKNARQEFLCQDDMTESLFENLEEPVGCFVDKSSSIMRGLGPSATPQ
FT                   DGESVMTLALRIFNKVEECYITHPHLDHVAALAINTPACNSNGKSIWGLRPTVEALKKH
FT                   IFNDVIWPNLLEEPRMKLRVNSLDEAQRHRVSCIPNWFITPLRLMHGVTVHGSNPCPST
FT                   AYLVEDDTTKDAILVFGDLESDLISRRRFVSNIWRHLSKTVAFEKLKAIVIECSCPNAT
FT                   KDEHLFGHLSPKYLVHELKSLSKVYGRPLDGLHVIIVHVKMASGGRDPRLVILDEVRQL
FT                   AAAEGLGKIVISIAIEGYTFVV"
FT   gene            complement(<41445..>41825)
FT                   /locus_tag="KLTH0G00594g"
FT                   /old_locus_tag="KLTH-ORF5047"
FT   CDS_pept        complement(41445..41825)
FT                   /locus_tag="KLTH0G00594g"
FT                   /gene_family="HOG000182011" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5047"
FT                   /product="KLTH0G00594p"
FT                   /note="similar to uniprot|P19955 Saccharomyces cerevisiae
FT                   YFR049W"
FT                   /db_xref="InterPro:IPR020373"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG7"
FT                   /protein_id="CAR24628.1"
FT                   /translation="MRQTVVRLAKSYTPMIKFVGARHPVVQHTGGAGAHACALDGIAPG
FT                   SSQCLPAAEYLSKLKPFEVVSYKVKNTPKKGVSETDKRRLTFTDRALHENEVASVLDLP
FT                   KRFRVRPLEDPEIDVINAGGAR"
FT   gene            <42539..>43120
FT                   /locus_tag="KLTH0G00616g"
FT                   /old_locus_tag="KLTH-ORF5045"
FT   CDS_pept        42539..43120
FT                   /locus_tag="KLTH0G00616g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5045"
FT                   /product="KLTH0G00616p"
FT                   /note="similar to uniprot|P53062 Saccharomyces cerevisiae
FT                   YGL247W BRR6 Essential nuclear envelope integral membrane
FT                   protein required for nuclear transport depletion alters
FT                   nucleoporin distribution and nuclear envelope morphology
FT                   suggesting a role in the spatial organization of nuclear
FT                   pores"
FT                   /db_xref="GOA:C5DLG8"
FT                   /db_xref="InterPro:IPR018767"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG8"
FT                   /protein_id="CAR24629.1"
FT                   /translation="MYDQLVTSQKKRSVSSAASSSKESKRHWSDPKTLAAYIQLFVNTV
FT                   IISGLLYLCVRFLRLVNRDVECKFRNKVALAAKAALECRANYETNRCEPEERAPALEAQ
FT                   CAEWAHCMSRSQELWDLQHSAVLWAETLAEIINGFFKPISIKSLIILLTFTFGVIIVSN
FT                   IAFGSYRVHYYGALNSPQNSDLSSRGPRPL"
FT   gene            <43280..>44221
FT                   /locus_tag="KLTH0G00638g"
FT                   /old_locus_tag="KLTH-ORF5044"
FT   CDS_pept        43280..44221
FT                   /locus_tag="KLTH0G00638g"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5044"
FT                   /product="KLTH0G00638p"
FT                   /note="similar to uniprot|Q07551 Saccharomyces cerevisiae
FT                   YDL124W NADPH-dependent alpha-keto amide reductase reduces
FT                   aromatic alpha-keto amides aliphatic alpha-keto esters and
FT                   aromatic alpha-keto esters"
FT                   /db_xref="GOA:C5DLG9"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLG9"
FT                   /protein_id="CAR24630.1"
FT                   /translation="MVADIPTVELKGSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQEL
FT                   ADQVSNAIKAGFNHIDAAEAYKTHPEVGAGIANSGVPREKLWVTDKYTPWSWTWRKGKG
FT                   PLESLELSLGKMQMQYVDLYLVHVPFINPETAGIDLKEAWRQMEEIYDRGWAKNIGVSN
FT                   FDVESLEYIRTIGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGK
FT                   PGPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSED
FT                   FTSITEVGKTKIFRNFMTDLYGKYDSILYKDL"
FT   gene            complement(<44243..>45394)
FT                   /locus_tag="KLTH0G00660g"
FT                   /old_locus_tag="KLTH-ORF5042"
FT   CDS_pept        complement(44243..45394)
FT                   /locus_tag="KLTH0G00660g"
FT                   /gene_family="HOG000200647" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5042"
FT                   /product="KLTH0G00660p"
FT                   /note="highly similar to uniprot|P53063 Saccharomyces
FT                   cerevisiae YGL246C RAI1 Nuclear protein that binds to and
FT                   stabilizes the exoribonuclease Rat1p required for pre-rRNA
FT                   processing"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH0"
FT                   /protein_id="CAR24631.1"
FT                   /translation="MGLSADLFVQKRSAASSLKQPKELGFYSKTQEGQFLVNDSSKLSY
FT                   YYLPDTELERNLDLCSGIKKFKECFGNPDVDACTLSGLLKTIQAYEERKNKKVPADIIT
FT                   FRGIMRKLISAAFDSPKYNRVDLRVLSFNGQLFIREPNQAHPPPANTSSMEYRSYYSGY
FT                   KFETLSTISKPLPQVTRNSLEKRHKRICCNGDQYITVVRSGVGHCKLVLGAEVDCVFDF
FT                   TEDSSDNLKHYAELKCTKGVSTFAEARAFERKMFKTWLQCFLVGINRVIYGFRDENFIL
FT                   RSVEEYSTQEVPLLLKNNNPQLTNACMDAVRWYGALTEWLLSSIPREESAEHIRAYRLT
FT                   FENNHLKLVEIEKSDTEYDQLVNGEGILTSEFREWRKSLNKSL"
FT   gene            <45680..>47794
FT                   /locus_tag="KLTH0G00682g"
FT                   /old_locus_tag="KLTH-ORF5041"
FT   CDS_pept        45680..47794
FT                   /locus_tag="KLTH0G00682g"
FT                   /gene_family="HOG000259234" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5041"
FT                   /product="KLTH0G00682p"
FT                   /note="highly similar to uniprot|P46655 Saccharomyces
FT                   cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
FT                   forms a complex with methionyl-tRNA synthetase (Mes1p) and
FT                   Arc1p complex formation increases the catalytic efficiency
FT                   of both tRNA synthetases and ensures their correct
FT                   localization to the cytoplasm"
FT                   /db_xref="GOA:C5DLH1"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH1"
FT                   /protein_id="CAR24632.1"
FT                   /translation="MAKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPA
FT                   TFEDSCDDVLKRIVQTYPEVFKHGFENCDEWAKLASEELTVKNFQKLSVSLAKLDACLN
FT                   FRTFILGGTTFSAADIACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEF
FT                   LVKTLQELKKASTSNKKKETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAIL
FT                   NQYFAQEYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDL
FT                   CVKMIEEGNAYCDDTPTDKMREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNC
FT                   VRAKIDYKALNKTLRDPVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRT
FT                   IEYRDRNAQYQWMLDALHLRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRF
FT                   PTVRGVRRRGMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPV
FT                   KFHVEGAPQTPDVQIKLKHKKNPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGN
FT                   AIVTKKNADGSLTGKLHLEGDFKKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGE
FT                   DFADYLTPQTEFHVSAVADLNVKDMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDG
FT                   KSVNKYGAKK"
FT   gene            complement(<47865..>49712)
FT                   /locus_tag="KLTH0G00704g"
FT                   /old_locus_tag="KLTH-ORF5039"
FT   CDS_pept        complement(47865..49712)
FT                   /locus_tag="KLTH0G00704g"
FT                   /gene_family="HOG000190628" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5039"
FT                   /product="KLTH0G00704p"
FT                   /note="similar to uniprot|P43620 Saccharomyces cerevisiae
FT                   YFR048W RMD8 Cytosolic protein required for sporulation"
FT                   /db_xref="InterPro:IPR003734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH2"
FT                   /protein_id="CAR24633.1"
FT                   /translation="MQSSLGFQEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFAGHAA
FT                   GLRGGRAAREKSDTYQGFSASSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDN
FT                   ILSDVSDVPSGRREERLSISSHEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPE
FT                   DSDRKNNALQMERRRPLKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTH
FT                   DVSPRLYDECLYVPYCLPLLPGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEY
FT                   YSGVETVEDMNNNFELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEG
FT                   RDTDQSKNISAVGNRSQNPYMESQSLENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKN
FT                   ILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTL
FT                   SHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVN
FT                   LSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAE
FT                   RNMARITWWFIAVIFVSVLVSICEIIVRSFIIRQLKNSE"
FT   gene            <49910..>51595
FT                   /locus_tag="KLTH0G00726g"
FT                   /old_locus_tag="KLTH-ORF5036"
FT   CDS_pept        49910..51595
FT                   /locus_tag="KLTH0G00726g"
FT                   /gene_family="HOG000065976" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5036"
FT                   /product="KLTH0G00726p"
FT                   /note="similar to uniprot|P53064 Saccharomyces cerevisiae
FT                   YGL244W RTF1 Subunit of the RNA polymerase II- associated
FT                   Paf1 complex directly or indirectly regulates DNA-binding
FT                   properties of Spt15p (TATA box-binding protein) and
FT                   relative activities of different TATA elements"
FT                   /db_xref="GOA:C5DLH3"
FT                   /db_xref="InterPro:IPR004343"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH3"
FT                   /protein_id="CAR24634.1"
FT                   /translation="MSDIDEDLLALAGASSGEEEEEDVQIGSSKKRSRSDHQSSSKRRI
FT                   VDEDEEQDDDEEEGEEDDYNPEAASYDMDSEEDEDEEPNPFPLEGKYKNEEDRSYLESL
FT                   PEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKRQLQQEGKKTRSSTRSTRTTG
FT                   HSDLKESRLSELKKQRAKKKGTYEYSEEEEEEGQNEEDEYGYQDQEDESEDDYEPMYKK
FT                   GKTEDEEELKWAEDEDLDREPELGDFNRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVG
FT                   VDKRSGQTLYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKNRKVFQMNFFSDGAITQP
FT                   EFERYLRSLETSEINKPSLYIINNKSNEINSFVSQPVTSKLTDELVRNRMIFNKKLSGT
FT                   NAVLEKTILKDKLQYAKESGSERDVAKYSSQLRNLEKRLSSYEKHHENDQAGSKKLGAL
FT                   TSKNRRVNLDKGKNVEVTKKEDTPFDAKTDPFSRLKTRTKIYYQEIQREENEKAKELAR
FT                   QEQLQKDDLNLVEKERKLLLAKFKNLGGLEDIISNMDFQVSLDV"
FT   gene            <51751..>52908
FT                   /locus_tag="KLTH0G00748g"
FT                   /old_locus_tag="KLTH-ORF5033"
FT   CDS_pept        51751..52908
FT                   /locus_tag="KLTH0G00748g"
FT                   /gene_family="HOG000248878" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5033"
FT                   /product="KLTH0G00748p"
FT                   /note="similar to uniprot|P53065 Saccharomyces cerevisiae
FT                   YGL243W TAD1 tRNA-specific adenosine deaminase deaminates
FT                   adenosine-37 to inosine in tRNA-Ala"
FT                   /db_xref="GOA:C5DLH4"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH4"
FT                   /protein_id="CAR24635.1"
FT                   /translation="MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVV
FT                   AINRANEDLRLVSLATGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLK
FT                   DSQSHPVPDLVSSSSDNSGIYRLNEEWSFALYISRAPCGDASMGLLYDEGCISFTDDDR
FT                   CQYVDDNNKTIIRGRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTW
FT                   DLLEAPVFLEYIVIPQLPRVAEADFERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYEN
FT                   QPPSLMSSILLNIIEGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQ
FT                   IKGGVDSQTYREFKSQQTDRNALKERIRLALSKDGWVGTESDDCG"
FT   gene            complement(<52958..>53473)
FT                   /locus_tag="KLTH0G00770g"
FT                   /old_locus_tag="KLTH-ORF5032"
FT   CDS_pept        complement(52958..53473)
FT                   /locus_tag="KLTH0G00770g"
FT                   /gene_family="HOG000210161" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5032"
FT                   /product="KLTH0G00770p"
FT                   /note="highly similar to uniprot|P53066 Saccharomyces
FT                   cerevisiae YGL242C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH5"
FT                   /protein_id="CAR24636.1"
FT                   /translation="MSDGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTAH
FT                   DPMGNSGLHLCCMYGSWDVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEHGT
FT                   FIARNLIEVGADPRIVNQAGQKPIDLVHGDELDDLIDLLQGAELAAENQGAVNEEDAEV
FT                   IDDGPDDD"
FT   gene            <53588..>56653
FT                   /locus_tag="KLTH0G00792g"
FT                   /old_locus_tag="KLTH-ORF5031"
FT   CDS_pept        53588..56653
FT                   /locus_tag="KLTH0G00792g"
FT                   /gene_family="HOG000113058" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5031"
FT                   /product="KLTH0G00792p"
FT                   /note="similar to uniprot|P53067 Saccharomyces cerevisiae
FT                   YGL241W"
FT                   /db_xref="GOA:C5DLH6"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH6"
FT                   /protein_id="CAR24637.1"
FT                   /translation="MICNSERTLAKMKEKLKEAIVGAQSTNGQVRENSENALWSLCSEN
FT                   PSATCTSLMQLACGIENAVEDRIFSLLSLRKLITMYWSAGFESYRGPPGIGDEGKRMIR
FT                   ESLLNLGLDDSQDTRLKNCSSYCIVQIAAVDFPDEWPTLVDSIFDAILQRQSLSALYVL
FT                   NEIFDDVVSEEMFFHRGIGWQTIQLIFRILSNSDSSTQAKTASAKLYQACLLQLQSPMA
FT                   TSTQDYKYALSNHIQESVLLLIKVLKEHHIAKGINTSALNLQQVLLSCLNTIKTGFSKK
FT                   LFTIESAQELIEFLFENFRKIAELCIDVTIDPDMKLAANEVGIQMVSLFATLMDTLTEN
FT                   QNWNFIVESFVIAGMISDEDAECWDNDFNVFASKETGLSTSFTVRDECEQFMQGLSGFA
FT                   YNSVFNALTSALIYNESPNWKVQESILFFIQALCGNEDDEVSFNFEKTQSLLNTLRQIL
FT                   ELEDSHILVKTRSLIALPKVIERFMETLESVKALVKDSLFHSFSLARQTPSYTVKIGCL
FT                   ISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQELLEEAEEDTPSILLEALAPTLSSNH
FT                   KTTETISFYQLALQLILKISSKHPSNIQVGLEAQDCLSNLLKSTSTEEYVTYSKTCIPL
FT                   FANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKPRDGCLPSDITSYVFNPLSDILINSS
FT                   DDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDLEKLLSAETSDSGAIHVGNLVVVVL
FT                   EKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLANVFCYLVSLNPAEVINFLSSFSID
FT                   QQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKLFFQADSRIDKIYVNGDPIPYSG
FT                   DMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTSQTDLEKYIPMSAKKTECSTIA
FT                   NAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRDEEDVIPGIKNVQQSTRELLISF
FT                   FKEAASQNINDFKTIYDNLSENEKRILSENLV"
FT   gene            <56852..>57739
FT                   /locus_tag="KLTH0G00814g"
FT                   /old_locus_tag="KLTH-ORF5029"
FT   CDS_pept        56852..57739
FT                   /locus_tag="KLTH0G00814g"
FT                   /gene_family="HOG000224023" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5029"
FT                   /product="KLTH0G00814p"
FT                   /note="highly similar to uniprot|P43619 Saccharomyces
FT                   cerevisiae YFR047C BNA6 Quinolinate phosphoribosyl
FT                   transferase required for biosynthesis of nicotinic acid
FT                   from tryptophan via kynurenine pathway"
FT                   /db_xref="GOA:C5DLH7"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH7"
FT                   /protein_id="CAR24638.1"
FT                   /translation="MPEFQHLLPASGLWRQDVTNWLQEDVPAFDFGGFVVGSDAKMATL
FT                   LCKQAGVLSGVPFAQEVFDQCQLNVEWLYKEGDFLDPASTANGKLAVAKVSGEARNILL
FT                   AERTALNLLSRCSGIATASRELVSTARKTGYQGIIAGTRKTTPGLRRLEKYSMLVGGCD
FT                   THRYDLSSMVMLKDNHIWSTGSITNAVKNARSVCGFAVKIEVECQSEEEADEAIEAGAD
FT                   VIMLDNFSGNSLKSAAQSLKQKWDGKKQFMLECSGGLKLSNISEFLCHDIDIYSTSSIH
FT                   QGTGVIDFSLKINV"
FT   gene            <58467..>59195
FT                   /locus_tag="KLTH0G00836g"
FT                   /old_locus_tag="KLTH-ORF5027"
FT   CDS_pept        58467..59195
FT                   /locus_tag="KLTH0G00836g"
FT                   /gene_family="HOG000000916" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5027"
FT                   /product="KLTH0G00836p"
FT                   /note="weakly similar to uniprot|P53068 Saccharomyces
FT                   cerevisiae YGL240W DOC1 Processivity factor required for
FT                   the ubiquitination activity of the anaphase promoting
FT                   complex (APC) mediates the activity of the APC by
FT                   contributing to substrate recognition involved in cyclin
FT                   proteolysis"
FT                   /db_xref="GOA:C5DLH8"
FT                   /db_xref="InterPro:IPR004939"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH8"
FT                   /protein_id="CAR24639.1"
FT                   /translation="MLDRWQGLVPDAEGRSFPVKPNQYLVLDDKQEDFDSNGVTYIGRP
FT                   SEEYDDEVATEAYLERYTQGLELMSSQGHIDITNLAYWKASSQKDGNPVSQALDDNPTT
FT                   FWQSDGLQPHKIEISFSKRVDIVQFALFLSLVVDESYTPQIIKIYAGHSASDATLYKTL
FT                   EVRNVNCWVALTFEDNRPEDNLLKCQYIRMIIPVNHENGKDTHLRGARIYALSLKPPVD
FT                   NSGVLDSFPMGTLLSGFSVR"
FT   gene            <59340..>62219
FT                   /locus_tag="KLTH0G00858g"
FT                   /old_locus_tag="KLTH-ORF5024"
FT   CDS_pept        59340..62219
FT                   /locus_tag="KLTH0G00858g"
FT                   /gene_family="HOG000201317" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5024"
FT                   /product="KLTH0G00858p"
FT                   /note="similar to uniprot|P33307 Saccharomyces cerevisiae
FT                   YGL238W CSE1 Nuclear envelope protein that mediates the
FT                   nuclear export of importin alpha (Srp1p) homolog of
FT                   metazoan CAS protein required for accurate chromosome
FT                   segregation"
FT                   /db_xref="GOA:C5DLH9"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR005043"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLH9"
FT                   /protein_id="CAR24640.1"
FT                   /translation="MAELESIAQLLDQSLEASTAKSAEANLKAVENQPGFVLTLMHVVA
FT                   SRNLPAATRLAGSLFFKNFVKRKWIDENGAYLIPEDDVVAVKREIVPLMIALPGNLQVQ
FT                   IGEAISVIADSDFPHRWPDLLDELIARLSTDDFVTNRGVLTVAHSIFKRWRPLFRSDDL
FT                   FLEIKMVLDKFAAPFMSLLQNVDEHISNSDNDPAKLTLLFDVLLILVKLYYDLNCQDIP
FT                   EFFEDNVQIGMGIMHKYLAYQNLALEDADEEDQPSIVTRTKSCIQELVQLYTTRYDDVF
FT                   GPMVNEFIQTTWGLLTTVSLQPKNDVLISKSFNFMTAVTKIPKYFEVFNSEAALNNITV
FT                   QIILPNITLRESDEELFEDDPIEYIRRDLEGSDSDTRRRGCTDFLKELKEKNESLVIPI
FT                   VLAHIKAFFAEYAADPSANWKCKDLCIYLFSTLAIRGTIGNPGVSSTSNLLDVVDFFTK
FT                   EITPDLMGPAAHPILKVDAIKYIYTFRNQLNKSQLIEILPVLANLLQADEFVVYTYAAI
FT                   TIERILSIRESNSSSDFIFKKADLAGSSHVLLQNLFNLIFKQGNSPEKLAENEFLMKTV
FT                   YRVLLTSEELTAPFAHEIAKQLLHIISIISKNPSNPRFSHYCFESLGVVVKFNKQSMSE
FT                   FMEMMMPQFLEILSEDVQEFTPYSIQIIAYCIEQLPAASSLPPSVSQLCQPILSPAVWE
FT                   LKGNIPALTRLLKDILRVDPTAYPDLVPVLGVFQRLIASKTYDENGFELLEYIVTYLPL
FT                   DSIVPYVKQIAVLLLQRLQNSRTEKYVKKFVVFLSIVAYKRGSDFVVDFIDGVQVGLFR
FT                   QIWSNFVINTLPTMGNLLDRKIAIIGILAVLTTGTKFSANYSDLLAPSLEVLVETATSD
FT                   SIVNLNSDYVDLENLEEITTFGSSFSRLTSISEKSFDPLPEVDLTSGVRSYVREALAAF
FT                   NDKTNNGLASLAPQLSESAKSALHNLGFN"
FT   gene            complement(<62327..>63253)
FT                   /locus_tag="KLTH0G00880g"
FT                   /old_locus_tag="KLTH-ORF5020"
FT   CDS_pept        complement(62327..63253)
FT                   /locus_tag="KLTH0G00880g"
FT                   /gene_family="HOG000144387" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5020"
FT                   /product="KLTH0G00880p"
FT                   /note="some similarities with uniprot|P06774 Saccharomyces
FT                   cerevisiae YGL237C HAP2 Subunit of the heme- activated
FT                   glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex a
FT                   transcriptional activator and global regulator of
FT                   respiratory gene expression contains sequences sufficient
FT                   for both complex assembly and DNA binding"
FT                   /db_xref="GOA:C5DLI0"
FT                   /db_xref="InterPro:IPR001289"
FT                   /db_xref="InterPro:IPR018362"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI0"
FT                   /protein_id="CAR24641.1"
FT                   /translation="MTMDNARGNHSAGEKCDTAAIKASVILDMDATKEFPPLESDAQPC
FT                   QRRDVNGKEELNPNIIGSSLGRQNVEVPYEDEQSPTNMYLYDQPQTNASRNESQTESHV
FT                   DPTALNEEDLSTSVDHHASLEVQFPETEVSGVSIKPVEQPKYPVDSKIGARDGSQQQGG
FT                   DGSIVSQAESEIEQVAGSTIGSLSEPTEQPFYVNAKQYYRILKRRYARAKLEENLKISR
FT                   ERKPYLHESRHKHAMRRPRGQGGRFLTAAEIAELKQHKELQLNLDIKQQDPADQSSKNV
FT                   EEETTEEPKSQTAKRSSGKHMSEVVRQ"
FT   gene            <63474..>64391
FT                   /locus_tag="KLTH0G00902g"
FT                   /old_locus_tag="KLTH-ORF5018"
FT   CDS_pept        63474..64391
FT                   /locus_tag="KLTH0G00902g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5018"
FT                   /product="KLTH0G00902p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI1"
FT                   /protein_id="CAR24642.1"
FT                   /translation="MSLGKSDALKQQLRELSFLLAKNRLQERQDTSSINSIKSFLSTEV
FT                   SSTESSRANDAVILSEGVDCGKRPLSQTLELSIDFQQRKHHKPSYRELELEIHDFPVIE
FT                   TVAGDLYESEGQLHTQAVNSLSYLDSEVEWSENARPARSEGMETGQVLAENISEVVDRQ
FT                   DNSYKNTSTSISNLEDSNITKSEQTVTKSNDTSSTLLQAKPLEIKTLKSIIKPLLDKAE
FT                   FEMSHDSWDSLRSFSGSLTDVVGKMFKDSSASKTKRLNRRFFISLFQECRVLSQGSDIN
FT                   DIFCVCSESLCAEELSELEIALFK"
FT   gene            complement(<64454..>66502)
FT                   /locus_tag="KLTH0G00924g"
FT                   /old_locus_tag="KLTH-ORF5016"
FT   CDS_pept        complement(64454..66502)
FT                   /locus_tag="KLTH0G00924g"
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5016"
FT                   /product="KLTH0G00924p"
FT                   /note="similar to uniprot|P53070 Saccharomyces cerevisiae
FT                   YGL236C MTO1 Mitochondrial protein required for respiration
FT                   in paromomycin-resistant 15S rRNA mutants forms a
FT                   heterodimer complex with Mss1p that plays a role in
FT                   optimizing mitochondrial protein synthesis"
FT                   /db_xref="GOA:C5DLI2"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI2"
FT                   /protein_id="CAR24643.1"
FT                   /translation="MLSASLNTNKRTLGSIFKLAQRSICLNIELRSALDKLPDSGVVVV
FT                   GGGHAGCEAAAGAARSGAPTVLVTPFLDKIGTCSCNPSMGGVGKGTLLREVDALDGVAP
FT                   KVTDLAGIQFKMLNRSRGAAVWGPRAQIDREIYLREMQKVLKSYANLTLYQGKVQDLVI
FT                   DRQVAGEGKDSHQKHSTVVGVILEDGTLLKASKVVITTGTFLSAEIHIGAKSIPAGRIG
FT                   EGASYGLSKTLDEAGFKLGRLKTGTPARLDGRTINFESLEKQYGDTPPNPMSFMNEDVA
FT                   IKDQVLCYGTHTTPEVHEYLRSNLHQAPHIRETIKGPRYCPSIEAKIIRFADKSSHRIW
FT                   LEPEGLDSHVVYPNGISNSMPENVQLKFMRMIPGLEQVEILQPAYGVEYDYIDPRSLAK
FT                   SLEAKPVKGLYLAGQINGTTGYEEACAQGIFAGINAGLAHQGKPPLEILRSDAYLGVLI
FT                   DDLITKGVEEPYRMFTSRSEFRISVRADNADFRLTPLGHAAGVVSDNRYASYINQKALY
FT                   SEIVTKLLNFELSAKRWNGSLGVPVADGAKNRSAWEMLRFNGIDLNTLGDKFPELGIDP
FT                   SQIPKHVLLKIDVEGKYAPFIKKQNQFIKAFQADEGMLLPPNFDYSILPSLSSECKTIL
FT                   NLVQPSTIGQARRIQGITPASLFELYKLVRFKQNDLSAETRMECQEP"
FT   gene            <67557..>69944
FT                   /locus_tag="KLTH0G00946g"
FT                   /old_locus_tag="KLTH-ORF5014"
FT   CDS_pept        67557..69944
FT                   /locus_tag="KLTH0G00946g"
FT                   /gene_family="HOG000030315" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5014"
FT                   /product="KLTH0G00946p"
FT                   /note="similar to uniprot|P07244 Saccharomyces cerevisiae
FT                   YGL234W ADE5 7 Bifunctional enzyme of the 'de novo' purine
FT                   nucleotide biosynthetic pathway contains aminoimidazole
FT                   ribotide synthetase and glycinamide ribotide synthetase
FT                   activities"
FT                   /db_xref="GOA:C5DLI3"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI3"
FT                   /protein_id="CAR24644.1"
FT                   /translation="MSFNVLVLGNGGREHALAWKLAASNSVGTVYVAPGNGGTADLGGK
FT                   VVNVCDLSPSPAHFEALQKFAVENSIGLVVPGPEQPLVDGISDVFAKVGIPVFGPSAKA
FT                   AIFEGSKTFSKDFMAKHNIPTARYANFDNYEEAKAYLQKVDYQIVLKADGIAGGKGVLI
FT                   PTSQQEAQEALKALMVERQFGSAGDSIVIEEFLEGDEISILTISDGYSYFNLPPAQDHK
FT                   RIGENDTGLNTGGMGAYAPAPAATPQLMQRMDQEAIKPTIDGMRKDGLPFVGVLFTGFI
FT                   LTADGPKVLEYNVRFGDPETQTVLPLLDDETDLAQVFLAAAEHRLDSVDIKLKENYFST
FT                   TVVLAAGGYPESYAKGDVITIDTEALPENAHIFHAGTVKKNGQILTAGGRVIASSAVAS
FT                   TLREAVDKAYQGVECIKFDNCYFRKDIAHRAFKAAEKSAANSKSITYAEAGVSVDNGNL
FT                   LVQKIKQKVKSTRRAGADSDIGGFGGLFDLKAAGYKTDETLLVAATDGVGTKLMIAQET
FT                   GIHDTVGIDLVAMNVNDLVVQGAEPLIFLDYFATGALDIKVATDFVSGVADGCIAAGCA
FT                   LVGGETSEMPGMYPAGHYDTNGTAVGAVGRNAILPKIERMSSGNVLLGLASDGLHSNGF
FT                   SLVRKIIETVDVQWSDKCPWDSSKTVGEATLVPTRIYVKQLLPSIRENLLLGLAHITGG
FT                   GLVENIPRALPKNLQAKVDMNTWEVPEVFKWFGKAGNVPTEDILKTFNMGIGMVLIVEK
FT                   QNVARVKELLAEANETVYEIGVLCEKPDGAPGCVVENASNLY"
FT   gene            complement(<70012..>71049)
FT                   /locus_tag="KLTH0G00968g"
FT                   /old_locus_tag="KLTH-ORF5011"
FT   CDS_pept        complement(70012..71049)
FT                   /locus_tag="KLTH0G00968g"
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5011"
FT                   /product="KLTH0G00968p"
FT                   /note="similar to uniprot|P43617 Saccharomyces cerevisiae
FT                   YFR045W"
FT                   /db_xref="GOA:C5DLI4"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI4"
FT                   /protein_id="CAR24645.1"
FT                   /translation="MNSIVAGSAAAVFQTTVSYPFEFLKTGLQLHRALPNMAPFNMMHQ
FT                   IKVYFAGCSALNAGTLLKTATRFTTFDRACQLLHDPELPQGAAISGPRLLAAGMITGFM
FT                   ESLLIIPFENIKTTMIENALALSEKSRLELSRSEAKSSHNPQALKGSRTVPYAHTSMTG
FT                   QSRPTFHARKEQALHPRQKWAIYYDEHPSRQLFTTIQEMFRTRGLRGFVQGTAPTIIRQ
FT                   TANSAVRFTSYTSLKQVFSPDGPINEYYAFALGFVSSCAVVAVTQPIDVVKTRMQSKYT
FT                   WVNYKNSLNCAYRIFVEEGFTKFWKGWAPRLMKVGLSGGVSFGVYQYVDNLMKAYAGPQ
FT                   EMGHD"
FT   gene            <71533..>73131
FT                   /locus_tag="KLTH0G00990g"
FT                   /old_locus_tag="KLTH-ORF5010"
FT   CDS_pept        71533..73131
FT                   /locus_tag="KLTH0G00990g"
FT                   /gene_family="HOG000216709" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5010"
FT                   /product="KLTH0G00990p"
FT                   /note="highly similar to uniprot|P43616 Saccharomyces
FT                   cerevisiae YFR044C Hypothetical ORF"
FT                   /db_xref="GOA:C5DLI5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017153"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI5"
FT                   /protein_id="CAR24646.1"
FT                   /translation="MLPGLSSKKSSGCRLLSIAKRLNITHFSSGISHRLPQAYYLRRFH
FT                   IYRKMSTEANFQQLFNKIDELKPRFIERLAKAIEIPAVSSDESLRPQVIKKAQFIAGEL
FT                   QKLGFSDIQMKELGAQPPPVADPNLPLPPVVLARYGSDPAKKTVLVYGHYDVQPAALED
FT                   GWATEPFKLIIDEEKQLMRARGASDDTGPLKGWLNVVEAHRELGLDLPVNLVTCFEGME
FT                   ESGSIGLDGLIAEEAGKYFKEVDAVCISDNYWLGTKKPVLTYGLRGCNYFQITIEGPAA
FT                   DLHSGIFGGVISEPMIDLTKVFSSLVDSRGRILIDGVNEMVAPVTEKEKELYEKIDFTL
FT                   DEMNAASGSQTCLYESKADILMHRWRYPSLSIHGLEGAFSAQGAKTVIPSKVVGKFSIR
FT                   TVPDMDSAKLDKFVIDHCDKVFASLNSPNRCKTELIHDGNYWISDPFNASFTAAAKATK
FT                   AVYGVEPDFTREGGSIPITLTFEKELKTSVMLLPMGRGDDGAHSINEKLDISNYMQGMK
FT                   TMAAYLHYYAASKEK"
FT   gene            <73388..>76018
FT                   /locus_tag="KLTH0G01012g"
FT                   /old_locus_tag="KLTH-ORF5008"
FT   CDS_pept        73388..76018
FT                   /locus_tag="KLTH0G01012g"
FT                   /gene_family="HOG000065975" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5008"
FT                   /product="KLTH0G01012p"
FT                   /note="similar to uniprot|P22224 Saccharomyces cerevisiae
FT                   YGL233W SEC15 Essential 113kDa subunit of the exocyst
FT                   complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
FT                   Exo84p) which mediates polarized targeting of vesicles to
FT                   active sites of exocytosis Sec15p associates with Sec4p and
FT                   vesicles"
FT                   /db_xref="GOA:C5DLI6"
FT                   /db_xref="InterPro:IPR007225"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI6"
FT                   /protein_id="CAR24647.1"
FT                   /translation="METDAQNVVSGELQQVLLSTDLSFLKSVHMDEGQGASFSGEHEEE
FT                   LDLDEHTFNRWTPLLRTAIETDSLPLVVDDLFSSVEENFENLEAQILQDSQLSDNLAAS
FT                   VSQIASIKDIIEGSLLHETEDLQVQLAHATNDVISRKQNYLSNKKTSTKISESIILITK
FT                   VLQILELSNKCQDLIKDSNFYKALQSLGALEKIYVQDFKNYNFEFLKKIYASIPILKSK
FT                   IKDESINLVKSSFNSNLEKKLLTVGKTFFEFYNNLLLPDWLESKNELKLSSFKFNSPVE
FT                   ISLRDSEKLESLNVEKLYPLNEFYDSILIFQNLKETDYLRKEFKKEYDFRISKVVYPLE
FT                   IKISGSASLSDLKKKTTTLFGDDFSLEELKEYMLRILGFVIYDRHLNRSTEYVLSQNDL
FT                   SANEDFWEVFIGRFSPFLEHFVSKICTSEEMLTELKDFLGIYISILENVGANIERIYEI
FT                   NVLVFKKYAALLVELFNKEFSTLLDDDDFMPLTINDESLYEKVLKICWLRTDELEALHS
FT                   REKTPDESFFATLPFSPLYPMTCTLVKKTYNKVVACLSEFYQYDLGELNNIIVKTVDDI
FT                   FGKIVDAKIASKLDTTSREEIAQILINLDYFIVAVGEFSKILARENITHSTDVELGLQS
FT                   AKLLSKTRGLTETKLIELIDSKVSDLMEFVEFEWSSTEVLKEPDYSIKDISQFLEMMFT
FT                   STLVNLPDSVKTLLIFREFDALTRRFLDVLLNSSPPSISPQSVLNFELNMNFLESIISK
FT                   LFPNDESIPSTPTSPDTASIQPLDNTRSSNLIDNTIRSLHSTFSDLKQHIQFLKCPDME
FT                   EYKDSGIRMRKYPRIKPEVAQMLHNKMVPPSSAGTDSDNSASIDQSFADSITSHRRIAK
FT                   FFNRA"
FT   gene            <76546..>77376
FT                   /locus_tag="KLTH0G01034g"
FT                   /old_locus_tag="KLTH-ORF5006"
FT   CDS_pept        76546..77376
FT                   /locus_tag="KLTH0G01034g"
FT                   /gene_family="HOG000065974" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5006"
FT                   /product="KLTH0G01034p"
FT                   /note="similar to uniprot|P53072 Saccharomyces cerevisiae
FT                   YGL232W TAN1 Putative tRNA acetyltransferase RNA-binding
FT                   protein required for the formation of the modified
FT                   nucleoside N(4)-acetylcytidine in serine and leucine tRNAs
FT                   but not required for the same modification in 18S rRNA"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI7"
FT                   /protein_id="CAR24648.1"
FT                   /translation="MLLTSAQKYKFSTGIIEPCVSGIYATCARKHEKQAAQELTQLFQE
FT                   KLEEWYGDELRELGHGESDDESDNDASVEDKIKKELEALHAKNNGPKSKEILRFVDLNC
FT                   ECVVFCKTRKPIDPEKFVHQLMQEFANPKESQKRTRYVQKLTPVTFSCNASLPELTKLS
FT                   QRVLKPHFHEEGTKPLKFAIEVTRRNFNTLDKMDIIKEVARVAGNGGQLPHKVDLKNYD
FT                   KLILVECFKNNIGMSVVNSEYRDDFKKYNIQQIFESKIKAQAANATQDVKLEPK"
FT   gene            complement(<77388..>77933)
FT                   /locus_tag="KLTH0G01056g"
FT                   /old_locus_tag="KLTH-ORF5005"
FT   CDS_pept        complement(77388..77933)
FT                   /locus_tag="KLTH0G01056g"
FT                   /gene_family="HOG000163282" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5005"
FT                   /product="KLTH0G01056p"
FT                   /note="similar to uniprot|P53073 Saccharomyces cerevisiae
FT                   YGL231C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI8"
FT                   /protein_id="CAR24649.1"
FT                   /translation="MSDIIPEWAHTLCDPNHPKKAPAVNSKSLPSPPGFKSLSGSSSKD
FT                   TKASLASGQRQDVAALIVQKAWQIAFQPAKSIPMNMIMSYMSGTSLQIISIMTALMFVS
FT                   NPVKSIANMRQTFKPVMGNAEAQPQVVVAMVMFVFFQIILMGIGIHKLNSMGLIPNTRS
FT                   DWLLLEQPAVYKGKSYAF"
FT   gene            complement(<78199..>78660)
FT                   /locus_tag="KLTH0G01078g"
FT                   /old_locus_tag="KLTH-ORF5003"
FT   CDS_pept        complement(78199..78660)
FT                   /locus_tag="KLTH0G01078g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5003"
FT                   /product="KLTH0G01078p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLI9"
FT                   /protein_id="CAR24650.1"
FT                   /translation="MSKFDNNCRTPRTMNNSSKFHETESFEGAEKKLSCMPISTVADSE
FT                   VGQEYCSARDKIGTKGVATAVKHPRYDFCKKKVRHSLHIFARLDLAVYEYSFIILFLIQ
FT                   LLLIVFSIKCIYPVIIKREMVGKGILYSSSVIPDECVDYSFFAQCIPQV"
FT   gene            <78894..>79649
FT                   /locus_tag="KLTH0G01100g"
FT                   /old_locus_tag="KLTH-ORF5002"
FT   CDS_pept        78894..79649
FT                   /locus_tag="KLTH0G01100g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF5002"
FT                   /product="KLTH0G01100p"
FT                   /note="weakly similar to uniprot|P43615 Saccharomyces
FT                   cerevisiae YFR043C Hypothetical ORF"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DLJ0"
FT                   /protein_id="CAR24651.1"
FT                   /translation="MTTGLSLDEGKVIEGRPKALRDKVLIVFSNKVFNREEILFEVFGV
FT                   EDNAGKQVHRGVDWTTKYYTVTIDVYVDSFSNLEDWTNEFCDPDFDELRDVIAGWIIVL
FT                   PFSGNIEEETKALSRLVNNATSEDFFTAILATELNVGKNERAFLEYNVLAGAVELVHNE
FT                   LDSDGELKEVNGVDRVKEIIDTCDWHPRLLRTAHLESETGMESACTGISLAQIMGSLRE
FT                   ARTKYMAMDPGLDREEFANEMANELSKLL"
FT   gene            <80433..>81317
FT                   /locus_tag="KLTH0G01122g"
FT                   /old_locus_tag="KLTH-ORF4998"
FT   CDS_pept        80433..81317
FT                   /locus_tag="KLTH0G01122g"
FT                   /gene_family="HOG000142085" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4998"
FT                   /product="KLTH0G01122p"
FT                   /note="similar to uniprot|P43613 Saccharomyces cerevisiae
FT                   YFR041C ERJ5 Endoplasmic reticulum protein that may
FT                   function as a cochaperone as suggested by the presence of a
FT                   DnaJ-like domain"
FT                   /db_xref="GOA:C5DLJ1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ1"
FT                   /protein_id="CAR24652.1"
FT                   /translation="MLHLQWKALVLILVSLVSLSIAFTPEEVQIFQLHQEIQKYGKNVD
FT                   FYKLLKLPKLKESTSQEIRKNFRQLSKKYHPDKNQKYRKLYERLNLATKILSNDSQRKT
FT                   YDYYLKNGFPKYDFNKGGFFFSRVRPSTWFTLAFIYIACGLIHYVLLRLQNDGNKARIE
FT                   RFLREVKAQDDTNGLGEKQLLLRQSENDEGKKIIVRLGDVFVLQPDGTEALVSTKEIKN
FT                   PGISESILVSLPFWLWSKSVGKLTGGFTGPKDSSNPSTSRAFSNKRATRNKGPGATMDL
FT                   PNGKVLHSRKKAQ"
FT   gene            complement(<81486..>83888)
FT                   /locus_tag="KLTH0G01144g"
FT                   /old_locus_tag="KLTH-ORF4995"
FT   CDS_pept        complement(81486..83888)
FT                   /locus_tag="KLTH0G01144g"
FT                   /gene_family="HOG000142084" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4995"
FT                   /product="KLTH0G01144p"
FT                   /note="similar to uniprot|P43612 Saccharomyces cerevisiae
FT                   YFR040W"
FT                   /db_xref="InterPro:IPR007587"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ2"
FT                   /protein_id="CAR24653.1"
FT                   /translation="MSFWPFGQSEHSNINRLLEEYFQVLHSVEKHNENGAETQATREEE
FT                   GGTPHDPGPAQEALEKCLDGIPSIQMLNNSFIDGILEESELLNELTRQNNTLLDFICFG
FT                   YFYTADGVKVQNIEYLIDQLIECVGHIDANEFDAATSGSGRSSRGSLHEFDDDDCISGS
FT                   ASPDNSPRPQQTYLNKATIISEIFALDIWLISESLVKNSSYLNKIWSIIYHPNFPSEKS
FT                   PLIPIFLKINQNLLSTRQDQYLNFIRSKPTLVDDLLKHIQISVLMDLLLKIISTDKQES
FT                   PTGIIELVHEQRLTRKLLCYLDNDKHEPDIQACAADVLKAIIAISANAPLDDMSIGPNS
FT                   LTRDLASEECIDHLLDAIINKRSNALINAVSIVIELIRKNNSDYDQVNLLSTTLSSHPP
FT                   SMRDPIYLGVMLRKFTEKLTYVFQILVDIERNNSAKVLENQLGEKYKPLGFERFKVVEL
FT                   IAELLHCSNMGLLNSKKAERIVSERNKAREMVAKSLQDALADLDVQDNDNTHSAESRSD
FT                   AYDEDVDESFEIPYVNPKQNSKLRENPTIGDRFKISLYDNQILPRIIYLFLKYPWNNFW
FT                   HNVVFDIIQQLFNGRMDFSYNSFLVYSLFNNGSASEFMPRDSRVDICDFQITRDLILKG
FT                   YKDSYAFYEKHNTALGFMGHLVLIAEEIVKFSKVYKVELISPKIQAAFQDEEWIFYSED
FT                   VLNDTRIMYSKILGGNDYLEEENGYEANGDNFNNDSNRNENPELGGSLINVGNLDQDQS
FT                   ANPSNFPTTSDLHNKLRKKLIDRSREDVDRRNEENGVIILGMAPEDN"
FT   gene            <84229..>86250
FT                   /locus_tag="KLTH0G01166g"
FT                   /old_locus_tag="KLTH-ORF4993"
FT   CDS_pept        84229..86250
FT                   /locus_tag="KLTH0G01166g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4993"
FT                   /product="KLTH0G01166p"
FT                   /note="weakly similar to uniprot|P53075 Saccharomyces
FT                   cerevisiae YGL228W SHE10 Putative
FT                   glycosylphosphatidylinositol (GPI)-anchored protein of
FT                   unknown function overexpression causes growth arrest"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ3"
FT                   /protein_id="CAR24654.1"
FT                   /translation="MRRVRGVGNLLVTILVVLIGFKQARKYCESNEAEFCRLTSLSRAS
FT                   PWWNEHIDPYWDSYVSPCVTKIHDYEHKLDEWAAPRIDRAYYQVQDIVETKVVPVTYKW
FT                   YKTVQFKTQVYYNGHFVPFLGHARILAKQWLASEGFFQRLYLHVQQGLFCLRNWSLWVW
FT                   NGSLEAFNEIHSWSGHALQEISNKFSVTENQSGEPVTDEDPSDTDESKYYDAEYFEGEQ
FT                   GDYNEDDETVYLTSTIIETVTLSDEKQLDKSTSAANGDDGSSLDVPLRDLVQDEFQAWS
FT                   NTVEQKASNTLTQFDSEVEELVEAKLSKAQPNITGLLQGISESFQSHYRIINRAILDVD
FT                   CTMELDPETGEQLYFNKDGTQLRKYVTRPLMREFFSSAHAHVDERLEMVRARLEKFVAA
FT                   VNKEVEQVRQEHLEVYEEWGDVMVSEWSKRMAYVDVVAAMGAEDMNQQQHDNWKRFLKL
FT                   KKQVVNTRDLLMQHPAKLERLQKFLNDIQFTLMALQRDAGEYLFILRSQANIAFQTREK
FT                   LEREREEEERRKLEQERQIQEQKEREQQELAENEARAARERLALEQGQGQEQLEQNSDE
FT                   AFFSMEDITATPLGADDNTDYENALDDADSQLSESGDSEDNFYDSYEGDEEDASRELER
FT                   LERESAERETLDRLELGQRQKLQEEQHRDELHHSSQAN"
FT   gene            <86471..>87820
FT                   /locus_tag="KLTH0G01188g"
FT                   /old_locus_tag="KLTH-ORF4989"
FT   CDS_pept        86471..87820
FT                   /locus_tag="KLTH0G01188g"
FT                   /gene_family="HOG000227987" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4989"
FT                   /product="KLTH0G01188p"
FT                   /note="highly similar to uniprot|P39954 Saccharomyces
FT                   cerevisiae YER043C SAH1 S-adenosyl-L-homocysteine hydrolase
FT                   catabolizes S-adenosyl-L-homocysteine which is formed after
FT                   donation of the activated methyl group of S-
FT                   adenosyl-L-methionine (AdoMet) to an acceptor"
FT                   /db_xref="GOA:C5DLJ4"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ4"
FT                   /protein_id="CAR24655.1"
FT                   /translation="MSSPAQNCKVADISLAAFGRKEIELAEHEMPGLMAIRAAYADAQP
FT                   LKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAAAGVPVFAWK
FT                   GETEEEYLWCIEQQLFAFKDNKKLNLILDDGGDLTTLVHEKHPEMLKDCFGLSEETTTG
FT                   VHHLYRMVKDAKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKVSVVA
FT                   GYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVCPMEEAASIGQVFVTTTGC
FT                   RDIITSEHFLAMPEDAIVCNIGHFDIEIDVAWLKANAKECVNIKPQVDRYLLSSGKHII
FT                   LLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAHDNEFRQKYIEFQKTGPFEIG
FT                   VHVLPKILDEAVAKFHLDKLGVRLTQLSNVQSEYLGIPSEGPYKADHYRY"
FT   gene            <88489..>90960
FT                   /locus_tag="KLTH0G01210g"
FT                   /old_locus_tag="KLTH-ORF4987"
FT   CDS_pept        88489..90960
FT                   /locus_tag="KLTH0G01210g"
FT                   /gene_family="HOG000000917" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4987"
FT                   /product="KLTH0G01210p"
FT                   /note="weakly similar to uniprot|P53076 Saccharomyces
FT                   cerevisiae YGL227W"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR018355"
FT                   /db_xref="InterPro:IPR019589"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ5"
FT                   /protein_id="CAR24656.1"
FT                   /translation="MSFCMDQVDCAYVRALFPAYLLEQPIGHELWKIYLRNRKLFHKLK
FT                   NKGQSVPVLKEARLHKLKPNVSHATRKEIWEKLMNLGVLGTVPYNSVGDEYLMQVYQYF
FT                   YPDIDQDSFGDSRRNEAADEMQIDSDSADLTKPVDPIAHLVRRLGEDDDGEDDDEDLDD
FT                   DDDDDDDDEDVTQAAERDDQVGDDEDEEDDDDNIEDIHQTEEHRGASDQKLQDSEKDQY
FT                   FSPLTESSHQNRPKKNYVSMDIYKLLGYPLPHAWDAQSSNSMMVSSDGSNQLKPNPSLE
FT                   GFPRRSDSIVGSGFSVSYSSYSAKFEYVSARANNSILSKKMAIFYYEIRVLSVTSSQSG
FT                   QNCNIKVGFKDLSKFQAGSASPSRTDLHAGDPVSINRQSASIMRSTVESSSTTSTKSRG
FT                   DGFDKGSFGYCGQDGYITDGTQYKIYGKQYGRGDVIGCGVNFVDGTIFFTKNGINLGTA
FT                   FTDVHDLDLVPFIALKPGNMVRTNFGLHEEFVFDILNYQRMLKSKAYHHIYKSIDGHDG
FT                   RNDFESSIHSDQDDFDDDPPLSGDNRGGFLLQNDERFSGDKLYRPEVEKLNNLSTDDDS
FT                   IPCAMHAMINDHLIHEGLIDVAKGFLKDLQKDCIPNSDEERARLVIRHNERQIIKEENN
FT                   LKLRQSIRRFINEGDIAQCLVFINSQYPGLIEKNVDLLFELKVAEYLLMFVQFKSHSID
FT                   EILRKGQELTSEFVYSQQVPADYKDGFRNHLNDISSLLAYDNPLRECNEDLAIYLTPAY
FT                   LQDRLFQLVNSRVLAFLEKKSESSLESMVSYTRAMIDTLMEYGEGSSLVHNDSELRFHK
FT                   LVNIDEDLLNM"
FT   gene            complement(<91023..>91350)
FT                   /locus_tag="KLTH0G01232g"
FT                   /old_locus_tag="Klth0G.mRNA.3788.m"
FT   CDS_pept        complement(join(91023..91268,91327..91350))
FT                   /locus_tag="KLTH0G01232g"
FT                   /gene_family="HOG000115295" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0G.mRNA.3788.m"
FT                   /product="KLTH0G01232p"
FT                   /note="similar to uniprot|Q92316 Saccharomyces cerevisiae
FT                   YGL226C-A OST5 Zeta subunit of the
FT                   oligosaccharyltransferase complex of the ER lumen, which
FT                   catalyzes asparagine-linked glycosylation of newly
FT                   synthesized proteins"
FT                   /db_xref="InterPro:IPR020294"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ6"
FT                   /protein_id="CAR24657.1"
FT                   /translation="MSSYQEVYKLYHQASEFEGVVALESQPMYGTITAVLALVFIALAL
FT                   SSISKAAGLPLGLQFVQYSFLSLAGSAFFGLATIFLTNSFGVYA"
FT   gene            <91489..>91938
FT                   /locus_tag="KLTH0G01254g"
FT                   /old_locus_tag="KLTH-ORF4983"
FT   CDS_pept        91489..91938
FT                   /locus_tag="KLTH0G01254g"
FT                   /gene_family="HOG000142083" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4983"
FT                   /product="KLTH0G01254p"
FT                   /note="similar to uniprot|P53077 Saccharomyces cerevisiae
FT                   YGL226W Hypothetical ORF"
FT                   /db_xref="GOA:C5DLJ7"
FT                   /db_xref="InterPro:IPR004203"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ7"
FT                   /protein_id="CAR24658.1"
FT                   /translation="MSTSLRSLRRNLGCLRRGTSHVPACLRSLSHTSYEPPRIDDLTGE
FT                   KWIKLEKDVKEEIMEYLDWKMEGDWREMPANEKRASYFVSFGQWGPRAKPGSKEAQLQM
FT                   TGAEIILRGVFSGVLFMAVAVSFMNYQNDKRVQKNLKKLEDSAER"
FT   gene            complement(<91956..>92510)
FT                   /locus_tag="KLTH0G01276g"
FT                   /old_locus_tag="KLTH-ORF4982"
FT   CDS_pept        complement(91956..92510)
FT                   /locus_tag="KLTH0G01276g"
FT                   /gene_family="HOG000263863" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4982"
FT                   /product="KLTH0G01276p"
FT                   /note="highly similar to uniprot|P40029 Saccharomyces
FT                   cerevisiae YER042W MXR1 Peptide methionine sulfoxide
FT                   reductase reverses the oxidation of methionine residues
FT                   involved in oxidative damage repair providing resistance to
FT                   oxidative stress and regulation of lifespan"
FT                   /db_xref="GOA:C5DLJ8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ8"
FT                   /protein_id="CAR24659.1"
FT                   /translation="MVSAVSKSIKFSPQSEKLLTVAAGCFWGTEHIYRKYFGNRIKDYK
FT                   VGYANGDETKKDSSDSVSYKRVCSGETQFAEVLQISFDPKTVSLKELVDFFFRIHDPTT
FT                   VNSQGPDVGTQYRSAILTHTQEDLEECRRLKEQWQPKWGNKIVTEVTMCTNFYDAEEYH
FT                   QLYLDNNPQGYACPTHYVRDL"
FT   gene            complement(<92808..>94835)
FT                   /locus_tag="KLTH0G01298g"
FT                   /old_locus_tag="KLTH-ORF4981"
FT   CDS_pept        complement(92808..94835)
FT                   /locus_tag="KLTH0G01298g"
FT                   /gene_family="HOG000142381" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4981"
FT                   /product="KLTH0G01298p"
FT                   /note="similar to uniprot|P40028 Saccharomyces cerevisiae
FT                   YER041W"
FT                   /db_xref="GOA:C5DLJ9"
FT                   /db_xref="InterPro:IPR006084"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLJ9"
FT                   /protein_id="CAR24660.1"
FT                   /translation="MGVPAFWDLIKSDESLRRLPLKQFVVEFRNNFNRPLRLAIDAFTW
FT                   LFESGFISNDCERLSEKGYRTDAQSTLILLNRLKCLLSLDVTFVLVFDGPMKPSFKNKF
FT                   SSKTLSNDHCELASDDEEYVSIYNEHRKQHEIHGTCTTTLVSEELGGLSFVKRLLKTMN
FT                   ISFIETCGEGEAECARLQREGLVDYVLSNDSDTLVFGATRVLRNFSRFWEDVPATYTGP
FT                   LKKKDHKEMFITVVDMQQIRNWNRSSLVLYCTLLGADYNQGIRGLGSKKAAKLAQLTTP
FT                   NFAETFKDIFEDHSQPSELRRKRYLEFQKALFEHCFIHSKELFGRNYFSSNSAGFQGWP
FT                   SDVAIMHYFHPILSPRVNRESLGVHYINVSGNSNFMKGDVADLMNLLEELEFKGITDFG
FT                   RWFHEMVHSTFLLKEILYGNRTREELTRLVKITEEWCAGICQNKFRVPCWRIRYNSFLT
FT                   TGNEASPQDTEDSIVAHSSPNKRSGSPSKKQSEKASHKFMTSIPKGLIPENNSLVKNYH
FT                   LEKRTASEGDKRPRRGSPRKVANQKSNLDGFLKKYGTPRKHDSPKALHEKLEPETEPMN
FT                   TKRKLFVEEDLDNPEPGNSSSLILVSERECNHDILHTSPKRALDLFIATSEEEDLEASA
FT                   GSEESPLKKLKKNAATAESQLPTPRKLLPDNFVDLTIESG"
FT   gene            complement(<95197..>97431)
FT                   /locus_tag="KLTH0G01320g"
FT                   /old_locus_tag="KLTH-ORF4978"
FT   CDS_pept        complement(95197..97431)
FT                   /locus_tag="KLTH0G01320g"
FT                   /gene_family="HOG000112739" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4978"
FT                   /product="KLTH0G01320p"
FT                   /note="weakly similar to uniprot|P18494 Saccharomyces
FT                   cerevisiae YER040W GLN3 Transcriptional activator of genes
FT                   regulated by nitrogen catabolite repression (NCR)
FT                   localization and activity regulated by quality of nitrogen
FT                   source"
FT                   /db_xref="GOA:C5DLK0"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK0"
FT                   /protein_id="CAR24661.1"
FT                   /translation="MTEGGANIFDMLAEGGGSTGSGVGGGFDAMLEILPEEIDVSFVEG
FT                   FSSEAREASAGPVRAASGGAAHVETLFEATPPIDVVDQQNGEIAQLWDFNVDEFMMTPS
FT                   GSSDSATISAPNSFNSEHPGQLGGYGGGGAFAGTFGAGTPAASHNWGHLLGAPFHSEPG
FT                   SQQPLFASPSALLADDAPGSVSAAAFRPTLPTRRSSSQLSKAAMADDGGLPLAHSTTAN
FT                   SVRKNSMTRPLSSSSLSSYRQNSVPELPKKPQVQCFNCKTFKTPLWRRDAQGNTMCNAC
FT                   GLFQKLHGTMRPLSLKSDVIRKRNTKKRGKKADAAKDKDKDSSATGAAATATTRPVRGK
FT                   QDSGSSIPQTRLPSTPVAGGQSHTNGSATTFPSTLSKSRTNSSTNLSVNGTFTSSSSSS
FT                   TTTQLSSNVLMNHNHRMLPTSGLGVSKKSRRSSSSSSASNSSNRSSSSRSMVPILPKPS
FT                   PGGTSSARNQFQLAGFPGSAGNSAASSPRFSNSPRPASATSPLPTSAGQTLSSSAGRPG
FT                   MTITRRKSSRQAHTSSSSSFMAASLQQHQHHQQQQPQPQPQSQHSQQGGFQSNTAGSSS
FT                   STISAHSNSWNSNTIAAPSPKSGRSPRSPFDLFSSSSSSQEPQSRPASRKTHTSLLSQQ
FT                   LQQATASPQNPQSPSQFQTPATFQSSSLSSSVTPQPASLKRSPMTASPRNSYMDSIQQQ
FT                   RGLHSDTGVRRTTSLRAEANNATGIAANAPSSQRQKDAFMDDLEWLKFGL"
FT   gene            <98101..>99108
FT                   /locus_tag="KLTH0G01342g"
FT                   /old_locus_tag="KLTH-ORF4969"
FT   CDS_pept        98101..99108
FT                   /locus_tag="KLTH0G01342g"
FT                   /gene_family="HOG000031183" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4969"
FT                   /product="KLTH0G01342p"
FT                   /note="similar to uniprot|P40107 Saccharomyces cerevisiae
FT                   YGL225W VRG4 May regulate Golgi function and glycosylation
FT                   in Golgi Golgi GDP-mannose transporter"
FT                   /db_xref="GOA:C5DLK1"
FT                   /db_xref="InterPro:IPR004689"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK1"
FT                   /protein_id="CAR24662.1"
FT                   /translation="MSELKVDNGGMSQMANSGPLSILAYCGSSILMTVTNKFVVNVENF
FT                   NMNFVMLFVQSFVCSLALVVLRALGYAKFRPLNKTDVKNWFPISVLLVAMIYTSSKALQ
FT                   FLAVPIYTIFKNLTIILIAYGEVLFFGGRVTAMELSAFLLMVLSSVVATMGDRQALAKK
FT                   ASELAAAATSEEAMDPTAGYIWMFANCISSALFVLIMRKRIKLTNFKDYDTMFYNNALA
FT                   MPILLISSFVLEDWSPENLTTNFTRNTFTALIISGLASVGISYCSGWCVRVTSSTTYSM
FT                   VGALNKLPIALSGLVFFDAPKNFLSIFSIFLGFLAGLVYVVAKQKKQQQPAAKA"
FT   gene            <99120..>100518
FT                   /locus_tag="KLTH0G01364g"
FT                   /old_locus_tag="Klth0G.mRNA.gf.424.p"
FT   CDS_pept        join(99120..99191,99325..100518)
FT                   /locus_tag="KLTH0G01364g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0G.mRNA.gf.424.p"
FT                   /product="KLTH0G01364p"
FT                   /note="weakly similar to uniprot|P40026 Saccharomyces
FT                   cerevisiae YER038C KRE29 Essential protein of unknown
FT                   function heterozygous mutant shows haploinsufficiency in K1
FT                   killer toxin resistance"
FT                   /db_xref="InterPro:IPR014803"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK2"
FT                   /protein_id="CAR24663.1"
FT                   /translation="MRLHSYRPSYARVGTACIHRCSQGAYASASISDEHSQAEPRAADA
FT                   DVVYDSQDSGGGSPIVKNQFHYDADDLSDSELSSEPSDDDEAGISALIHLEAPEQAPAP
FT                   PPSGFEAPQFREFDVHCNGFDEQLLSRTAKLRELSRELEPEPAVSAASASDKKPPLRKQ
FT                   VASSFKQKVPRAYLDMILAENSSRKFQDWYFMTENAQPAEIDPWATFLGAKKPKKQSLK
FT                   ELLKSLGVPSQHLSPQLQHITVDMYDTVNLLQPVHVMCKQLQRYYKCRGFAQSFICFIL
FT                   DRNVFNSPECTSAWCEDVYSRLDANHFTDTYLQLVAGDSYLLHLRVSRQIPEFHELLLE
FT                   KLFPQHTYETLLGEFDRLLKAKEHQKLLYFTLFIYGTATMPFGDTAASQRLRDSVYGAG
FT                   NDGNHVELVIIRSYINFFIKIV"
FT   gene            complement(<100515..>101414)
FT                   /locus_tag="KLTH0G01386g"
FT                   /old_locus_tag="KLTH-ORF4964"
FT   CDS_pept        complement(100515..101414)
FT                   /locus_tag="KLTH0G01386g"
FT                   /gene_family="HOG000165531" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4964"
FT                   /product="KLTH0G01386p"
FT                   /note="similar to uniprot|P53078 Saccharomyces cerevisiae
FT                   YGL224C SDT1 Pyrimidine nucleotidase overexpression
FT                   suppresses the 6-AU sensitivity of transcription elongation
FT                   factor S-II as well as resistance to other pyrimidine
FT                   derivatives or to YER037W uniprot|P40025 Saccharomyces
FT                   cerevisiae YER037W PHM8"
FT                   /db_xref="GOA:C5DLK3"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK3"
FT                   /protein_id="CAR24664.1"
FT                   /translation="MQSHFSRVGSTIGSKIGKMTISTTASARAHYRDQVEAQLKANQES
FT                   LDNLTHTGSQVTFEIDPPETPKPNPDLKVFFFDIDNCLYKRSTRIHDLMQVSIHEYFKN
FT                   ELNIDDDEAWKLHHTYYREYGLAIRGLVMHHDIDALEYNRMVDDALPLQRILKPDAGLR
FT                   SMLSRLKESGAVDKLWLFTNAYKTHGIRCVRLLGIADMFDGITYCDYSQKDNLVCKPDP
FT                   AAFQRAKAQSGLGDYKNAYFVDDSGSNVKTGISLGIKKCVHLIEDEVDPNLGQTPAGSI
FT                   VIRNIEDLPKAIPELFQR"
FT   gene            complement(<101521..>103356)
FT                   /locus_tag="KLTH0G01408g"
FT                   /old_locus_tag="KLTH-ORF4963"
FT   CDS_pept        complement(101521..103356)
FT                   /locus_tag="KLTH0G01408g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4963"
FT                   /product="KLTH0G01408p"
FT                   /note="weakly similar to uniprot|P53079 Saccharomyces
FT                   cerevisiae YGL223C COG1 Essential component of the
FT                   conserved oligomeric Golgi complex (Cog1p through Cog8p) a
FT                   cytosolic tethering complex that functions in protein
FT                   trafficking to mediate fusion of transport vesicles to
FT                   Golgi compartments"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK4"
FT                   /protein_id="CAR24665.1"
FT                   /translation="MCHGIGIRHYVRASVCHFARAARVARASSPNCRCTTSTSTSSHGQ
FT                   QNPDPPAAMATTADALFREKPVGELRNYRLQLSHDIAKAKDRFETELGRRYTDMLAVTD
FT                   QVDELLQQARTADADLMELCFNDAKFKLAALPDPAAFHAAAPAAATADPELGPGAQPDL
FT                   AGIEATLAVSEWVLAVKDFAREPALQKHFDSLVQGFHTVLSLHDVSRYASVLARNCRAL
FT                   EDTILEQQAEFSASQWVKLHRLVHSHAEVFPFKRVDELDALVFSFLLANEEPLRAAGVD
FT                   ADVQAFLEGEPFKLKFVERVLQDVDAEFQALEEAAAGSAPTPELYRMNFDDGSLLALVT
FT                   EANLYCSGAISPRDRALYALVENITALVRKLQRSQADSAVISKVKERLSEVLIERRKEV
FT                   VEAPSDNSVLQLEALQKKGDTEFGTSQQGDAGPELKHKDAPLDSVTAAQKGESTDVVGN
FT                   AARKTPVVSTDAEAEAHDSDTGASSTETEAPGAETETTSAETEVVTPSAETETQTPSAE
FT                   TETQTPSAETETQTPSAETETQTPSAEAEATSAQTQPPSAENNNYEKTMHKGNIWQPVE
FT                   SLPLTRDIVRAAVQKLNTDNLLAYLGGQIAQVDSF"
FT   gene            complement(<104505..>105005)
FT                   /locus_tag="KLTH0G01430g"
FT                   /old_locus_tag="KLTH-ORF4949"
FT   CDS_pept        complement(104505..105005)
FT                   /locus_tag="KLTH0G01430g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4949"
FT                   /product="KLTH0G01430p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK5"
FT                   /protein_id="CAR24666.1"
FT                   /translation="MPPSASPPAAPSAARLNGTPDTPTLPARKPPTSASPSFRAPASAA
FT                   PRGARRAPCKREPFASALSCGAAPCSRDLPRCWAYSRGSSSDVATVSALYPRRRPVAKD
FT                   LRPDKRIKCKNMRKAPPSSRHCSSLWSLCATFPRPLRSQRGILQFSRPRKNVVRRVPRA
FT                   HGG"
FT   gene            <105741..>107564
FT                   /locus_tag="KLTH0G01452g"
FT                   /old_locus_tag="KLTH-ORF4944"
FT   CDS_pept        105741..107564
FT                   /locus_tag="KLTH0G01452g"
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4944"
FT                   /product="KLTH0G01452p"
FT                   /note="highly similar to uniprot|P40024 Saccharomyces
FT                   cerevisiae YER036C"
FT                   /db_xref="GOA:C5DLK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007406"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK6"
FT                   /protein_id="CAR24667.1"
FT                   /translation="MPPASASKAKREAKKAEREAKRLAEGKTVRSSKKKEGTEDEAEAA
FT                   AKEIAQMKLQLDKDGISDRVVTGVLDSLETSRDVKMSSVSLLFHGKVLIQDSQLELNYG
FT                   RRYGLLGENGCGKSTFLKSLATREYPIPEHIDVYLLDEPAEPSEFSALDYVVNEAQNEL
FT                   KRLEDLVEKTILDEGPESDVLEGLYERMDSLDPSTFESRAAVILIGLGFNSQTIKKKTK
FT                   DMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLVSHSQD
FT                   FLNGVCTNMIDMRLQKLIAYGGNFDSYVKTRTEQETNQMKQYAKQQEEIAHIKKFIASA
FT                   GTYANLVRQAKSRQKILDKMEADGLIEPVVPDKVFSFRFPEVERLPPPVLAFDDISFAY
FT                   DGKAENNLYEHLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELSAQSGRVSRHTHVKLG
FT                   VYSQHSQEQLDLNKSPLEFVRDKFPHISQDFQYWRGQLGRYGLTGEGQTSQMGTLSEGQ
FT                   RSRVVFALLALQAPNVLLLDEPTNGLDIATIDSLAEAINDFNGGVVVVSHDFRLLDKIA
FT                   KDIFVVENKTATRWDGSILDYKNKLAKNVVL"
FT   gene            complement(<108671..>109738)
FT                   /locus_tag="KLTH0G01474g"
FT                   /old_locus_tag="KLTH-ORF4940"
FT   CDS_pept        complement(108671..109738)
FT                   /locus_tag="KLTH0G01474g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4940"
FT                   /product="KLTH0G01474p"
FT                   /note="some similarities with uniprot|P53080 Saccharomyces
FT                   cerevisiae YGL222C EDC1 RNA-binding protein activates mRNA
FT                   decapping directly by binding to the mRNA substrate and
FT                   enhancing the activity of the decapping proteins Dcp1p and
FT                   Dcp2p"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK7"
FT                   /protein_id="CAR24668.1"
FT                   /translation="MSTDTMYLNSSRRLPAAGKNKSSQLQKPEKKQTRSTRKNRTRQEA
FT                   SAAEVLPKPQTLPNGEKPDFGNSSKKQYGRKNHESSSAPRPYEARESAQKKNRSKDSSP
FT                   SHVDTTPAKSPSVLERSAVRQLTPQSVANASPVVSPLPLSMAAPLTISPLPHQPGLYQQ
FT                   QHQQNQFQQNQYQQHQQFNAGYPYHHPQFSSLPLPAGAHQPNYALSTGAMPYFTSPQAP
FT                   LMGLPAQQAPPFFGMPHPPPPVTIMPGHFPHTPPSLNNVPPPQMFQQTFSPASAPTSIS
FT                   SSTECSGPVTALPEEPRSSSATSNSTSSSTGASGSKKPSKKTRTSGKLGRGGYAGASFA
FT                   TSLPSITNLPKPSFT"
FT   gene            complement(<110060..>110593)
FT                   /locus_tag="KLTH0G01496g"
FT                   /old_locus_tag="KLTH-ORF4935"
FT   CDS_pept        complement(110060..110593)
FT                   /locus_tag="KLTH0G01496g"
FT                   /gene_family="HOG000142080" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4935"
FT                   /product="KLTH0G01496p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK8"
FT                   /protein_id="CAR24669.1"
FT                   /translation="MDPYALKRDNRKKFFDKEKLKRKHATPSDRKYRALNKSEELPPPE
FT                   PELQANDYRYHEDISMAHGQDDFDAQNVNKKLKEVLKGRDVESGSAAKSVLPMTRKNLD
FT                   SMTVAELNSLLQRDVVPNADAKPAQAPNSSAPNSAVKSSAVKSGGNTSGTTKPQPSAVP
FT                   AELESEQNFLDELI"
FT   gene            complement(<110693..>111550)
FT                   /locus_tag="KLTH0G01518g"
FT                   /old_locus_tag="KLTH-ORF4933"
FT   CDS_pept        complement(110693..111550)
FT                   /locus_tag="KLTH0G01518g"
FT                   /gene_family="HOG000014260" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4933"
FT                   /product="KLTH0G01518p"
FT                   /note="similar to uniprot|P53081 Saccharomyces cerevisiae
FT                   YGL221C"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLK9"
FT                   /protein_id="CAR24670.1"
FT                   /translation="MSKALSKPQLKLLIEKITKLYPASYADASWDNTGLLIDCSAPQSS
FT                   VEKPKVLLTVDLTASVAEEAVANDCSLVLAYHPFIFPSWKRLSPWSNSQHRSAIKLIQS
FT                   GISVYCPHTAVDAAKNGVNDWLAHSLVRDQSLLKSSVSIEKVTPEQGELECEVGYGRVV
FT                   SFSTVVHLKDIISQVKSALEIPHLQVAVKDPLADFEVRSVALCAGSGSGVFKALKQDVD
FT                   LYFTGEMSHHEVLRLKEMGKAVIVCNHSNTERGFLKHVMQHELARAGVECIVSATDSDP
FT                   LVVV"
FT   gene            <111703..>111960
FT                   /locus_tag="KLTH0G01540g"
FT                   /old_locus_tag="KLTH-ORF4932"
FT   CDS_pept        111703..111960
FT                   /locus_tag="KLTH0G01540g"
FT                   /gene_family="HOG000255170" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4932"
FT                   /product="KLTH0G01540p"
FT                   /note="similar to uniprot|P53082 Saccharomyces cerevisiae
FT                   YGL220W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL0"
FT                   /protein_id="CAR24671.1"
FT                   /translation="MSVSQQVIKDKLQASIGDIYHIIITDTSNGCGQSFDVIVVSDTFE
FT                   GKNKLQRCRLVNGALKEEVAQIHAFGCKCFTTAEWSKLVV"
FT   gene            complement(<112050..>113678)
FT                   /locus_tag="KLTH0G01562g"
FT                   /old_locus_tag="KLTH-ORF4931"
FT   CDS_pept        complement(112050..113678)
FT                   /locus_tag="KLTH0G01562g"
FT                   /gene_family="HOG000000918" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4931"
FT                   /product="KLTH0G01562p"
FT                   /note="similar to uniprot|P53083 Saccharomyces cerevisiae
FT                   YGL219C MDM34 Mitochondrial outer membrane protein
FT                   colocalizes with mtDNA nucleids required for mitochondria
FT                   shape"
FT                   /db_xref="GOA:C5DLL1"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DLL1"
FT                   /protein_id="CAR24672.1"
FT                   /translation="MSFRFNKGAFEDNSFNEQIREALTSALNSKTQSSSQTAPANTTNS
FT                   AATDEVKQETRGPKRLDILKSGISVSKVNFPSTPQLEILDLDVSAQSRSLLKGICKVSC
FT                   KNAMLEINTEIEANLLLLYTNDGPSFTTPRLISNDSFTVPITMTFNQIELEAITNIFVK
FT                   NNSVGISFNDVNLDFDFDCSIKLLQSSIEKRLKGSMETVFKEVLPSVIFSMSQRWFTHG
FT                   ESTCNSASDDKSAGRQVENHSHTPRTILEDCDLEDLSPANMLRLSTLVSSRQSLSLNPT
FT                   AMNTLSTIPGCLERQNLHRFNSRIPALSNFYPDFYEVESPHLKAFGRSVSTNVISSGKL
FT                   EHHNALPQRVLDERSYDLKTIASVQSRIFERSSGDGTAIRRRKIKMGKKSKSKKAQSQD
FT                   IENSSPTVVMPSSPSLEPSAVSTPEALHSPQPTTAVQSPELLAENSESVSIPALILPTQ
FT                   ADHYTLPVKTSAPKLNLLEEAHYLNRKREFQKLRTSLYSPIRSNRFNLNKEMERPILEH
FT                   KGLNFVGLTHGLNWGSEDLPPPYRG"
FT   gene            complement(<114328..>115530)
FT                   /locus_tag="KLTH0G01584g"
FT                   /old_locus_tag="KLTH-ORF4929"
FT   CDS_pept        complement(114328..115530)
FT                   /locus_tag="KLTH0G01584g"
FT                   /gene_family="HOG000116231" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4929"
FT                   /product="KLTH0G01584p"
FT                   /note="similar to uniprot|Q03558 Saccharomyces cerevisiae
FT                   YHR179W OYE2 Widely conserved NADPH oxidoreductase
FT                   containing flavin mononucleotide (FMN) homologous to Oye3p
FT                   with slight differences in ligand binding and catalytic
FT                   properties may be involved in sterol metabolism"
FT                   /db_xref="GOA:C5DLL2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL2"
FT                   /protein_id="CAR24673.1"
FT                   /translation="MTFVEGFKPIALKDTNLFKPIKVGKTVLRNRAVLCPLTRLRASQP
FT                   RHVPNSELATKYYGQRSSVPGTMIITEGTFPSAQSSGTDNAPGIWSQEQVTEWKKIFSK
FT                   IHENKSFVWVQLWVLGRQASPKSLKRDGLRYDAPSDEPYMSEETKKEAIESGNPQHGLT
FT                   HEEIKQYIQDYVQAAKNSLEAGADGVEIHSANGYLLNQFLDPKSNKRTDEYGGSIEKRA
FT                   RFLLEVVDAVVDAVGHEHVGVRLSPYGTFGNMSGASDPLFLAQYAYVVGQLEARAKSGK
FT                   GIAYIHLVEPRVTSPRLVEGEGWFKDGSNEFVGSIWKGPIIKAGNYALDPKAAKEDVQF
FT                   DDRTLIGYGRLFIANPDLVLRLKDGLPLNQYDRDTFYTQTAKGYVDYPTFEEAQKLSAA
FT                   A"
FT   gene            <116364..>118823
FT                   /locus_tag="KLTH0G01606g"
FT                   /old_locus_tag="KLTH-ORF4925"
FT   CDS_pept        116364..118823
FT                   /locus_tag="KLTH0G01606g"
FT                   /gene_family="HOG000183905" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4925"
FT                   /product="KLTH0G01606p"
FT                   /note="similar to uniprot|P53086 Saccharomyces cerevisiae
FT                   YGL216W KIP3 Kinesin-related motor protein involved in
FT                   mitotic spindle positioning"
FT                   /db_xref="GOA:C5DLL3"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL3"
FT                   /protein_id="CAR24674.1"
FT                   /translation="MDSEAPHTRQSSIVVSVRVRPFTVHERAHLVNEQNIFGNLQLGDP
FT                   NLTLPGVENSTPTKIAPSRHRPQGVRQIVDCVDDKMLIFDPAENNPLSRISENVLNSIT
FT                   TPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAY
FT                   GATGCGKTYTVSGTAENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLL
FT                   EPETPSKKLVLREDVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSR
FT                   SHAVLQVHITQKNRTAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLL
FT                   ALGNCINALCAGGKRGGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETL
FT                   NTLKYATRAKEIKTKIIRNQHSLDRHVGSYLKMITEQRQEIEELRSRERKMIDLELSRY
FT                   KISRERVHMSVWDSVQSLRQNYKTSEKFHHLKVIKSLMLCKRRFLQMVGVELAVLLKFT
FT                   SPNSDIHVNCMALHEQLVQKVKNLEQSFDSPDELESALEHTRQVDLVKLQEMEGWAESD
FT                   LVWYESLLSWVSESVRNEILVGSSLMMERLMEDHVLLDRLKFISETLLRFTHTAEGSDE
FT                   HSFDFDSLTEQLHGQIRDLINIDDEFDRFAASVQTTMVGTRDRTLVSAEALQERNFRKG
FT                   ALSLQVPHHRKQARAKVVKSSSGTPSPVQRSRTSQGSKAAKKVRWSEVLPGNDTSSMMM
FT                   DDDNPQTQHSTHITASEEDISMLDAADSAVAPSEGIYNLHPTVAPRDIPPPPRKVSLTA
FT                   TALVRGK"
FT   gene            <119662..>120873
FT                   /locus_tag="KLTH0G01628g"
FT                   /old_locus_tag="KLTH-ORF4923"
FT   CDS_pept        119662..120873
FT                   /locus_tag="KLTH0G01628g"
FT                   /gene_family="HOG000142079" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4923"
FT                   /product="KLTH0G01628p"
FT                   /note="some similarities with uniprot|P35190 Saccharomyces
FT                   cerevisiae YGL215W CLG1 cyclin-like protein that interacts
FT                   with Pho85p in affinity chromatography cyclin-like protein
FT                   that interacts with Pho85"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL4"
FT                   /protein_id="CAR24675.1"
FT                   /translation="MASYMYYPNYAAPQLQPFHGHSQSMGAPPVGNYGYYQAAQPMQPY
FT                   YQPQPHRSFHNHSSSYPMVMPPPGMGYLAPPAPSHHMPLPPVQPQLQPPVQQHPPPAQN
FT                   PESQVNGGVREVLDYDLKLMSEFVVKNAYLVFDNDDAINVESSSVVDVFTKGVSSVLNA
FT                   TRLPSVTIFMALDFLCKYISKLPAGVEAVGGDSVNVIYQNLMIALVLANKFNDDKTFTN
FT                   KSWSHATGMELSVINQFERAWLAVFEWRLFDDNFVLFDEYSNSFKQYCQEKSSPVHQYN
FT                   APSLPPSASCVSGLSPVQQNCSGFQTPMQAPPMVYSSPCFTEERSTTSNSFYQPTFASP
FT                   ISNESPMTKQGMNGYSYNYYSAPQPAPALAPMSSNLLWNNRVDEFYPQSQFAPPNKAYY
FT                   CYSN"
FT   gene            complement(<121279..>122556)
FT                   /locus_tag="KLTH0G01650g"
FT                   /old_locus_tag="KLTH.mRNA.158AT.m"
FT   CDS_pept        complement(join(121279..122466,122554..122556))
FT                   /locus_tag="KLTH0G01650g"
FT                   /gene_family="HOG000247930" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.158AT.m"
FT                   /product="KLTH0G01650p"
FT                   /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
FT                   YGL213C SKI8 essential for protection against viral
FT                   cytopathology dispensable for mitotic but required for
FT                   meiotic recombination and spore viability antiviral protein
FT                   mRNA is induced early in meiosis"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL5"
FT                   /protein_id="CAR24676.1"
FT                   /translation="MSKLFISTTNCGKAHEADIFGMSISNPFTITVSGDGALKLWKNRL
FT                   LDGQQPKEHVLSKFVHKTGVHHVDAFHSMERGGIEVFLVACVSFSGQLFVYSIDLESGA
FT                   FQELDLLTKSEKQKSYWCVRFFKSDDLNVSHKLVATDVKGNTIVWNLKTFKEKEEADGQ
FT                   HAEEKDIHLVLKGEIPSPEPNFATCVDVSSKGLIVTGFQDGSVSVSQLETLRPIYVFEG
FT                   FGIKGTEESSNTVRDVKFSPLGELLAVANDSGSYGCVTLYETEYGERIGNLTVPTHSSQ
FT                   ANIANFTHDGWVFGISFNSTGEFLATCGYDGKIRVWDVKQKERVSTLNISAGDIEIEED
FT                   IVPKDEFGDSLKIPPVMGVTFINKGVRGGVGSDTNEGISCICLDRSVRWFREAGGV"
FT   gene            <122726..>123775
FT                   /locus_tag="KLTH0G01672g"
FT                   /old_locus_tag="KLTH-ORF4919"
FT   CDS_pept        122726..123775
FT                   /locus_tag="KLTH0G01672g"
FT                   /gene_family="HOG000142078" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4919"
FT                   /product="KLTH0G01672p"
FT                   /note="similar to uniprot|P32912 Saccharomyces cerevisiae
FT                   YGL212W VAM7 Regulator of vacuolar morphogenesis
FT                   hydrophilic protein heptad repeat motif"
FT                   /db_xref="GOA:C5DLL6"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL6"
FT                   /protein_id="CAR24677.1"
FT                   /translation="MLGDKSVHVEVHVSKGQIVKKSYTLYLINLKITKDGGLESSFHSL
FT                   RRFSEFVQLKKDLEQEVGCELPYELPPRRFIGWLRPASSCDPDVIEERVRELTTFLQDL
FT                   LNDSFDTRWRKARSLCQFLRIPDDWDNSGADGKHGNRSRDFHSSKDPQEEDLADAQKWL
FT                   EELRNCKILYEEAIQNTSSFAKASVQLRLRIHNLEKGLKKIEAGQLVGAAEVNRRQTLL
FT                   NGLKTDLNRSSLTWAPQSTETFDSGLLPTTNSQALKPIAGRKLGETNQTTRLNNQELLQ
FT                   LHKDTTQEQDKELEQLRRIILSQKDLSLTMNQELAQQNELLDYMGNEVDSTASKLRLAN
FT                   RKAKKFNGN"
FT   gene            <124053..>125174
FT                   /locus_tag="KLTH0G01694g"
FT                   /old_locus_tag="KLTH-ORF4917"
FT   CDS_pept        124053..125174
FT                   /locus_tag="KLTH0G01694g"
FT                   /gene_family="HOG000225864" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4917"
FT                   /product="KLTH0G01694p"
FT                   /note="similar to uniprot|P53088 Saccharomyces cerevisiae
FT                   YGL211W"
FT                   /db_xref="GOA:C5DLL7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020554"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL7"
FT                   /protein_id="CAR24678.1"
FT                   /translation="MSFTPPSDPKKPKSIKVSQLCELCHSRKALIKRPKNLQKICKLCF
FT                   FHVFETEIHNTIISNNLFEYGEKVAVGASGGKDSTVLAYVLKLLNERYNYGIQIVLLSI
FT                   DEGIVGYRDDSLATVKRNKEQYGLPLEIVSYRELYDWTMDEIVACAGVRNSCTYCGVFR
FT                   RQALDRGAAKLGIRHVVTGHNADDMAETVLMNILRGDVARLEKSTAIMTQSSGSPIKRS
FT                   KPFKYSYQKEIVLYAHYKKLDYFSTECTYAPEAFRGTARELMKNLEAVRPSCIIDIIYS
FT                   GESLRLKPKRTKRAPPAGHVEVCSDGSVSLNGGDFVDGNRCERCGYLSSNRICKACMLL
FT                   EGLQQNRAKLSIDRDVSTHGAARLTRTLEQLTF"
FT   gene            <125972..>128509
FT                   /locus_tag="KLTH0G01716g"
FT                   /old_locus_tag="KLTH-ORF4914"
FT   CDS_pept        125972..128509
FT                   /locus_tag="KLTH0G01716g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4914"
FT                   /product="KLTH0G01716p"
FT                   /note="some similarities with uniprot|P40021 Saccharomyces
FT                   cerevisiae YER033C ZRG8 Cytoplasmic protein of unknown
FT                   function transcription is induced under conditions of zinc
FT                   deficiency"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL8"
FT                   /protein_id="CAR24679.1"
FT                   /translation="MRSFIKSHKKSNSLDSSPSRSQSDKESGRSSYEYAVQPQAPLSKR
FT                   PVLDKGPPQSLSFESFHKLTNKNKIFSTKIFKKPGSHTSKTGEPCTTPVSPHVPTFRNL
FT                   SSPETPQSSHFSRHFQEESKEFTTIKGTRTHEWGASKDKSSSVIVLNRSSTSSDASSEM
FT                   TESGFGSQVKLQRGSVSSATSSCIDENQRGSFDLQAGTTTPLVKLDDLSEVQEKHPYFS
FT                   LRSHGNKAKNRQVRIHSHEDFLSLEKKSNVNLDFLPGGLGSSNRLRNLTRLNSTDDSLH
FT                   CVAEKPSKAYDQAQKESTPNLNLLGLGIDAKNLVQGEESSLSSSDEREQSVITNDRSFE
FT                   EGDENRASSIALSITKISVSEHPESSSERGSEPDEDYSDGSSKFSFEIGGVNGRTSSVK
FT                   YYSKPNPQPHVYIDDVYEDDDFNEDMNCFDEEEDQELEMRVGVNNDNASGVRGTSKLQE
FT                   KVGYGAITDAFSSDEEIEQQNSSKVKGYNDLFDISDDESESNTSFHGGQEASDGNSCFS
FT                   NDEALSVKGNITTEFQSSNLKSYGDIFDLSDEELSKFPKADLSNTNEDMAAHPDVNVDF
FT                   EGAEAPKQPFGHKPSTTEKIIQSCIKPVHSPKLSKPSSPRGTLRLPFPADPRSPTLDSA
FT                   TLFLPPPARSQVVKYHDLSSNLDYEVPGAMSNLFFIDESEEDQYNKKHQPDEHYLDEIN
FT                   NLPEDFAFSDDDEYYLSASRSPGSNVRNSSFKKSHSFSEKPIGAVKEKTPSNYKLELKD
FT                   RVVTFFHGPFDSTLTSTSPRSPAAEEDDDTPLSIEERQIQGVTGLDPLPVTPSNSFSRP
FT                   NAYLGQSNGLSPIQETNSSVDNSPRVKSRLNNN"
FT   gene            complement(<128741..>131494)
FT                   /locus_tag="KLTH0G01738g"
FT                   /old_locus_tag="KLTH-ORF4912"
FT   CDS_pept        complement(128741..131494)
FT                   /locus_tag="KLTH0G01738g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4912"
FT                   /product="KLTH0G01738p"
FT                   /note="some similarities with uniprot|P40020 Saccharomyces
FT                   cerevisiae YER032W FIR1 Protein involved in 3' mRNA
FT                   processing interacts with Ref2p potential Cdc28p substrate"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLL9"
FT                   /protein_id="CAR24680.1"
FT                   /translation="MLDPGPSTPTKQQGVEHDKQELPSCLKSSEKRRSSPYNHKHSTSQ
FT                   VRFSLPLEDDSQSLLDEDEEPVRVSPTKVVFPKGSEEDMTTHFVDLHNKIMVDVPEEIW
FT                   RFHNERNAQQLQKMSVKGQKGHGRAQSLQSIIAGTIQSYQSPAAENTHSRSLSCTSSRL
FT                   KPSELYLRSDSPLNKYKVPVPLEVTLPPYLSPDKKTKRRESMIYDGEGYSLFFEDSDVQ
FT                   EERDPFDPNSSADRSESEGSDISIPSASHDYSFEVGQDIDKILGIDEDANVNLKNQVRN
FT                   LLNKSPSKKAFLSLEQPQLPKLPRSQPKVEPFQEEKPVKLKLPPSQLKTKPTQEEKPVE
FT                   ITKSYALKILSSPSKTITLPDFNEPVSSSNRNSLAEFFARVDCEDNTHPVTVEHEGKDE
FT                   INEFFKFPAIQQEDKTTETQPIDENLQVNEGELDNSFERRRKMLQNRASTDDFRTRHSH
FT                   ARSRSFHNSQEMFNAKLTSSGILSSNLEAPERSPKRSSIKSVTFKEGLPGADVEANAKS
FT                   TPTKSSTLQANRNCELDKGPVSEEEEEEEEESFSFTLSEHEQKDSAESGIIARPAELLE
FT                   TAHKNSQPAQDTDELSHKSGLSYHNSSSSLAMDFFSDVISDADSSDFIHSTGTSSVKNL
FT                   SSSKSDSSISLIGANAKPGDNITPLSTYNSFKTPLDSPQTANDPSLIECRLTHDNRLSP
FT                   SRQLSNDRSQSSECSADTMPSQPSSATTYSHNDWKQSMEVFSYINKKSGNNFVSGRRAK
FT                   RGNNPALVAGEIQPSYSGYRVTKEEIGGRLVDIILLDEPGNNDCAPKRRPRSYHEDALQ
FT                   HYDQVLALCDMTADRAKSVIMNLVEDPSHTNQVSEPLSRPVPPPSYLKSHEKPIKENRS
FT                   PKGLAHTSLNNNMPSRPQKYISNLEKLRRASKERSNSPDRRLRENC"
FT   gene            <132121..>132917
FT                   /locus_tag="KLTH0G01760g"
FT                   /old_locus_tag="Klth0G.mRNA.122.p"
FT   CDS_pept        join(132121..132166,132307..132917)
FT                   /locus_tag="KLTH0G01760g"
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0G.mRNA.122.p"
FT                   /product="KLTH0G01760p"
FT                   /note="highly similar to uniprot|P51996 Saccharomyces
FT                   cerevisiae YGL210W YPT32 probably involved in intra-Golgi
FT                   transport or in the formation of transport vesicles at the
FT                   most distal Golgi compartment; ras-like GTPase, highly
FT                   homologous to YPT31"
FT                   /db_xref="GOA:C5DLM0"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015595"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM0"
FT                   /protein_id="CAR24681.1"
FT                   /translation="MNNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNEFNMESKST
FT                   IGVEFATRTIEVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENC
FT                   NHWLTELRENADENVAVGLIGNKSDLAHLRAVPTDEAKNFAQENQLLFTETSALNSENV
FT                   DQAFRELITAIYQMVSKHQVDLNEYGNNAGQAPKGPTISLTPAPAKKNKKSDNCC"
FT   gene            complement(<132995..>133435)
FT                   /locus_tag="KLTH0G01782g"
FT   CDS_pept        complement(132995..133435)
FT                   /locus_tag="KLTH0G01782g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0G01782p"
FT                   /note="weakly similar to uniprot|P40019 Saccharomyces
FT                   cerevisiae YER030W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR019098"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM1"
FT                   /protein_id="CAR24682.1"
FT                   /translation="MAETKKHELKDQPDKKRVKRRRNYDDYDKEVAAEDSKAKKENKGT
FT                   GDNGSESESEDDEKLDMMLNKEDEEEDDLAEIDSSNIIQGGRRTRGKVIDYKKTAEALD
FT                   KESGKASEEPKEELAQKDVAKKSETAEEDEDAEDADFKEPEK"
FT   gene            <133466..>134044
FT                   /locus_tag="KLTH0G01804g"
FT                   /old_locus_tag="KLTH-ORF4903"
FT   CDS_pept        133466..134044
FT                   /locus_tag="KLTH0G01804g"
FT                   /gene_family="HOG000188899" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4903"
FT                   /product="KLTH0G01804p"
FT                   /note="weakly similar to uniprot|P40018 Saccharomyces
FT                   cerevisiae YER029C SMB1 associated with U1 U2 U4 and U5
FT                   snRNPs as part of the Sm-core that is common to all
FT                   spliceosomal snRNPs U1 snRNP protein"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM2"
FT                   /protein_id="CAR24683.1"
FT                   /translation="MWGFDVYYPHLRIFSQFQMNLNSYRSRGRPEMSVKVGHKSKLADL
FT                   LRYRIRAVTNDGKAFVGELLAFDAHMNLVLAECVEHRIPSTQVQSLKAKAKEVDAQPKI
FT                   ETRTLGLVVLRGDQVLTTVVESGPTMSKRERAVAHDRKQAQLNKHKRKGKGVVRPGASN
FT                   NAVAPAPGFQRTSQPQPRPFQPPPGFRRR"
FT   gene            <135376..>136299
FT                   /locus_tag="KLTH0G01826g"
FT                   /old_locus_tag="KLTH-ORF4894"
FT   CDS_pept        135376..136299
FT                   /locus_tag="KLTH0G01826g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4894"
FT                   /product="KLTH0G01826p"
FT                   /note="some similarities with uniprot|P53035 Saccharomyces
FT                   cerevisiae YGL209W MIG2 Protein containing zinc fingers
FT                   involved in repression along with Mig1p of SUC2 (invertase)
FT                   expression by high levels of glucose binds to Mig1p-binding
FT                   sites in SUC2 promoter"
FT                   /db_xref="GOA:C5DLM3"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM3"
FT                   /protein_id="CAR24684.1"
FT                   /translation="MGVAQQESDHRPFKCDMCGKGFHRLEHKRRHIRTHTGEKPHACNF
FT                   PGCVKRFSRSDELKRHVRTHMSTSRGKSRKRSGSSPALEHPVVVHQLPPISVPGVAQMP
FT                   PLVPVAQLASVAQLASVAAPVAVAPSATAYIPRAGPSSSTSLLIPGVVAPMVSPAVSRA
FT                   VSPAVSPAFSPHTSSIHLHPGHASFLSSSSSSMSSVFSGGESGLASPLPSSPDLRVHKL
FT                   AGLLPSVQKSTRSASGGMSIASAVLNNAKRQQPLPAARPRLQGRNSQRAKFELNDDDDS
FT                   DSSQPADVRLPPLSSMLDGIQAFQER"
FT   gene            <136780..>138030
FT                   /locus_tag="KLTH0G01848g"
FT                   /old_locus_tag="KLTH-ORF4890"
FT   CDS_pept        136780..138030
FT                   /locus_tag="KLTH0G01848g"
FT                   /gene_family="HOG000093748" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4890"
FT                   /product="KLTH0G01848p"
FT                   /note="similar to uniprot|P34164 Saccharomyces cerevisiae
FT                   YGL208W SIP2 Member of a family of proteins including Sip1p
FT                   and Gal83p that interact with Snf1p and Snf4p and are
FT                   involved in the response to glucose starvation component of
FT                   Snf1 protein complex involved in response to glucose
FT                   starvation and similar to YER027C uniprot|Q04739
FT                   Saccharomyces cerevisiae YER027C GAL83 One of three
FT                   possible beta-subunits of the Snf1 kinase complex allows
FT                   nuclear localization of the Snf1 kinase complex in the
FT                   presence of a nonfermentable carbon source contains
FT                   glycogen-binding domain"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM4"
FT                   /protein_id="CAR24685.1"
FT                   /translation="MGNTHSKRAMSENMKDVSMVDVSSAEDEDKKGSQRAIVQSFSKLD
FT                   IGDHSSSGAPLMRRRSTLIFDDEDESPRHEENVGDQADLNEFGGPSSESSSSASVFHQR
FT                   QQQTPPAQESEPPAAEAPRVMVPVEITWQQGGSKVYVTGSFTGWRKMIGLVPVADQPGV
FT                   FHIKLQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEISPQDSQQQLQLQQQQ
FT                   QQQQQQQPQQLQPLQQPQQPQPQEQPQHPANYPPRSRRAEAAAEPLSARSKLALQIEEE
FT                   PDDMGDGYSRFHGGAEATPAYSYTTDIPAVFTDSSVMEQYYLTLDQQQNNQQSMAWLTP
FT                   PQLPPHLENVILNNYSNSSDPGGSGSENNSGALPIPNHVVLNHLATSSIKHNTLCVASI
FT                   VRYKRKYATQILYSPLQ"
FT   gene            <138361..>141459
FT                   /locus_tag="KLTH0G01870g"
FT                   /old_locus_tag="KLTH-ORF4888"
FT   CDS_pept        138361..141459
FT                   /locus_tag="KLTH0G01870g"
FT                   /gene_family="HOG000209079" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4888"
FT                   /product="KLTH0G01870p"
FT                   /note="similar to uniprot|P32558 Saccharomyces cerevisiae
FT                   YGL207W SPT16 Subunit of the heterodimeric FACT complex
FT                   (Spt16p-Pob3p) facilitates RNA Polymerase II transcription
FT                   elongation through nucleosomes by destabilizing and then
FT                   reassembling nucleosome structure"
FT                   /db_xref="GOA:C5DLM5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR013719"
FT                   /db_xref="InterPro:IPR013953"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM5"
FT                   /protein_id="CAR24686.1"
FT                   /translation="MSDVEINFKVFQKRLTQLHSEFRNFEGSPQSLLFVVGSSDEEDPY
FT                   KKSTILHNWLLGYEFPATLIAFVPDKVIIVTGAGKAKHLLGAVDLFKDSAFKLELWQRK
FT                   AKDDAHNDKLFADVIELLKTAGKTVGTPVSDKYQGKFIAQWTPHWEGATGKGEFETVDI
FT                   ALGLSQVWEKKDDQEVAFLKVSSKGTDLFMNLLSDEMVTAVDEELKISNAKLSDKIENK
FT                   IDDPKFLKKLANQMAPLCPSGEKFDINLLDWAYSPIIQSGSKFDLKVSARSNNDQLHGN
FT                   GCILASCGIRYKSYCSNVTRTFLIDPTEEMVSNYEFLVSLQQEIINSFLKIGKTPKEVY
FT                   ESTVEYVKSHKPHLLSGLTKNVGSLIGLEFRDSQFVLNSKNEQRKIGEQDCFNVSLGFN
FT                   NLKDSKTGVNYAVQIADTVLISSDGKAAALTDYTKLKSQISFYFNNEEEEVTTKVKKEN
FT                   AAGSPPIPMKSDGNSKILRSKLRGESRVQEDSQKEQIRKENQRKLHEKLQKNGLIRFSA
FT                   ADANGADDQPQHQFKKYESYIRETQIPNNVRDLRVHVDWKNQTIILPIYGRPVPFHINC
FT                   YKNGSKNEEGEYTYLRLNFHSPGAGGISKKAEELPYEDSPDYQFVRSISLRSKDGDRMN
FT                   EVFKQIADLKKEATKREQERKLLADVVEQAKLLENKSGRTKRLDQIFARPSPDAKRVPG
FT                   TVFIHENGIRYQSPLRTDSRIDILFSNIKNLIFQPCKGELIVIIHVHLKNPILMGKKKI
FT                   QDVQFYREASDMAVDETGNGRRSNMKFRRYGDEDELEQEQEERRKRAALDKEFRYFAEA
FT                   IADASDGLVDLDTTFRELGFQGVPSRSAVYCMPTRDCLVQLVEPPFLVINLSEVEICVF
FT                   ERVQFGLKNFDMVFVYKDFSKPVTHINTVPIEDLELLKSWLTDVDIPYAVSTINLKWST
FT                   IMKSMQEDPHQFFLEGGWSFLVAGSDDEMSDESEEEISEYEASDEDPSDESAYSEEDGG
FT                   SEDDFSDGGSEDASADESEEEGEDWDELEKKAAKADRENRQNE"
FT   gene            complement(<142143..>147116)
FT                   /locus_tag="KLTH0G01892g"
FT   CDS_pept        complement(142143..147116)
FT                   /locus_tag="KLTH0G01892g"
FT                   /gene_family="HOG000188877" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0G01892p"
FT                   /note="highly similar to uniprot|P22137 Saccharomyces
FT                   cerevisiae YGL206C CHC1 vesicle coat protein presumed
FT                   vesicle coat protein"
FT                   /db_xref="GOA:C5DLM6"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001473"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM6"
FT                   /protein_id="CAR24687.1"
FT                   /translation="MSDLPIEFTELVDLTSIGISPQSLDFRSTTFESDRFVTARESQNG
FT                   ANSVAIVDLQNGNQVTRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKTKLKSFTL
FT                   EEPVLFWKWLSEETLGFVTANSLYVSNVFDGDTSRKPSKLTQRHANLNNAQIINFVANK
FT                   RLDWFAVVGIIQENGRVAGKIQLFSKARGISQAIEGHVATFSTILLEGNTQPVQVFVTG
FT                   NKTASGTGELRIIEIDHDASNAVSYQKKTVDIFFPPDAVNDFPISVQVSEKYGVIYVLT
FT                   KHGFIHLYELETGANLFVNRITVEPVFTATTYNQKNGIACINRRGQVLAVEISTDQIVP
FT                   YVLNKLSNVSLALKMASRGGLPGADDLFNKQFDTLLASGDYQNAAKVAASSQQLRTQTT
FT                   INRLKNIQAPPGAISPILLYFSTLLDKGKLNKYETIELARPVLQQDRKQLFEKWLKEDK
FT                   LECSEELGDVVKPFDTTLALACYLRAEAHSKVVTCLAELQQFDKILPYAQKVGYQPNFI
FT                   VLISNLARSSPDKASEFAVSLLQSPETASQIDIEKIADIFFAQNFVQQGTSFLLDALKG
FT                   DTPDQGHLQTRVLEVNLLHAPQVADAIMGNSIFSHYDKPTIASLAEKAGLYQRALENYT
FT                   DIKDIKRCIVHSNALPIDWLVAYFGKLNVEQSVACLRALLDDNLQANVPIAIQVATKYS
FT                   DLIGSQVLIKLFEEYRATEGLYYYLASLVNLTEDKDVVFKFIQAAAKVGQFKEVERIVK
FT                   TNNVYDPEKVKNFLKDIKLADQMPLVIVCDRFNYIHDLILYLYKAQDFKFIEVYVQQVN
FT                   PSKTPQVVAALLDVDCDEKVIQNLLGSVLGQVPIGELTAEVEKRNRLKLLLPFLEDTLR
FT                   QGTQEQAVYNTLAKIYIDSNNSPERFLKDNDQYDTLDVGRYCEKRDPYLAYIAYEKGAN
FT                   DDDLIRITNENSMYKYQARYLLKRSDANLWNKVLDEENIHRRQLIDAVVGTGIGELTDP
FT                   EPVSLTVQAFMSNGLKGELIKLLEKIILEPSPFNDNPALQGLLMLSAIRYEPSKVSSYI
FT                   EKLDKFDEDEIAPLCVENGLNEEAFEIYSKNEKHDKALQVLVEDVMSLDRAESYVDKIN
FT                   SPELWSQLGAAQLVGLRIPEAINSYIKANDPSNYETVIEVAEQAEKYEELIPYLSMARS
FT                   SLKEPKIEGALILSYAKLGKLHEIENLLTGSTVADLESVGNKLFEEKDYKAAKLCFSAV
FT                   SNYSRLATTLVYLNDYQAAVDTARKASNVRVWREVGDACVDNKEFRLAQICGLNLIVHA
FT                   EELEELVEKYESHGYFEELISLFEAGLGLERAHMGMFTELAILYTKYDMGKTYEHLKLF
FT                   WSRINIPKVIRAVESAHLWTELIFLYAHYDEWDNAALTMIDKSADDFDHSYFKEIIVKV
FT                   SNLEIYYKAINFYVKEHPTLLIDLMTVLSSKLDIPRTIRIFSKSDNLPLIKPFLVNVLP
FT                   KNNSVVNQAYHDLMIEEEDYKALQVAVDSYDKFDQLDLAARLEKHDLIFFKKIAAQLYR
FT                   RNKKWSKSLAILREEKLWADAIETAAISQSTEVAEELLNYFVDTNNREGFVALLYTAYH
FT                   LIRYEVVLELAWMNSLEDLIKPYEISVKKEQYSNVQKLLEQSKSGAKSDAAQSEDQPLL
FT                   LTNGAMAYQATGQAFGNYA"
FT   gene            <148464..>150680
FT                   /locus_tag="KLTH0G01914g"
FT                   /old_locus_tag="KLTH-ORF4880"
FT   CDS_pept        148464..150680
FT                   /locus_tag="KLTH0G01914g"
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4880"
FT                   /product="KLTH0G01914p"
FT                   /note="similar to uniprot|P13711 Saccharomyces cerevisiae
FT                   YGL205W POX1 Fatty-acyl coenzyme A oxidase involved in the
FT                   fatty acid beta-oxidation pathway localized to the
FT                   peroxisomal matrix"
FT                   /db_xref="GOA:C5DLM7"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM7"
FT                   /protein_id="CAR24688.1"
FT                   /translation="MTRITTNEFSGPTFKPQAFIQHERRESQLNIDAVNVFLESDPANA
FT                   QLTHDLVTEVTMDPVLKTGSEYYDMSKDQHRRATALKIAKMAVYLEQDIKRAARNYRGG
FT                   AVEKFQTSDKTPILTAQDLAIFDKRLSIISNQDPQLGTRIGVHLGLFGNCIRGNGTNEQ
FT                   IRYWLQEKGALFLKGIYGCFAMTELGHGSNVAQLQTRAEYNIQTDTFLINTPNLPATKW
FT                   WIGGAAHSATHATVYARLIVKGKDYGVKTFVVPLRDPGTFQLLPGVFIGDIGTKMGRDG
FT                   IDNGWIQFKNVVIPREFMLCRFTKVIRSEQGDDAKVWSEPTLDQISGYSALLNGRVNMV
FT                   MDSFRFGAKFVTIAVRYAVGRQQFAPAGDKTGKAEETQLINYPLHQYRVLPHLAVVYLI
FT                   SPVAFNLMATYHSTLDQLFKASSSGDKKQLGPVSLKLKDLFIDSASLKATNTWLVATAI
FT                   DELRQACGGLGYSAYNGFGKGFSDWVVQCTWEGDNSILSLTSARSILKKFTDLSKGKVQ
FT                   ESQSFKYLSPSFVTQVLRGSKSAQIRSLEDYIEVWGIMLVKILHYCVDLVSKTKNTDSI
FT                   SKHLIMISRFHAFHTMLQAYYEKLKSPEDSHVSDQESQKMLWNLFRLFSLYFIDKHSGE
FT                   FLQFKVFTPDQIQTIVQPQLLALLPEIRKECIALTDAFKLPDAMLNAPIGYYDGDIYNN
FT                   YYAEVLKNNPPEAPGPGKPNYHEVLTTMLRRDYEPEENLAKLGK"
FT   gene            <151117..>151929
FT                   /locus_tag="KLTH0G01936g"
FT                   /old_locus_tag="KLTH-ORF4875"
FT   CDS_pept        151117..151929
FT                   /locus_tag="KLTH0G01936g"
FT                   /gene_family="HOG000229371" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4875"
FT                   /product="KLTH0G01936p"
FT                   /note="similar to uniprot|P08456 Saccharomyces cerevisiae
FT                   YER026C CHO1 phosphatidylserine synthase"
FT                   /db_xref="GOA:C5DLM8"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR016271"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM8"
FT                   /protein_id="CAR24689.1"
FT                   /translation="MSKRGEQVPREEATQDLGGAVSSDAEDDAFTASRTPSRRASSIFS
FT                   LDNPPLEPPNESDIRKFTSDEYHFNMIRNLHLADLITMMNGFSGFYSIVSCLRFTLTGK
FT                   PHYVQRAHFFILLGMFFDFFDGKVARLRNRSSLMGQELDSLADLVSFGVAPASIAFAIG
FT                   FQTTLDVLVLSFFMLCGLTRLARFNVTVAQLPKDVSGKSKFFEGLPIPTSLALVGAMAY
FT                   LVSKGLILEKLPFGLFAAGEWYELHPAVLLFGIQGCGMISKSLKIPKP"
FT   gene            complement(<152104..>152175)
FT                   /locus_tag="KLTH0G01958r"
FT                   /old_locus_tag="Klth0G.tHis.GTG.32"
FT   tRNA            complement(152104..152175)
FT                   /locus_tag="KLTH0G01958r"
FT                   /old_locus_tag="Klth0G.tHis.GTG.32"
FT                   /note="tRNA-His (GTG) cove score=64.62"
FT   gene            complement(<152313..>154550)
FT                   /locus_tag="KLTH0G01980g"
FT                   /old_locus_tag="KLTH-ORF4873"
FT   CDS_pept        complement(152313..154550)
FT                   /locus_tag="KLTH0G01980g"
FT                   /gene_family="HOG000208879" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4873"
FT                   /product="KLTH0G01980p"
FT                   /note="similar to uniprot|P09620 Saccharomyces cerevisiae
FT                   YGL203C KEX1 Protease involved in the processing of killer
FT                   toxin and alpha factor precursor cleaves Lys and Arg
FT                   residues from the C-terminus of peptides and proteins"
FT                   /db_xref="GOA:C5DLM9"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLM9"
FT                   /protein_id="CAR24690.1"
FT                   /translation="MSHFKYRNQTTDICNAAALDAFAMYSNYSVPLALLFALLLSFQTA
FT                   RALKAADEYAVSPDLIPGLSQAEDRALVPTMHAGHIPLDENNDEHTKNYFFWKFHDESG
FT                   SASGPARDTLIFWLNGGPGCSSMDGALMESGALRIDSDGKAYLNRGGWHTRGDIVFVDQ
FT                   PAGTGFSTVASDNDYDNDLKVVSEHFVAFLRNYFQVFPDDAGKQVVFAGESYAGQFIPY
FT                   FARAVLDQDEVQVNLQALLIGNGWIDPNQQSLYYIPFAVEKGLITQDDPSFSYLLKQQE
FT                   NCQNKINSKENDRFSFKECENILNNLLEVTRKIKDSEGKKVPSDQQCINMYDLRLKDSY
FT                   PSCGMNWPQDLPNLGKFFGTEGVLEALHLDPEHVSQWHECDDKVSNYLKNPDSRASAAI
FT                   LPGLLEAGLEVMLFNGDQDIICNNMGVEAVISQMSWGGETGFSENVQLYDWVYRSPENS
FT                   EITPAGFVKYDRNLTFMSVYNASHMVPFDNALVSRGVVDLFLNDVDLVQIDGRDTLITD
FT                   DVNKGKDGDASETDDTTELDCEGKDKLSEECKQLNASKGQNGESDKDEGEKGNEEDDND
FT                   DTEDGKKDAGDEKDDGEKDDDEKDGDEKDGDEKDEEDDDDKDENEKDEEDDDKDGDKPE
FT                   GKNNDGAEDEDDDHNSGSHLAVTMICLLVSGTIIGGLYFTFRDRFRPRLRAILVDPTNR
FT                   SEASKKTVSWAADLEQDAADLSNPENGAKKKGPYTSVPTQESRDSFELDNL"
FT   gene            <155219..>156709
FT                   /locus_tag="KLTH0G02002g"
FT                   /old_locus_tag="KLTH-ORF4868"
FT   CDS_pept        155219..156709
FT                   /locus_tag="KLTH0G02002g"
FT                   /gene_family="HOG000223057" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4868"
FT                   /product="KLTH0G02002p"
FT                   /note="highly similar to uniprot|P53090 Saccharomyces
FT                   cerevisiae YGL202W ARO8 Aromatic aminotransferase
FT                   expression is regulated by general control of amino acid
FT                   biosynthesis"
FT                   /db_xref="GOA:C5DLN0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN0"
FT                   /protein_id="CAR24691.1"
FT                   /translation="MTVGESLDFSHLYSEETKSRKSSPLKTCIHLFQDPNIVFLGGGLP
FT                   LSKYFPWENLQAESPLPPFPNGIGAAPSGDAKDTCVTSIPKDGTSKAGDTNDIPLSRAL
FT                   QYGFSMGQPEYLSFVREHTQLVHKMQYEDWDVLATIGNTGSWESTLRIFCNRGDTILAE
FT                   KYTFSSSVYAAEAQGVNVFPVPLDADGLIPERLEAILDNWNPETPKPKLLYTIPTGQNP
FT                   TGSSLSDDRKKEIYRIAQKHDFIIIEDEPYYFLQMDAYEKDPSKRKAIEFASHDEFVNS
FT                   LAKSFISLDTEGRVIRMDSFSKVLGPGTRLGWLVGSKRILRAYTQLHEMTIQNPSGFSQ
FT                   AIVSGTLNRWGQHGFLDWLIGLRQEYNEKRDVAIDALYKYVPSTPALTVTPPIAGMFFT
FT                   VNIDASAHPEFATKYQSKPELVEQAIYEKVIACGVLVVPGIWFKADGETTPAQPKESKA
FT                   EPNPNGIFFRGTYAAVPLDKLQDGIKRFGIALKEEFGL"
FT   gene            complement(<156778..>158406)
FT                   /locus_tag="KLTH0G02024g"
FT                   /old_locus_tag="KLTH-ORF4863"
FT   CDS_pept        complement(156778..158406)
FT                   /locus_tag="KLTH0G02024g"
FT                   /gene_family="HOG000259757" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4863"
FT                   /product="KLTH0G02024p"
FT                   /note="similar to uniprot|P36035 Saccharomyces cerevisiae
FT                   YKL217W and to gnl|GLV|KLLA0F10043g Kluyveromyces lactis
FT                   KLLA0F10043g"
FT                   /db_xref="GOA:C5DLN1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN1"
FT                   /protein_id="CAR24692.1"
FT                   /translation="MTRNSFASSSNSVVETEGSKCCVERKPRAQHQVTWAEVQEYLRTR
FT                   FTTLVPTRQKLREARSKYALNPFPALRHMNARQTQFFIVGFLAWTWDALDFFAVSLNMS
FT                   AIAKDLDKSIKDMSNAITLVLLLRVIGAVIFGYLGDRYGRKLPYCISMFLIIVVQIGTG
FT                   FVKTFPAFLGCRAIFGIVMGSIFGVASATALENAPEESRSILSGIFQEGYALGYLLGVI
FT                   FKRAIVDNSPHGWRSFFWFSAGPPALFIVWRLLLPESEVYTRRMNESKRVAQEQEKTNS
FT                   SQFWQNVKVALIQHWMTLVYLVILMAMFNFSSHGSQDLFPTMLTNQYNYSDDASTVTNS
FT                   VANIGALVGGILVAHVSSFIGRRCAIVICCIGGGALLYPWGFVSNPKGLNPAVFFLQFF
FT                   VQGAWGVVPIHLTELSPVEFRAFVTGVAYQMGNMISSASSTIEATIGERFPIDGKEGVY
FT                   DYGKVMCIFMGCVFAGLLITTVLGPENKGGELLIDERVLDTRGALNNVGDFDLEHADTF
FT                   SLPKPSVEQIADVERNSENSDRAPK"
FT   gene            complement(<158828..>161563)
FT                   /locus_tag="KLTH0G02046g"
FT                   /old_locus_tag="KLTH-ORF4858"
FT   CDS_pept        complement(158828..161563)
FT                   /locus_tag="KLTH0G02046g"
FT                   /gene_family="HOG000278444" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4858"
FT                   /product="KLTH0G02046p"
FT                   /note="highly similar to uniprot|P06738 Saccharomyces
FT                   cerevisiae YPR160W GPH1 Non-essential glycogen
FT                   phosphorylase required for the mobilization of glycogen
FT                   activity is regulated by cyclic AMP-mediated
FT                   phosphorylation expression is regulated by stress-response
FT                   elements and by the HOG MAP kinase pathway"
FT                   /db_xref="GOA:C5DLN2"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN2"
FT                   /protein_id="CAR24693.1"
FT                   /translation="MSFGRRPSLSNDLISEDPNAPHVPRLTRRLTGFLPQEIKAIETTI
FT                   PAQSREIWNKHKVQKFNTADEFQERFISHVEWTLARSLYNCDDLAAYQATSQSVRDNLV
FT                   IDWNKTQQRQTARDPKRVYYLSLEFLMGRALDNALINMRTDTDVRDVGDTDETLTKGNT
FT                   SREMIKNAMNELGFKLEDILDEEPDAALGNGGLGRLAACFVDSMATGNYPAWGYGLRYQ
FT                   YGIFAQKIINGYQVETPDYWLNFTNPWEIERAEIQVPINFYGYVDRGQNEKSTLEPSDW
FT                   IGGERVLAVPYDMPIPGFKTSTVNNLRLWSAKPTTEFDFKKFNNGDYKNSVEEQQRAES
FT                   ITAVLYPNDNFLQGKELRLKQQYFWCAASLHDIVRRFKKGKRAWSEFPDAIAIQINDTH
FT                   PTLAIVELQRILVDLEKLDWHEAWKIVTSTFAFTNHTVMQEALEKWPISLLGRLLPRHL
FT                   EIIYDINWFFLQDVEKKFPHDMDLLSRVSVIEESSQERQVRMAYLAIIGSHKVNGVAEL
FT                   HSDLIKTTIFKDFVKIYGSNKFTNVTNGITPRRWLKQANPKLAQLISETINDPEDNYLL
FT                   DMSKLTQLSKYAEDEKFQKKWNDVKQFNKQRLADLIKKLNNGVDIIERDHIRNTLFDIQ
FT                   VKRIHEYKRQQMNIFGVIHRYLTMKELLQSGASIEEVVKKYPRKVSIFGGKSAPGYYMA
FT                   KLIIKLINSVADVVNNDKEIQDLLKVYFIPDYNVSKAEIITPASDLSEHISTAGTEASG
FT                   TSNMKFVMNGGLIIGTVDGANVEITREIGEDNIFLFGNLAENVDELRYKHQFHNEGVPA
FT                   SLAKVLDAMQNGAFSPQNHSEFMPLIDSIKSHGDYYLVSDDFEAYISTQELVDQVYHKD
FT                   KKEWLKKSILSVANIGFFSSDRCIEEYADTIWNAEPVKPE"
FT   gene            complement(<162461..>165571)
FT                   /locus_tag="KLTH0G02068g"
FT                   /old_locus_tag="KLTH-ORF4852"
FT   CDS_pept        complement(162461..165571)
FT                   /locus_tag="KLTH0G02068g"
FT                   /gene_family="HOG000224130" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4852"
FT                   /product="KLTH0G02068p"
FT                   /note="similar to uniprot|P53091 Saccharomyces cerevisiae
FT                   YGL201C MCM6 Protein involved in DNA replication component
FT                   of the Mcm2-7 hexameric complex that binds chromatin as a
FT                   part of the pre-replicative complex"
FT                   /db_xref="GOA:C5DLN3"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008049"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN3"
FT                   /protein_id="CAR24694.1"
FT                   /translation="MSSPPRNSGANLSSTFNDDSPAGNPNIPSSAPPTHHSSPPYSSMS
FT                   GNYAGSAHFGEDEIGSGPSGATPAFPSSSRSIGGPDRSSQPQMGSSQHFEREEGDVEQE
FT                   ELPLDGVRRRNLNTIKKVDDVTGEKVREAFEHFLEDFTIESQDDGQEPQAVKAYRSQIE
FT                   FMRVYDLNTIYIDYQHLSTRENGALAMAISEQYYRFLPFLQKGLKRVIRRHAPQLLFTA
FT                   DSVSQNPGGLDTQNTSNADSYTQESQGTGESVPRGGNPSSGFATGASTAGSPEQTERVF
FT                   QISFFNLPTINRIRDIRAEKIGSLMSISGTVTRTSEVRPELFKASFTCEMCRAVVDNVE
FT                   QVFKYTQPTYCPNPSCENQAFWTLSVGRSKFLDWQKARIQENANEIPTGSMPRTLDVIL
FT                   RGDCVERAKPGDRCKFTGTEIVVPDVTQLGLPGVKPSSSMDTRGLARSSEGLNNGVSGL
FT                   KSLGVRDLTYKISFLACHVAPTGKDATSGADTRDEGTELLNLQVNSSGNDDERDQEVFL
FT                   NSLNPQEINELKEMVKDEQIYDKLVRSIAPAVFGHNTVKKGILLQMLGGVHKTTVEGIN
FT                   LRGDINICIVGDPSTSKSQFLKYVCSFAPRAVYTSGKASSAAGLTAAVVKDEEAGDFTI
FT                   EAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAA
FT                   NPVAGRYNRKLTLRGNLNMTAPIMSRFDLFFVVLDDCNEKIDTELAAHIVDLHMKRDEA
FT                   IDPPFTADQLRRYIKYARTFKPLMNEEARNYLVEKYKELRRDDAQGFSKSSYRITVRQL
FT                   ESMIRLSEAIARANCVDEISPNFVAEAYDLLRQSIIRVDVEDVDVTGDSDDESNEGGND
FT                   GGNDSGNDSDGHGDSGDQVASQRSSEEPLETRETPLPSESGHGDKKGKVTISYDKYAAM
FT                   INLIVQKVAQEDRDGGAELTAADIVDWYLLQRENEINSESEYWQERKLAFKVIKRLVKD
FT                   KILMQVQGNMQALADHEGDHPISERVVYVIHPNCAVLDNIVGPSRQG"
FT   gene            complement(<165811..>165881)
FT                   /locus_tag="KLTH0G02090r"
FT                   /old_locus_tag="Klth0G.tGly.GCC.31"
FT   tRNA            complement(165811..165881)
FT                   /locus_tag="KLTH0G02090r"
FT                   /old_locus_tag="Klth0G.tGly.GCC.31"
FT                   /note="tRNA-Gly (GCC) cove score=62.63"
FT   gene            complement(<166538..>168667)
FT                   /locus_tag="KLTH0G02112g"
FT                   /old_locus_tag="KLTH-ORF4850"
FT   CDS_pept        complement(166538..168667)
FT                   /locus_tag="KLTH0G02112g"
FT                   /gene_family="HOG000164283" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4850"
FT                   /product="KLTH0G02112p"
FT                   /note="similar to uniprot|P32486 Saccharomyces cerevisiae
FT                   YPR159W KRE6 Protein required for beta-1 6 glucan
FT                   biosynthesis putative beta-glucan synthase appears
FT                   functionally redundant with Skn1p"
FT                   /db_xref="InterPro:IPR005629"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN4"
FT                   /protein_id="CAR24695.1"
FT                   /translation="MSVRNLTSNTREQQASYSGGDQGNASASQNVPVRNPFTDDAEDDT
FT                   YASYSASDTSLLHHDDGASATDAAGAAGSAAVGSRDVSDYKGYYSKGAAGARLTPGSRA
FT                   GPAALPSSSSLSSHTGISNNDITAPPGFDRYPVVGSRVASMAPVGGAAAVGAAGAAAHN
FT                   GSHNNSSASISSSDPFISDQDFSPFGGYPTSSFPLHLDEKEDDDYLHNPDPEEEARLDN
FT                   SKFMLDFKHMDRRSAGGFFGFLFLFLGALTLFVVLPVLTFTGAVDHGKPQTITYLSLYE
FT                   YPQLSAIRTSLVDPDTPTSAKTWKAKDGSEWPLAFSDEFNAEGRTFYDGDDQFWTAPDF
FT                   HYAATHDLEWYSPDAVTTANGTLKLRMDAYKNHDLYYRSGMLQSWNKLCFTQGYIEASA
FT                   NLPNYGRVIGLWPGMWTMGNLGRPGYLASTEGVWPYSYEACDAGITPNQSSPDGISYLP
FT                   GQKLSSCTCDGEDHPNQGVGRGAPEIDIIEGSADTYIGGSGVGVASQSLQLAPFDIWYM
FT                   PDYDFIEIHNSTVTAMNTYAGGPFQQAVSAVTALNVTWNEFGPDAGYFQSYGFEYLNDH
FT                   DTGYIRWFVGQQPTMTIHSTALHPNGNINWRPISKEPMSIILNLGISNNWAYIDWNSIF
FT                   FPVTMSIDYVRIYQPENATSITCDPSGFPTYQYIQDHLNVYSNVNLTSWEDAGYTFPKN
FT                   TLTGNCKSSKKNKDY"
FT   gene            complement(<169262..>169342)
FT                   /locus_tag="KLTH0G02134r"
FT                   /old_locus_tag="Klth0G.tLeu.GAG.30"
FT   tRNA            complement(169262..169342)
FT                   /locus_tag="KLTH0G02134r"
FT                   /old_locus_tag="Klth0G.tLeu.GAG.30"
FT                   /note="tRNA-Leu (GAG) cove score=65.59"
FT   gene            complement(<169670..>170752)
FT                   /locus_tag="KLTH0G02156g"
FT                   /old_locus_tag="KLTH-ORF4842"
FT   CDS_pept        complement(169670..170752)
FT                   /locus_tag="KLTH0G02156g"
FT                   /gene_family="HOG000190858" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4842"
FT                   /product="KLTH0G02156p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5DLN5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN5"
FT                   /protein_id="CAR24696.1"
FT                   /translation="MWLSAGTPFIGAIVLGILKPQGPSELLVQSFKMPSKSQSLMGQDG
FT                   VRTFQDMLYQHARAMSHVSVYYATEEVGVSELLHTLVQVLKKGSKLVFLGSGKSFKIIL
FT                   KTVAMLTSLGIDSRYLHPSEALHGDMGAVRPGDALVVCSSSGETQELVQFLEHAGRVLE
FT                   PSVKVLVTSSTQSTLHALVDQVLYVPQPVQFQEKTLQDGLPSPTVSTTLMLTVLDCFCL
FT                   ALTELYFDGDTARRREFFRKMHPGGGIGKQSQVPVPVPVPVLMPMALHKDAVGAPIDST
FT                   VCGHVPDGASESEFLQSIVQFDYCVVAGVRYDSHVLQHRYREWKRSMPAFPLKYSADRS
FT                   WNLAALLASAVVAANQADSM"
FT   gene            complement(<170898..>170970)
FT                   /locus_tag="KLTH0G02178r"
FT                   /old_locus_tag="Klth0G.tAla.AGC.29"
FT   tRNA            complement(170898..170970)
FT                   /locus_tag="KLTH0G02178r"
FT                   /old_locus_tag="Klth0G.tAla.AGC.29"
FT                   /note="tRNA-Ala (AGC) cove score=70.00"
FT   gene            complement(<171670..>172959)
FT                   /locus_tag="KLTH0G02200g"
FT                   /old_locus_tag="KLTH-ORF4836"
FT   CDS_pept        complement(171670..172959)
FT                   /locus_tag="KLTH0G02200g"
FT                   /gene_family="HOG000095276" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4836"
FT                   /product="KLTH0G02200p"
FT                   /note="some similarities with uniprot|P53286 Saccharomyces
FT                   cerevisiae YGR142W BTN2 Cytosolic coiled- coil protein that
FT                   modulates arginine uptake interacts with Rhb1p possible
FT                   role in mediating pH homeostasis between the vacuole and
FT                   plasma membrane H( )-ATPase may have a role in
FT                   intracellular protein trafficking"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN6"
FT                   /protein_id="CAR24697.1"
FT                   /translation="MFHFNQSPCIFDREPAVEGFLPFTVAPDQKRRRVCCQPFYNNAMK
FT                   RDRKGIRFDVTENQQEYVLSVYKNVAEDTMSKAICDQLQKLRNDRPPTYHVVRDFFGNE
FT                   YYVQDHEDDEDFMRHAIANLDLSPIKRQVARQVFRDYEITLNHRGDELVLMSRKDGLFK
FT                   EFSLGIEFEDVSVKGFDMISESVAVLKIGIKKAQKEVPQMYHIEFQPSSNDTQQQEKIE
FT                   QQEQQKLIEAAQEEELAKREAAATLKQRERAQAAHYAQIKKQEELARKERAALREREEQ
FT                   RAIEAATLRKREEQREREVAALKKHEEEERAREQEAAQREEKRHAISQKKAFLVEQKRK
FT                   RRQQERQRRAKSQKNEKQPEKKNISPSDSPHNVVININFPNAVSEKTSEKSRGRSRSPV
FT                   VLEDVDDEEEFRYRRSLDKSPRGSSIIDDM"
FT   gene            complement(<173533..>174849)
FT                   /locus_tag="KLTH0G02222g"
FT                   /old_locus_tag="KLTH-ORF4833"
FT   CDS_pept        complement(173533..174849)
FT                   /locus_tag="KLTH0G02222g"
FT                   /gene_family="HOG000000935" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4833"
FT                   /product="KLTH0G02222p"
FT                   /note="similar to uniprot|P53285 Saccharomyces cerevisiae
FT                   YGR141W VPS62 and similar to uniprot|Q06466 Saccharomyces
FT                   cerevisiae YPR157W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR009291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN7"
FT                   /protein_id="CAR24698.1"
FT                   /translation="MSLALLLFLLQGVCAVIVPWLDNDPFAESTETHKLDLGYPPVLSP
FT                   DEITDDTRSLPHEGFVPQFVIDNCPLVHLYSEEEYWPADISDFVRHFNIQLSNGSVLQE
FT                   HPLDLQDLKSKIQGPAGAISGRETYLSSVDDFDKDPRWLLGHEPDYGSGQIKNAPAILI
FT                   VVDKGNGWVDAFWFYFYSFNLGPFIMGYGPWGNHVGDWEHSLVRFFEGEPKYLWMSAHG
FT                   GGGCYRFDAIEKKTRVQYSNNHRTSKILQRPLIFSARGTHANYASVGQHAHDVPFFFSA
FT                   LSDFTDRGPLWDPSLNYLAYTYNGTVVTPVSDRERELGTKWLHYMGHWGDKQLPWSDPR
FT                   QRWCPVQWRYIDGPRGPLAKNLGRTSLCQRSKWFNFWGGCPARRKIKRGQGLDAEHNDL
FT                   VGDNCGILLYRVRPKWLRTLMRLIMWRGIACFIMDYFTG"
FT   gene            complement(<175051..>177507)
FT                   /locus_tag="KLTH0G02244g"
FT                   /old_locus_tag="KLTH-ORF4828"
FT   CDS_pept        complement(175051..177507)
FT                   /locus_tag="KLTH0G02244g"
FT                   /gene_family="HOG000111344" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4828"
FT                   /product="KLTH0G02244p"
FT                   /note="weakly similar to uniprot|P32504 Saccharomyces
FT                   cerevisiae YGR140W CBF2 Essential kinetochore protein
FT                   component of the CBF3 multisubunit complex that binds to
FT                   the CDEIII region of the centromere Cbf2p also binds to the
FT                   CDEII region possibly forming a different multimeric
FT                   complex ubiquitinated in vivo"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN8"
FT                   /protein_id="CAR24699.1"
FT                   /translation="MPDVPSRPMDPHLHIKALVDTLAPRTAHQYKLYHTKFIQWCRDNK
FT                   LLRRDPGADHPYRDIVVTATLVHCFVLSQYVCVSDSQFSASVLRKMISAFKFLHRVCCA
FT                   YEPDYPYELDHDYLEAVARLHVSASAENPPFSPLHLVSVNMWTPHSNRLSEKYFKGGLE
FT                   RLRFLVDFHVQQYWHLPFADRARLKLGDLRFAADPGMLHVVRQGQHGADAPETVQQLAL
FT                   LPQRVPWICPLVSLAAYLYLRFYGAPKAYKGDGFPDLLGADEWAFLPMVRGKSLDKYPR
FT                   EETMTNYYAHVFRHCHLPYKRREYFYNKSVDYCQYPEIRRTELDQLQEIAPAQQRELFP
FT                   HLIPLDFLRHMNHFPVYEPPSENHYADLANVPKSLLVQVFPEIEEYKRSSIPLGEQAQH
FT                   FIDALQLLRSALVSALPLFYHFFPEHDLFKDPMFQNAEFQGYFHQKIEQLRATDQLQSY
FT                   DPAAFGLVEAERDFAAPSQPPQALNVPPSADTQDLQIYLRDQTFRMVQFQTTSNFHLLL
FT                   QSLSRIFEKLETKKSNREYIIHQLGSLEQTLQDQIAASKPQDVKTEEETSSSSTNGPKQ
FT                   ETRESLPAGKLSRPAVFDSDAEDDDDYKEEDDNEDNDDEVDPNLQNELQALVSQVMDTR
FT                   FKSAVEQQTAQIERHVQSLISAQVKEEVRKQLAHLLNQQSSTPTPQPSQQPVTIAPKRP
FT                   REEQEPPSTAGESTFAMSPQLTSIEDIILEWFTPNPEQGNECVHTMNKKFGKTWRAGSQ
FT                   EATHLYKQRKLIIEFYICLVNQRQMDRYEAVAVCEKLRDNASIQEFSNMLKSWKKGHNN
FT                   SFDGLG"
FT   gene            <178663..>180597
FT                   /locus_tag="KLTH0G02266g"
FT   CDS_pept        178663..180597
FT                   /locus_tag="KLTH0G02266g"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0G02266p"
FT                   /note="highly similar to uniprot|P53283 Saccharomyces
FT                   cerevisiae YGR138C TPO2 Polyamine transport protein"
FT                   /db_xref="GOA:C5DLN9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLN9"
FT                   /protein_id="CAR24700.1"
FT                   /translation="MDSDQESINSFNSRDSYTQVPQTYVPSDATSARRAGRRSSASASS
FT                   AVGSDRLRLVPTETVKSLQDMGVTPEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVP
FT                   VATLQSLGRTQSAVSRTRTRVMREGAAARRRGSDAGSENEQKLTLSDHGSKSGSGSGEG
FT                   EGEGAAAGAPELDPEIEFVTFVTGDPENPHNWPLWLRWVYTILLSILVIAVAYGSACIT
FT                   GGLGTVSDKFHVSQEVSILTCSLMVLGFSLGPLIWSPVSDLLGRRVAYFISLGLYVIFN
FT                   IPCALAPNIGCLLACRFLCGVWSSSGLCLVGGSIADMFPPETRGRAIAFFAYAPYCGPV
FT                   FGPLVNGFISVATNRMDLIFWVNMAFAGVMWIIVALIPETFAPVILKRRAARLRKETGN
FT                   PKIMTEQEAQGLSVREMVQDCLLRPLYLAVTEPVLDLMCFYVCLIYSLLYAFFFAYPVI
FT                   FGELYGYKDNLIGLMLIPILIGASVALATTTFCENQYIKITRRRKPTPEDRLLGAMIGA
FT                   PFAAIALWILGATAYKHIIWVGPASSGLAFGYGMVLIYYSLNNYIIDCYAVYASSALAT
FT                   KVFLRSAGGAAFPLFTEQMYHKLGLHWASWLLAFISTAMVAIPFAFFHWGKDLRAKLSK
FT                   KNYAFSGME"
FT   gene            <181647..>182219
FT                   /locus_tag="KLTH0G02288g"
FT                   /old_locus_tag="KLTH-ORF4805"
FT   CDS_pept        181647..182219
FT                   /locus_tag="KLTH0G02288g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4805"
FT                   /product="KLTH0G02288p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP0"
FT                   /protein_id="CAR24701.1"
FT                   /translation="MFRNQSLIPSCHTLGASGAVVPVLSPECGLPQPEMRKGSAGHASA
FT                   GHSSSGSSGKGGSSSGSSGSSSGSSGSSSKGGSSSGSSGSSSKGGSSSGSSSSSNSGSG
FT                   GYYGGSSSGTYGGSSSGTYGGAAGGAAAGAAAGHAGTRGHHNSTSGSSQRNGAAVVSPS
FT                   WPRLLIFVFLLCSLTGVAPPATLDAHN"
FT   gene            <182450..>184267
FT                   /locus_tag="KLTH0G02310g"
FT                   /old_locus_tag="KLTH-ORF4801"
FT   CDS_pept        182450..184267
FT                   /locus_tag="KLTH0G02310g"
FT                   /gene_family="HOG000074730" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4801"
FT                   /product="KLTH0G02310p"
FT                   /note="similar to uniprot|Q12374 Saccharomyces cerevisiae
FT                   YPR155C NCA2 Protein involved in regulation of
FT                   mitochondrial expression of subunits 6 (Atp6p) and 8
FT                   (Atp8p) of the Fo-F1 ATP synthase functions with Nca3p"
FT                   /db_xref="InterPro:IPR013946"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP1"
FT                   /protein_id="CAR24702.1"
FT                   /translation="MFTDQFVLDAFEDIDAKLELALQQSSFVGQDHSSSNSDQLKKLQD
FT                   QLWLVKNEVVALTASLRQRRVRLPNIKLLKSVLESLQEDAPSDFVAVSDNVEGPVRAAI
FT                   IQYVTVCLYYCVVQKSLDQLPLVHDTAQYYSEIHDSTRWSLLYALQVAPQRLVHEANAV
FT                   KNDVSRSASWRAMGSLEARSIGTAWYHRLVEQCRKMVMVHNFQLVGVPRDAKKVVSSLW
FT                   ALPLAAVRDEVGTRRQAADTLFNSTASRLGALMTQFPATRDTEARVALLSTFFNHSRAS
FT                   SPGGSEKALLAVMPEVMTLAPASKIQAPGFLTRYWPTLLCSLAYGPSSAFALWQSRDKI
FT                   LQFFQENVVDFCAGLIQNWIWTPLQQVWSTVRHDESQPSIAVASKGSLDSEFSSLTRMV
FT                   VQLVAENSDGHVNTDALAVQVENGDLTEFMQIYERQIHHPVKNILTGKLVRSLLIQIQK
FT                   TKVDASLALNGIDKLLSSQQLVFGVVAMSPALLIVYSIWTCIYRLSKLGRIWSNVAQFR
FT                   FRLMSSMNNIERLLNYNVSEIESSDKDLNTGLLALEVVSARRYGEKLVPKKYRGQWTRD
FT                   VGELVDPGLNNTARLNVVNRIYHVYGRYL"
FT   gene            complement(<184383..>185084)
FT                   /locus_tag="KLTH0G02332g"
FT                   /old_locus_tag="KLTH-ORF4795"
FT   CDS_pept        complement(184383..185084)
FT                   /locus_tag="KLTH0G02332g"
FT                   /gene_family="HOG000195703" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4795"
FT                   /product="KLTH0G02332p"
FT                   /note="similar to uniprot|Q06449 Saccharomyces cerevisiae
FT                   YPR154W PIN3 Protein that induces appearance of [PIN ]
FT                   prion when overproduced"
FT                   /db_xref="InterPro:IPR000108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP2"
FT                   /protein_id="CAR24703.1"
FT                   /translation="MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPS
FT                   RGPQQPSATQGEFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFP
FT                   SNYVKPAFSGSTTTERPVVPPPPQYQSQQLVPQQTNASAQSAYSQPPFPPSSTNYYQPP
FT                   PQQYPQQYPQQQYYQAQQAPVAAPVAAPAAQQGHSSQASSAFKKFGGKLGNAAVFGAGA
FT                   TIGSDIVNSIF"
FT   gene            complement(<185220..>185769)
FT                   /locus_tag="KLTH0G02354g"
FT                   /old_locus_tag="Klth0G.mRNA.5765.m"
FT   CDS_pept        complement(join(185220..185343,185400..185693,
FT                   185765..185769))
FT                   /locus_tag="KLTH0G02354g"
FT                   /gene_family="HOG000213929" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0G.mRNA.5765.m"
FT                   /product="KLTH0G02354p"
FT                   /note="similar to uniprot|Q06HN0 Saccharomyces cerevisiae
FT                   YPR153W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP3"
FT                   /protein_id="CAR24704.1"
FT                   /translation="MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKF
FT                   TVFWTLILFMGFYTAAGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVT
FT                   YKAGLFEMSTWIPLCSAVVLILFHVSTTYSMAGIII"
FT   gene            complement(<185961..>186716)
FT                   /locus_tag="KLTH0G02376g"
FT                   /old_locus_tag="KLTH-ORF4790"
FT   CDS_pept        complement(185961..186716)
FT                   /locus_tag="KLTH0G02376g"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4790"
FT                   /product="KLTH0G02376p"
FT                   /note="highly similar to uniprot|P23638 Saccharomyces
FT                   cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
FT                   the only nonessential 20S subunit"
FT                   /db_xref="GOA:C5DLP4"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP4"
FT                   /protein_id="CAR24705.1"
FT                   /translation="MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIV
FT                   LAAERKVTSKLLEQGSSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNE
FT                   EIPVEILVRRLSDVKQGYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAI
FT                   SVGANTSAAQTLLQMDYKDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDNG
FT                   KIAQKIFKPQEIETLLNKTGVTKKENDDE"
FT   gene            <186986..>188374
FT                   /locus_tag="KLTH0G02398g"
FT                   /old_locus_tag="KLTH-ORF4789"
FT   CDS_pept        186986..188374
FT                   /locus_tag="KLTH0G02398g"
FT                   /gene_family="HOG000141866" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4789"
FT                   /product="KLTH0G02398p"
FT                   /note="similar to uniprot|Q06525 Saccharomyces cerevisiae
FT                   YPR152C Hypothetical ORF"
FT                   /db_xref="GOA:C5DLP5"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR002713"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP5"
FT                   /protein_id="CAR24706.1"
FT                   /translation="MHPRKMPRYWREYKTPDGTKYYYNVNTKRSTTDKPDDFEESQSFR
FT                   SKSRRVDPGVTFVVPLSNDWVLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLVDKN
FT                   KLVLLLATARGFDIGERDVYQELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNA
FT                   TEEPSQAVRTLISAYESSDEDGDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEAT
FT                   KQMFTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVI
FT                   EDPAHQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPSTLPRDLRSEQKQLFK
FT                   QFKIKESLGKKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLES
FT                   VLSQQDLPTSGFAIESQLLRLEDCIDIHGVSKALQDEVQYYVLGIKQKTTALKEFLKQL
FT                   NSEV"
FT   gene            complement(<188767..>189636)
FT                   /locus_tag="KLTH0G02420g"
FT                   /old_locus_tag="KLTH-ORF4788"
FT   CDS_pept        complement(188767..189636)
FT                   /locus_tag="KLTH0G02420g"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4788"
FT                   /product="KLTH0G02420p"
FT                   /note="similar to uniprot|P47137 Saccharomyces cerevisiae
FT                   YJR096W"
FT                   /db_xref="GOA:C5DLP6"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP6"
FT                   /protein_id="CAR24707.1"
FT                   /translation="MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYR
FT                   HVDTAQLYENERECATAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEM
FT                   AKELEYVDLFLIHNPCAETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEG
FT                   LEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPG
FT                   RTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPG
FT                   FDPIETED"
FT   gene            complement(<189819..>193160)
FT                   /locus_tag="KLTH0G02442g"
FT                   /old_locus_tag="KLTH-ORF4786"
FT   CDS_pept        complement(189819..193160)
FT                   /locus_tag="KLTH0G02442g"
FT                   /gene_family="HOG000111568" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4786"
FT                   /product="KLTH0G02442p"
FT                   /note="similar to uniprot|P53280 Saccharomyces cerevisiae
FT                   YGR134W CAF130 Part of the evolutionarily- conserved CCR4-
FT                   NOT transcriptional regulatory complex involved in
FT                   controlling mRNA initiation elongation and degradation"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP7"
FT                   /protein_id="CAR24708.1"
FT                   /translation="MVRKKRSAVISDPPRRPSALPAPAEPNGTPGSPVGQPSREPRAFT
FT                   DIDAQEKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVK
FT                   RWTSSTEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEVLVIDDEYNLLL
FT                   DFALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYK
FT                   YLSVLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNSDSDHWPQK
FT                   RLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLSSQFFTLCA
FT                   LVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINELHIDWRFHVCFNLQKIVQATLPRL
FT                   NCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAIYIIHKLYRDLP
FT                   AQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVAT
FT                   ILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLL
FT                   SDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVESRERIKEMRAYYKRCHCQ
FT                   FDDDELLPEDEEDGRPDASPYRVTRDAPPDNNVKLSNTSKPMALRSQKDSVEFDFNGRD
FT                   WRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQLLRVIATCVAKEQ
FT                   ELTVLRSALLLGETPESENHSTLVADGDLTTDFVYEKWCENSMFEKILFHNETLVWRMM
FT                   DEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRGEKAASDGDYAKVPFSRQGAI
FT                   VLSDIEIKMLLQEFFTNAAIFFSKQLRESLGDGEDDEDQGDDEKGSGISPHVVGLMKLV
FT                   CYMVKSLMQKEMFDFKDPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLE
FT                   SESIASACEPDSQSEPQLPQGTHAELEPEATHAVSIYNKKLMSLLPPAAGTENSAITAL
FT                   RSFISKHSLTTKTALFGRRVISQDDTIMPMYMSDREMDNRQFLAEFGIDYNDFVDGAYD
FT                   SDFVYD"
FT   gene            <194153..>195133
FT                   /locus_tag="KLTH0G02464g"
FT                   /old_locus_tag="KLTH-ORF4777"
FT   CDS_pept        194153..195133
FT                   /locus_tag="KLTH0G02464g"
FT                   /gene_family="HOG000239685" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4777"
FT                   /product="KLTH0G02464p"
FT                   /note="similar to uniprot|P53598 Saccharomyces cerevisiae
FT                   YOR142W LSC1 Alpha subunit of succinyl-CoA ligase which is
FT                   a mitochondrial enzyme of the TCA cycle that catalyzes the
FT                   nucleotide-dependent conversion of succinyl-CoA to
FT                   succinate"
FT                   /db_xref="GOA:C5DLP8"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP8"
FT                   /protein_id="CAR24709.1"
FT                   /translation="MLRTAASRRLASRCFSRETVPYDKTIGNLRLTKDTKVIIQGFTGK
FT                   QATFHAKLSQEYGTNIVGGTNPKKAGQTHLGQPVFATVAEAMKQTGATATGIFVPPPIA
FT                   AKAIREAIEAEIPLAVSITEGIPQHDMLYVAEMLKSQQKTRLVGPNCPGIISPEARVRI
FT                   GIQPSRIFKPGKIGIVSKSGTLTYEAVQQTTITGLGQTLVIGMGGDAFPGTDFIDTLKY
FT                   FMEDPATEGIVMLGEIGGKAEIEAAQFLKEFNLTRSNPMPVASFIAGAVAGQMKGVRMG
FT                   HSGAIVEGSGTDAESKKAALRDAGVAVVESPGHLGKALLDEFAKL"
FT   gene            complement(<195831..>195901)
FT                   /locus_tag="KLTH0G02486r"
FT                   /old_locus_tag="Klth0G.tGly.CCC.28"
FT   tRNA            complement(195831..195901)
FT                   /locus_tag="KLTH0G02486r"
FT                   /old_locus_tag="Klth0G.tGly.CCC.28"
FT                   /note="tRNA-Gly (CCC) cove score=62.22"
FT   gene            complement(<196658..>197587)
FT                   /locus_tag="KLTH0G02508g"
FT                   /old_locus_tag="KLTH-ORF4771"
FT   CDS_pept        complement(196658..197587)
FT                   /locus_tag="KLTH0G02508g"
FT                   /gene_family="HOG000248374" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4771"
FT                   /product="KLTH0G02508p"
FT                   /note="similar to uniprot|P35202 YOR143C Saccharomyces
FT                   cerevisiae THI80 Thiamine pyrophosphokinase"
FT                   /db_xref="GOA:C5DLP9"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR016966"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLP9"
FT                   /protein_id="CAR24710.1"
FT                   /translation="MESVVENTEELQFQPPAYSHVLDLNGFLSPHQNDSALLILNQKIM
FT                   VTGVFEKLWRNYFLHVCADGGANRLYEYFDNDEDRSRHIPDYIVGDLDSVREDVLRFYI
FT                   QKGVAIIRQTSQYATDFTKSLQLISLHFFSSSFHKVTRSSGIDTNYGIEDCHGIHTLYH
FT                   SERKIWVDRDVDLLVLNAIDGRFDQTIHSITQLYATARTDAYYRLCYLTTTDLIMLVPT
FT                   GGALIKYSKKFKEECIKNCGLLPVGKPSVIRATRGLKWDVENWPTSIISGKVSSSNRFV
FT                   GDTCCFFDVEDPMVLNIELNLEKLSMFM"
FT   gene            <197769..>198761
FT                   /locus_tag="KLTH0G02530g"
FT                   /old_locus_tag="KLTH-ORF4767"
FT   CDS_pept        197769..198761
FT                   /locus_tag="KLTH0G02530g"
FT                   /gene_family="HOG000205281" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4767"
FT                   /product="KLTH0G02530p"
FT                   /note="similar to uniprot|P06844 YDR392W Saccharomyces
FT                   cerevisiae SPT3 Subunit of the SAGA and SAGA-like
FT                   transcriptional regulatory complexes"
FT                   /db_xref="GOA:C5DLQ0"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ0"
FT                   /protein_id="CAR24711.1"
FT                   /translation="MDKYKYRVEIQQMMFVSGENNDPPVETTCLIEDIVRGQVIEILLQ
FT                   SNKTAHSRGSKSILPEDVIFLIRHDRAKVNRLRTYLSWKDLRKNAKDQDANAAAGGNSG
FT                   GGGDGPEGAVEEDDKKGDKDGGNMMRVKKSQIKLPWELQFMFNEQPLETNEDADDLDED
FT                   EREANVATLKRLKMADDRTRDMTKEEYVHWSDCRQASFTFRKGKRFKDWSGITQLTEGK
FT                   PHDDVIDILGFLTFEIVCALTETALKFKKREELLQLKKDKSQKSQPDVVQDSTRERKKR
FT                   LFDGPDNVVNPLKPKHVEDAWRALQTIDMKHRALTNFKGGRLSSRPAIM"
FT   gene            complement(<198794..>201187)
FT                   /locus_tag="KLTH0G02552g"
FT                   /old_locus_tag="KLTH-ORF4766"
FT   CDS_pept        complement(198794..201187)
FT                   /locus_tag="KLTH0G02552g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4766"
FT                   /product="KLTH0G02552p"
FT                   /note="some similarities with uniprot|Q12050 Saccharomyces
FT                   cerevisiae YOR144C ELG1 Protein required for S phase
FT                   progression and telomere homeostasis"
FT                   /db_xref="GOA:C5DLQ1"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ1"
FT                   /protein_id="CAR24712.1"
FT                   /translation="MTSPTPRKTVRLGTLLSGNRKPKIELASDLHSDVSTDDFLDSIET
FT                   SGIIDYDNNWTTGDSSPLRIELNNQKISCATDDVHLPQREPPHRTSLPFVGDCEIIAEP
FT                   GTPKLTVKQILSGKSQPGLGNKKTQPSSKTSCSKSEDLEVIHISDSGKNRETHERIMSG
FT                   LTCTKKTSVKKLFDNFQKRNRNQEEYQEIDEVELVSTTPVKPLHEVSSLDSMETPLPAS
FT                   QNVTDNTDYINARPLSLKKKNKSAPELVLNFDPHEYKSLNLSNKQSKTALQTLGLEASG
FT                   RRCSNKIWTEDFEPHDVENVILNDNLKRDVHSWLDKAFKKLRKKTTRNKLRKKKVEADD
FT                   EMDFFVVDDDLEEGDEQEEEFVPLMILSGEAVGKTTLLKSLMNSYSGQIFEINASGNRG
FT                   KRDFLQSVLDFSTTHYVKDKGSKGLILFDDVDVLFRERDKLFWNAVEKLLIKARRPVVL
FT                   ICRDINYIPLNILQVAQEENSLFQAKAIDFPKAVDQLQQFLTSRGLLWPREFLEHIIKL
FT                   NMCDIRKCLMELQWMSLSDHTSERTVEPVVPPQDIASALFSSTLLSEQDVILRGIQWKS
FT                   NLEQDRDSTVYFASKSKDFVSFSDEQKLAFDYMVDYKQHLHDSLKRPLMPFEMDVTEYL
FT                   RSRVFDPNEQQECGNHIFQKAAMETIHYLKSRVSETASFNEDHGGNARMTRNSRKVKEI
FT                   MDRFSENGDHVRSSFNDYFMNLTSVMTRSQICQDVIPLVCEVAKHDKARKAQNRLIYQN
FT                   AMTGVPPENEREVVIRLLQEHAFYPIWFKGEPDLLLSAWSFRPL"
FT   gene            complement(<201390..>202205)
FT                   /locus_tag="KLTH0G02574g"
FT                   /old_locus_tag="KLTH-ORF4765"
FT   CDS_pept        complement(201390..202205)
FT                   /locus_tag="KLTH0G02574g"
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4765"
FT                   /product="KLTH0G02574p"
FT                   /note="similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
FT                   YOR145C PNO1 Partner of Nob1 Protein required for cell
FT                   viability"
FT                   /db_xref="GOA:C5DLQ2"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ2"
FT                   /protein_id="CAR24713.1"
FT                   /translation="MVAPTALKKAQNDTAGSNTAGSTNSRIFGLENTQQIDEDDDDEVL
FT                   VDAQEASEGAAAPEDKTVESNSVVLDEQGKPRFASAAASGEMKVKPESRKVPVPPHRMT
FT                   PLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKAFTLGF
FT                   DLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATRTRIV
FT                   LADSKIHILGGFTHIRMARESVVSLILGSPPGKVYGNLRTVASRLKERY"
FT   gene            <202425..>204206
FT                   /locus_tag="KLTH0G02596g"
FT                   /old_locus_tag="KLTH-ORF4763"
FT   CDS_pept        202425..204206
FT                   /locus_tag="KLTH0G02596g"
FT                   /gene_family="HOG000113511" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4763"
FT                   /product="KLTH0G02596p"
FT                   /note="similar to uniprot|Q12171 Saccharomyces cerevisiae
FT                   YOR147W MDM32 Mitochondrial Distribution and Morphology"
FT                   /db_xref="GOA:C5DLQ3"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ3"
FT                   /protein_id="CAR24714.1"
FT                   /translation="MISNARRHLRVLSTRPNVSRTCVYGLCGLNKYYNLRPQAKLCVTN
FT                   RLYSTKKDLNELSKNTDFLHTQNILLQKNQQRLTKQKLLSEATNFFERFTIKTKWFLIR
FT                   GNRPFSTDELSTIFSWLVISQILWVVLGTTTFVSLLLFTFNTVFAKEMVGKFVGNLLND
FT                   YVDDCDIQFRDALVPEWRRGCISFKQVKLKSSSPSQGEGLRKEDSSEALSFSLDFNQID
FT                   ITLSFTKWFRGHGLINDLTLYGMKGEVALGQGVDQDLLISWFSNPRYHLGKVKVRDSCI
FT                   NVLDRNLNQNYRMSIYNMDLPQLRFKWALIDFFNANVVTGAINHSLFSVHKRQHKLAYL
FT                   QDFEHDLSPWKRITRLRLDEISVKDLGLDKSNSFNWVEDGQVEIIADVMLPDIPEDEDY
FT                   DYDENRYIVMDMKFKFKDLMARYPSEEPKLSNGDALATLDELRPLIAFVNTQRGLFHSF
FT                   MDIQNTNSIWNNIANVSIKKNKSYPDTTVIPSNVKWPEYEDPNRPGQEIIKYHDQPVHN
FT                   NNEIVLRSRIVKNIDELKDLVLFRETGIYDTLSMELHVDLMRMVEEWEHRKKNDWKRVW
FT                   GTTVASQLMILGLGAMV"
FT   gene            complement(<204285..>204941)
FT                   /locus_tag="KLTH0G02618g"
FT                   /old_locus_tag="KLTH-ORF4762"
FT   CDS_pept        complement(204285..204941)
FT                   /locus_tag="KLTH0G02618g"
FT                   /gene_family="HOG000154395" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4762"
FT                   /product="KLTH0G02618p"
FT                   /note="some similarities with uniprot|Q02521 Saccharomyces
FT                   cerevisiae YOR148C SPP2 Required for final stages of
FT                   splicesome maturation promotes step 1 of splicing
FT                   spliceosome-associated protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ4"
FT                   /protein_id="CAR24715.1"
FT                   /translation="MVGFSINLKAGKVSKKTASSEKKKKRANIFNDADANKVPKSKIRI
FT                   THIDEHQNSAEPQLVIKPPPANKGWNVPIVDENGRDEESLGYGLNQSTSGARDLRRQHN
FT                   REALALSRKPNSVVHLPTETAQEEYETVPVEEFGDALLRGMGWNGELENEVVAKSAGKS
FT                   KPVLPHEQFRPSLLGLGAKASQNTVSEGINKSEPFLPIIKVSRRRGKPIEEQQLT"
FT   gene            <205070..>206398
FT                   /locus_tag="KLTH0G02640g"
FT                   /old_locus_tag="KLTH-ORF4761"
FT   CDS_pept        205070..206398
FT                   /locus_tag="KLTH0G02640g"
FT                   /gene_family="HOG000154316" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4761"
FT                   /product="KLTH0G02640p"
FT                   /note="similar to uniprot|Q04172 YDR393W Saccharomyces
FT                   cerevisiae SHE9 Mitochondrial inner membrane protein
FT                   required for normal mitochondrial morphology"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ5"
FT                   /protein_id="CAR24716.1"
FT                   /translation="MLVRRLILLYPRRLPRQITSIRLNSTLPEGSKKKHDKVAKDSNFP
FT                   ALEPAWSEVRAKIASANAQAKHYTGQFKNQIDKAKAAIQEANRKLAEEDRSASDSRLGF
FT                   DTDVETKGRIEGLPSARERSRMQWAKKLEFYLDSLQETIFTATKALNDVTGYSSIQKLR
FT                   KSIELMEKDLEKRKEEVRVAKTTFNEAIVARAESQREVNELLQRKNSWSPADLERFTHL
FT                   YTDDTLNLKKEEDAKRTLQSAESQEEALSNNLYRAILTRYHEEQIWSDKIRRTSTWGTF
FT                   LLMGMNIFLFLVFQLLLEPWKRRRLVGNFEDKVKKALDEQALVQNNRLNEMSDHISTTF
FT                   DKKNAAPEPIVPATSRDTAEFMELSPKEPDALVPIKWKSWPEISYVFKQNFRILRNWTH
FT                   RFFQKLLFIKKTNLNSTTTFTTAELYVYSALVGIAGYLTCAWI"
FT   gene            <206550..>207827
FT                   /locus_tag="KLTH0G02662g"
FT                   /old_locus_tag="KLTH-ORF4759"
FT   CDS_pept        206550..207827
FT                   /locus_tag="KLTH0G02662g"
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4759"
FT                   /product="KLTH0G02662p"
FT                   /note="highly similar to uniprot|P33298 Saccharomyces
FT                   cerevisiae YDR394W RPT3 One of six ATPases of the 19S
FT                   regulatory particle of the 26S proteasome involved in the
FT                   degradation of ubiquitinated substrates substrate of N-
FT                   acetyltransferase B"
FT                   /db_xref="GOA:C5DLQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ6"
FT                   /protein_id="CAR24717.1"
FT                   /translation="MEELGILSTPTSGSGETAPIGSYGSLVAQLNSNAGSAINGSSDNY
FT                   FRLKKLEKELELLNLQEDYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQFLEPIDENT
FT                   GIVSSTTGMSYVVKILSTLDRELLKPSTSVALHRHSNALVDILPPDSDSSISIMSANEK
FT                   PDVSYSDVGGLDMQKQEIREAVELPLVQADLYQQIGIDPPRGVLLYGPPGTGKTMLVKA
FT                   VANSTNVAFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIATKRFDA
FT                   QTGSDREVQRILIELLTQMDGFDQSINVKVIMATNRADTLDPALLRPGRLDRKIEFPSL
FT                   RDRRERRLIFGTVAAKMALAPEVDLDSLIIRNDPLSGALIAAIMQEAGLRAVRKNRYVI
FT                   LQSDLEEAYASQVKSSSDVDKFEFYK"
FT   gene            complement(<207890..>209416)
FT                   /locus_tag="KLTH0G02684g"
FT                   /old_locus_tag="KLTH-ORF4756"
FT   CDS_pept        complement(207890..209416)
FT                   /locus_tag="KLTH0G02684g"
FT                   /gene_family="HOG000172163" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4756"
FT                   /product="KLTH0G02684p"
FT                   /note="similar to uniprot|Q04174 Saccharomyces cerevisiae
FT                   YOR149C SMP3 Protein involved in glycosyl phosphatidyl
FT                   inositol synthesis most likely an alpha 1 2
FT                   mannosyltransferase utilized for addition of the fourth
FT                   side-branching mannose onto the GPI core structure"
FT                   /db_xref="GOA:C5DLQ7"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ7"
FT                   /protein_id="CAR24718.1"
FT                   /translation="MRLKTWHVLGYLFGLIVALEPSYIHPDEHFQSLEVMMIKIMGIKG
FT                   TIPWEFKPESAARSFVPLYITYGPLLYLNKYILHLSSGVALMYLVRIQNYIVFMYLSKL
FT                   ALQFLLDSKLDRKKASFYISTSYIIWAYQTHSFSNSLESIILLLVLSLFRILIKDSSDR
FT                   SFNHYKTCVVLGILVTLGVFNRITFLAFILLPCVPTFHLFYSKHLKSLCVSAISFICSC
FT                   LLFVFLDKTIYGSDDWCVTPLNNLLYNLQDANLAQHGLHPRYTHVLVNVPQMLGPIMVF
FT                   FVSKKQKINLALLSCISGLLILSLFRHQELRFLVPLFPLFCISIDLEKLNTFPYPKLIA
FT                   KTWVAFNIVFGIIMGSLHQRGVVTAIQRLAEKQEHVDVHLWWKTYSPPTWLYMNNNLTV
FT                   STTNFVNSAERLDNVDFGITVDHVVDLKGCDYELFEFGLMSFLNSTSHGICLIIPKSTD
FT                   KGVQKFRTKHEDVRFQVLWETPFSLDLDHIDFTDLSTLQPGMTIYQIDRL"
FT   gene            <209656..>212508
FT                   /locus_tag="KLTH0G02706g"
FT                   /old_locus_tag="KLTH-ORF4755"
FT   CDS_pept        209656..212508
FT                   /locus_tag="KLTH0G02706g"
FT                   /gene_family="HOG000093618" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4755"
FT                   /product="KLTH0G02706p"
FT                   /note="similar to uniprot|Q04175 Saccharomyces cerevisiae
FT                   YDR395W SXM1 Nuclear protein; has similarity to Cse1p
FT                   homologs including Nmd5p, Cse1p,Lph2p, and the human
FT                   cellular apoptosis susceptibility protein, CAS1; also has
FT                   similarity to the karyopherin Kap95p"
FT                   /db_xref="GOA:C5DLQ8"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ8"
FT                   /protein_id="CAR24719.1"
FT                   /translation="MLDQNAILSAFNRTMASDAVAIKQAEQELFQMQKEPGFTAFLLNA
FT                   ATDESIPLNVRISCAIYMKNKIQRCWSSKRDDAILPQEQSVLKDTLIQSLIRNSENSHI
FT                   KPYLTESVRGILENNEKWDLILPINELLSSNDPKFVYPGLLLLFEVCIHHRWEMPDNRG
FT                   YIDEVIMRVFPVVERIASQLIQENDYRSNELLYLILKSFKYACLNNFPRYFTNTEKLQS
FT                   WIRLHLFLCSKPLPQEVLNLEPADRSLDKRVKCNKWAFGNLSRFLMKYSRTTKTVTKEF
FT                   VGYIFDQIVPTILGEYFKTIESWGSGSLWLSDASLYYMIEFLEKCMTTDSLWSLIQPHL
FT                   ESIITYVIFPCLSADEESVTLFEDDPEEYTRRYFDVNKEGTTADVASTDFIFVIGHKRF
FT                   EEVSKILPLINSVFNEFAEKKDLPSAYREEGALRLLSSLCGFLAENDSPVKNELEGIFE
FT                   HYVLPLLTQQKYPFLIARALETIAIHQQAFIDMNVLSKIYEAVYVNFMNSEYLPIQVEA
FT                   SDALKTLVVSNPSIHPHISSQVPGIMEKLLKLSKEFEIDILSEVMESFVERFADELTPF
FT                   AQDLAANLAEQFVMLGQSIVESSSGNYSTADQDQEIQASALLQTMTTMVMSMNKVSLVD
FT                   KFMPVVKFILVHAQITFLSEAVDLMDSLALSSKAMFNKFTPEIWEMLHDVLDSCQTYAL
FT                   EYFESFQVFFETVVTYGFPTDNTYAPAFLEVLSHAMGSEVDFDVESAFDILLFYVLAMK
FT                   ENPLFEKALTVAGNEDTELELDDALIVKLFLAGLFTTPLETLQICEQQGVTLDLLQKWF
FT                   SCNFSSVFTIKLQLVAIISVLGLPELPSCVSGFIPQLSDKLVSLTASLPDAIRKRDAVS
FT                   KGELGGSSFDGEDGTDFFEELEDDFKESCLDDISCFQQVHVLFSQLQSGNPGLYQQITG
FT                   SLSDDKLDTLKTILEFVAHN"
FT   gene            complement(<212646..>213140)
FT                   /locus_tag="KLTH0G02728g"
FT   CDS_pept        complement(212646..213140)
FT                   /locus_tag="KLTH0G02728g"
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0G02728p"
FT                   /note="highly similar to uniprot|Q04176 Saccharomyces
FT                   cerevisiae YDR397C NCB2 Beta subunit of the NC2 dimeric
FT                   histone-fold complex represses RNA polymerase II
FT                   transcription through binding to TBP and inhibition of
FT                   TFIIA and TFIIB homologous to the Dr1 subunit of the
FT                   mammalian NC2 (negative cofactor2)"
FT                   /db_xref="GOA:C5DLQ9"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLQ9"
FT                   /protein_id="CAR24720.1"
FT                   /translation="MGEQEDISLPKATVQKIISEVLESDLTFSKEAREIIIESGIEFIM
FT                   ILSSMASEMADKEAKKTIAPDHVIKALEELEYHEFIPYLEQILVEHKETQRIKERRDAK
FT                   FKKSGLSEEELLRQQEELFRQSRNRFQQTSTTPGDGAEGAESLEAEADSSRSESVKAEE
FT                   L"
FT   gene            <214405..>214860
FT                   /locus_tag="KLTH0G02750g"
FT                   /old_locus_tag="KLTH-ORF4743"
FT   CDS_pept        214405..214860
FT                   /locus_tag="KLTH0G02750g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4743"
FT                   /product="KLTH0G02750p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR0"
FT                   /protein_id="CAR24721.1"
FT                   /translation="MLRDMLRARPNAVCAWGGSLFFAAAHRSARKFWLVRRRSRTPVET
FT                   HTLGKAQRPGSGAGLCQRCATRMSIHTGGRSSMREWRESLVAKAPVAPRLCSATRFPAS
FT                   WIRPLDVRLSLGAPLACCRTSLCTTEPSPPHRKIFQNFNAMQFENLR"
FT   gene            <214898..>216805
FT                   /locus_tag="KLTH0G02772g"
FT                   /old_locus_tag="KLTH-ORF4740"
FT   CDS_pept        214898..216805
FT                   /locus_tag="KLTH0G02772g"
FT                   /gene_family="HOG000246841" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4740"
FT                   /product="KLTH0G02772p"
FT                   /note="similar to uniprot|Q04177 Saccharomyces cerevisiae
FT                   YDR398W UTP5 Nucleolar protein component of the small
FT                   subunit (SSU) processome containing the U3 snoRNA that is
FT                   involved in processing of pre-18S rRNA"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR1"
FT                   /protein_id="CAR24722.1"
FT                   /translation="MSESPVVLSQYDPSGQFLAYVTVALDKHRVSVEPTNAGKANGLVN
FT                   ENFLYLEDSQSRVTCLQWVHLASSDAQLVALGLNSGEVWLYAPSANQVVYKLSTGALHA
FT                   IRDFQCKGQTAWCCDQSDTVYQFNMTEFTVAAKFKVEGCENLQKLCVVDEQHILLASHS
FT                   ISLVDVQSKLVVQTFPGHISAVSNLIMLNSSAFLTSATNDRFLNIYDLATGGTKSVLVA
FT                   QSDVLQLSHYNDSTVAVTTEDGTIEVFPDPLVNTSKKRRRTVSKQSTHLIKIQRPESEE
FT                   RVAAMNVFITADTLNYAWLENATIPYFDQLQWAELPATHLITKSRPSATSKHANRTLHG
FT                   EDVAAAKSYVEGNATVTSGDNFKHVHEAIAELERGGADASDSLADRMASSSLGDDHAGS
FT                   KRSKKRVTTGTLTVVLSQSLQSNDHSLLETVLNNRDEKIIKGTISRLQPSLAVLLLERL
FT                   AERIARQTNRQGPLNVWVKWCLIIHGGYLARMPNLMSSLASLHSTLRKRSEILPRLQAL
FT                   ETRLDFSLNQLDAYRASHVNLGEMSASAFGVGEDNEEEVEYCEELDDAGLIEDGELDDD
FT                   EDFSDSEDNQSDNDQRNGNFAEEDGIDGEGASEGELDDEHGYSDVEGDDDSHPNGHKRV
FT                   "
FT   gene            <217593..>218237
FT                   /locus_tag="KLTH0G02794g"
FT                   /old_locus_tag="KLTH-ORF4736"
FT   CDS_pept        217593..218237
FT                   /locus_tag="KLTH0G02794g"
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4736"
FT                   /product="KLTH0G02794p"
FT                   /note="highly similar to uniprot|Q04178 Saccharomyces
FT                   cerevisiae YDR399W HPT1 Dimeric hypoxanthine-guanine
FT                   phosphoribosyltransferase catalyzes the formation of both
FT                   inosine monophosphate and guanosine monophosphate mutations
FT                   in the human homolog HPRT1 can cause Lesch-Nyhan syndrome
FT                   and Kelley-Seegmiller syndrome"
FT                   /db_xref="GOA:C5DLR2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR2"
FT                   /protein_id="CAR24723.1"
FT                   /translation="MSLEKQYISYNNVHQLCQEAAVKIKNFKPDLIIAIGGGGFIPARI
FT                   LRTFLKEENVPTVRIFAIILSLYEDLASESSMEEKPGVTVNRTQWIDYEQCKLDLVGKN
FT                   VLIVDEVDDTRTTLHYALNELEKDAAEQAKAKGIDLEQQPEMKTNFGIFVLHDKVKAKK
FT                   ADLPADLLNDENRYFAARKVPDTWYAYPWESKDIVYHTKMAIEQGNDVFLP"
FT   gene            complement(<219150..>220559)
FT                   /locus_tag="KLTH0G02816g"
FT                   /old_locus_tag="KLTH-ORF4733"
FT   CDS_pept        complement(219150..220559)
FT                   /locus_tag="KLTH0G02816g"
FT                   /gene_family="HOG000248493" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4733"
FT                   /product="KLTH0G02816p"
FT                   /note="similar to uniprot|P36032 Saccharomyces cerevisiae
FT                   YKL221W MCH2 Protein with similarity to mammalian
FT                   monocarboxylate permeases which are involved in transport
FT                   of monocarboxylic acids across the plasma membrane mutant
FT                   is not deficient in monocarboxylate transport"
FT                   /db_xref="GOA:C5DLR3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR3"
FT                   /protein_id="CAR24724.1"
FT                   /translation="MTSVNSSYNGSDEEKLEQTKVTENVNRIEVPDGGLRAWGVVAAYF
FT                   LFNISTWGANAGFSVYLAEYLKVGRFANAGALDYATIGGLAFGAGLFFAPAISYLVHIT
FT                   SAQLVIAVGIALQCAGLLLAAFSANLWELYLTQGVLISFGLAFISIPSITLVPQWFRYK
FT                   RNLAQGIASGGSGAGGIVFNLGMEKVMRARSVKWALIVQCILCTALSCIGLSLTRTRLK
FT                   HIWRGQKPKFWFFDREIIKSWGYWFVVLYVSMTMLGYVVLLYSMSAFTVSLGYSQNQGS
FT                   IVSCMISVGALVGRPFVGFSADRFGAVTVSIVAHLIVAIFSLAMWIPCRNFATALIFSL
FT                   IVGLFMGSIWSLIAPIIGRVVGLPKMGVCMGMIWTFLSAFGITAPIIGLVLRDENNPTG
FT                   NNFIRTAIFAGMMYFGSVVALWFLRALLIARDEIATEAKTGSDEGELHLQITFKSWAKG
FT                   LFKLRNLPRQI"
FT   gene            <221833..>222288
FT                   /locus_tag="KLTH0G02838g"
FT                   /old_locus_tag="KLTH-ORF4727"
FT   CDS_pept        221833..222288
FT                   /locus_tag="KLTH0G02838g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4727"
FT                   /product="KLTH0G02838p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR4"
FT                   /protein_id="CAR24725.1"
FT                   /translation="MTKHASLCINAKNTAISNGSPQATHWKPQPFKGIQVQTLLACMLD
FT                   SGCRILHRAAQMFHIRFASILSASSTLFTILLPARPANASSLSGFRIPHAAVTLPVGHF
FT                   WLPVSLLCPFSFDLYAPMANFRKENLCILLDQVTERVKYFIRHVACF"
FT   gene            <222428..>223459
FT                   /locus_tag="KLTH0G02860g"
FT                   /old_locus_tag="KLTH-ORF4725"
FT   CDS_pept        222428..223459
FT                   /locus_tag="KLTH0G02860g"
FT                   /gene_family="HOG000218839" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4725"
FT                   /product="KLTH0G02860p"
FT                   /note="similar to uniprot|Q04179 YDR400W Saccharomyces
FT                   cerevisiae URH1 uridine nucleosidase (uridine
FT                   ribohydrolase)"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR5"
FT                   /protein_id="CAR24726.1"
FT                   /translation="MTIDQTPSFDRIPIWLDCDPGHDDAVGVLMGAFLPQFELLGISAS
FT                   YGNAPPKKTAYNTLSLLTAMGKTRDIPVYAGAQKPWVREARYAPDIHGESGLDGTTLLP
FT                   IPDVPLCTDVSYLCAMEKAIEAHAGRISVVSTGSLTSVATLLDQRPHLKPKIKFISIMG
FT                   GGIHQGNSNMNGTAEFNIWIDPQAANSLFRDPAVNHKCILVPLDLTHKAIATKSVEERV
FT                   LGDGSSNLRKLFYELFLFFAKTYENAQGFETGPPVHDPLTLMPLLQFYGLKSPRDVGFV
FT                   YKRLDLLVVEDESDQNLGQTKVLSEYSSESSRGAIVGFELNIDYFWGQFLSALDSASIN
FT                   SPL"
FT   gene            complement(<223474..>224994)
FT                   /locus_tag="KLTH0G02882g"
FT                   /old_locus_tag="KLTH-ORF4723"
FT   CDS_pept        complement(223474..224994)
FT                   /locus_tag="KLTH0G02882g"
FT                   /gene_family="HOG000160758" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4723"
FT                   /product="KLTH0G02882p"
FT                   /note="similar to uniprot|P21595 Saccharomyces cerevisiae
FT                   YDR402C DIT2 Sporulation-specific enzyme required for spore
FT                   wall maturation involved in the production of a soluble
FT                   LL-dityrosine-containing precursor of the spore wall
FT                   homologous to cytochrome P-450s"
FT                   /db_xref="GOA:C5DLR6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR6"
FT                   /protein_id="CAR24727.1"
FT                   /translation="MDLVILAFLFCLITFGILKIVLPPWNFPRNIPTIPFYVTFLATIW
FT                   DVDQEDIYEIYLREPLEKYGAVKLYFGSRWNIVVSRPELLAQVFKDEDTFAKSGNHKKI
FT                   PYGVIAAYTGENVISAHGAIWKTFRRAITPGLQIFDHTPMIKNAEIFCSLISKQLTTSD
FT                   SDNNEKIHLQSNEQPWELQEKKSGIVLMPELIQRLSLANISEVALGFDIETLTKENSEL
FT                   HVKLKNVKSHIFKSLYLNFPLLDKLPIPSRQRARRFVEDFRECLMEAVETNLLQNYTFE
FT                   QTAFSSSDLIRSFNKEEISKKQLIDNVVIIMVAGHENPQLLLTTCFYMFAKNQKWQKLV
FT                   REEVQGCAVENLSELPLLNSFIFECVRMYPPLSQIINRCTSKPCRLGRDIILPRDVYVG
FT                   YNVLATGRQRSAWGKEAHRFIPERWGDNIDEIMKEWKHRKNTCAMSAFHGGRRACLGEK
FT                   LALMEVRIAMSAALKGFEWSLAPNWADKVTPAGPLCPAGLKVKFTELA"
FT   gene            <225923..>227479
FT                   /locus_tag="KLTH0G02904g"
FT                   /old_locus_tag="KLTH-ORF4719"
FT   CDS_pept        225923..227479
FT                   /locus_tag="KLTH0G02904g"
FT                   /gene_family="HOG000179673" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4719"
FT                   /product="KLTH0G02904p"
FT                   /note="similar to uniprot|P21623 YDR403W Saccharomyces
FT                   cerevisiae DIT1 Sporulation-specific enzyme required for
FT                   spore wall maturation involved in the production of a
FT                   soluble LL-dityrosine-containing precursor"
FT                   /db_xref="InterPro:IPR007817"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR7"
FT                   /protein_id="CAR24728.1"
FT                   /translation="MKNTEDTSSDESATCYKTEDLSTYSKVLCLYTREPDSYQLYAIED
FT                   KQSACFSQRWEKFLELLKHTVSREIGTSGISERTIEAEAAVEFTCLQGVPIKVTELRRN
FT                   DEGQTRGIITIIENENDFSHWMISHILEQTRMDLDEKPAVGHGKLYAEMFTDYFAQNLK
FT                   NTTKNDQWGEGGREYFLEKTRYFTDRFLKIECILPAFPCKSSNIEKVHGVFPDKGEELA
FT                   LRRLAAATQEVRKFYPPGMKIWIVSDGHVFSDCIGVDDDVVDEYTDRLHGFYQNLAVPG
FT                   NDAIGFAGLKELFFTGETVLDFDEEMVSDIELPHYTGSKICENSELSRRILMKGFDTDD
FT                   GSLRKQILIPGHPRLHLFRGFSKFMIDDLSHLAHFKNVSRKCFKKVVSKVAFEMIKRND
FT                   AYSNLVELLFPHHMRFSIHAHTNSGPKFGVKIISGNQCRTVKSLESLDEPSFEDLLHIP
FT                   TPWHNCVIKLGDAYYLTKSKVVFEAITSGLYEGQWKEGGEQKNLGGHFVLKKKMHVQKQ
FT                   M"
FT   gene            complement(<227702..>228217)
FT                   /locus_tag="KLTH0G02926g"
FT                   /old_locus_tag="KLTH-ORF4718"
FT   CDS_pept        complement(227702..228217)
FT                   /locus_tag="KLTH0G02926g"
FT                   /gene_family="HOG000158201" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4718"
FT                   /product="KLTH0G02926p"
FT                   /note="highly similar to uniprot|P34087 Saccharomyces
FT                   cerevisiae YDR404C RPB7 RNA polymerase II subunit B16 forms
FT                   two subunit dissociable complex with Rpb4p"
FT                   /db_xref="GOA:C5DLR8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR8"
FT                   /protein_id="CAR24729.1"
FT                   /translation="MFFFKDLSLNITLHPSFFGPQMKQYLRTKLLQEVEGTCTGKFGYI
FT                   LCVLDCENVEIERGRILPGDGSAEFTVKYRAVVWKPFKGEVVDGVVSSCTNLGFEVDVG
FT                   PLSVFVSPFLMPEDLSYNSGSNPPSYQSSEQIITKGSRVRLKIVGARSEVNSIYAIGSI
FT                   KEDYLGVI"
FT   gene            <228482..>228964
FT                   /locus_tag="KLTH0G02948g"
FT                   /old_locus_tag="KLTH-ORF4716"
FT   CDS_pept        228482..228964
FT                   /locus_tag="KLTH0G02948g"
FT                   /gene_family="HOG000225288" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4716"
FT                   /product="KLTH0G02948p"
FT                   /note="highly similar to uniprot|Q12487 Saccharomyces
FT                   cerevisiae YOR150W MRPL23 Mitochondrial ribosomal protein
FT                   of the large subunit"
FT                   /db_xref="GOA:C5DLR9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLR9"
FT                   /protein_id="CAR24730.1"
FT                   /translation="MSQKLGHTGLAFARLWHHVDIAQDKRTLGRLASSIALTLIGKHKP
FT                   VYHPTQDCGDYVVVTNCQQLRVTGKKFEQKTYWSHSQKPGHLKLTTMQKMAENKGYGEI
FT                   LKKAVSGMLPKNKLRKPRLERLKVFDGSEHPYTSNVTAFVDQQPKIAQQLKKLEAK"
FT   gene            complement(<229131..>232793)
FT                   /locus_tag="KLTH0G02970g"
FT                   /old_locus_tag="KLTH-ORF4714"
FT   CDS_pept        complement(229131..232793)
FT                   /locus_tag="KLTH0G02970g"
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4714"
FT                   /product="KLTH0G02970p"
FT                   /note="highly similar to uniprot|P08518 Saccharomyces
FT                   cerevisiae YOR151C RPB2 RNA polymerase II second largest
FT                   subunit B150, part of central core"
FT                   /db_xref="GOA:C5DLS0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS0"
FT                   /protein_id="CAR24731.1"
FT                   /translation="MSTEEFYEEDPYGYEDDEASITAEDSWTVISAFFREKGLVSQQLD
FT                   SFNQFINYTIQDSIVEDSTLILEQLAQHTTEADNISRKYEISFGKIYLAKPSMTESDGV
FT                   SHAMYPQEARLRNLTYASGLFVEIRKRTYEAVDIPGRDLKYEVIDEESEMSDESKIFIG
FT                   RVPIMLRSKYCLLDELTESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFK
FT                   KSAPSPISHIAEIRSALEKGSRFISTLQVKLYGREGSTNRTIKATLPYIKQDIPIVIIF
FT                   RALGIIPDGEILEHICYDVNDWQMLELLKPCVEEGFVIQDRETALDFIGRRGTALGIKK
FT                   EKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDHFGKK
FT                   RLDLAGPLLAQLFKTLFRKLTRDILRFMQRSVEEAKDFNLKLAVKATTITAGLKYALAT
FT                   GNWGEQKKAMTSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLV
FT                   CPAETPEGQACGLVKNLSLMSCISVGTDPLPIITFLNEWGMEPLEDYVPHQSPDATRVF
FT                   VNGVWHGIHRNPAKLVDTIRKLRRKGDVTSEVSIVRDIREKELKIFTDAGRVYRPLFIV
FT                   DENEETGVKELKLRKGHIRKLMMTEYQDIEGGFEEEDINYTWSSLLNEGLVEYIDAEEE
FT                   ETILIAMQHEDLDPTIEAADPEEELDPAKRIKAIHHSSTFTHCEIHPSMILGVAASIIP
FT                   FPDHNQSPRNTYQSAMGKQAMGVFLTNYSVRMDTMANILYYPQKPLGTTRSMEYLKFRE
FT                   LPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKRIGMSITESFE
FT                   KPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGDDMIIGKTTPIPPDAEELGQRTAFHSK
FT                   RDASTPLRSTENGIVDQVLITTNQEGLKFVKVRVRTTKVPQIGDKFASRHGQKGTIGIT
FT                   YRREDMPFTAEGVVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGNEGDASPFTDITV
FT                   DGISRLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPV
FT                   QVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLKERLMEASDAFRVHICGVCGLMT
FT                   VVAKLKHNQFECRGCKNKIDIYQIHIPYAAKLLFQELMAMNIAPRLYTDRSRDF"
FT   gene            <232992..>233831
FT                   /locus_tag="KLTH0G02992g"
FT                   /old_locus_tag="KLTH-ORF4712"
FT   CDS_pept        232992..233831
FT                   /locus_tag="KLTH0G02992g"
FT                   /gene_family="HOG000246534" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4712"
FT                   /product="KLTH0G02992p"
FT                   /note="similar to uniprot|P32387 Saccharomyces cerevisiae
FT                   YDR405W MRP20 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="GOA:C5DLS1"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS1"
FT                   /protein_id="CAR24732.1"
FT                   /translation="MKKRNGIFQEPFDEQRQKFKRTQRRSEVTEMPRLVRKWLNAVPTA
FT                   VKNNFKIRSFATVSEVRDTTTINVTATEPVKVSDKILNWSREAIAQGKPHFKVGGTPVF
FT                   FPKARVVLLRPNAKHTPFQAKFIVPKSFNKLDLRDYLFHVYGLRAMNVTTQLLHGKYTR
FT                   VNQVMPRYRSAQIKKMTIDMAEPFVWPAEPVDKEPWAATLVEDLQKYREEQTRIGSDKF
FT                   KPGTAFDGALGPYQPPPQPFVPKFLKRRITNSRRRAQARVSQLERLLKVDKFAQASS"
FT   gene            complement(<233917..>234399)
FT                   /locus_tag="KLTH0G03014g"
FT                   /old_locus_tag="KLTH-ORF4710"
FT   CDS_pept        complement(233917..234399)
FT                   /locus_tag="KLTH0G03014g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4710"
FT                   /product="KLTH0G03014p"
FT                   /note="weakly similar to uniprot|Q99325 Saccharomyces
FT                   cerevisiae YOR152C"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS2"
FT                   /protein_id="CAR24733.1"
FT                   /translation="MPNPIVYVFQALPLSNFVELAAWLVISRELLGRFCEMEAGRGGFS
FT                   GFERPAYGAEKSTWISYLQNMSSQANRDKYVFGKLTTFVLRAVEKWPLDIKILDTSFQA
FT                   VVAWIGRLGRRAQPSTESQSWAWTYQWFSASTSQPTAAGEEEYDLLEDVLRDFKKS"
FT   gene            complement(<234881..>236179)
FT                   /locus_tag="KLTH0G03036g"
FT                   /old_locus_tag="KLTH-ORF4709"
FT   CDS_pept        complement(234881..236179)
FT                   /locus_tag="KLTH0G03036g"
FT                   /gene_family="HOG000200133" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4709"
FT                   /product="KLTH0G03036p"
FT                   /note="similar to uniprot|Q99312 YOR155C Saccharomyces
FT                   cerevisiae ISN1 Inosine 5'-monophosphate (IMP)-specific 5'-
FT                   nucleotidase"
FT                   /db_xref="GOA:C5DLS3"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS3"
FT                   /protein_id="CAR24734.1"
FT                   /translation="MPSRYRVEYQLKSHRKDELIEWIKGLLAVPFVLHSASHDPAARQI
FT                   LRQRYAEVFVAVEALIDEQVSVGKLARQSEDREFLVGRTRLAQLVPSIGPFFTRLPLRQ
FT                   AFLHEDHKRAISARTMVSPSFNDIRHILNSAQILQMRECHDVRLVTFDGDVTLYEDGGS
FT                   LTATSKVVPFLLSLLRSGICVGIVTAAGYDEAQKYMERLFGLMTSLKDDTSISADFKRN
FT                   LVVLGGESNYLFRYEPSQHELVSIENKAWIKPPMCHWSESDMTETLDLAESLLRDFRTT
FT                   LNLPEESTIIRKPRAVGIVPGNRWNPETKRTIRVKMDREQLEEMVLTLQHRLEDFAPAR
FT                   RIQFSCFDGGSDVWCDIGGKDLGVAALQHYFDPYNPIKPCQTMHIGDQFAPMGSANDFK
FT                   ARLSGCTLWISSPQETVEVLRCLTAGFDHYFQT"
FT   gene            <237157..>238761
FT                   /locus_tag="KLTH0G03058g"
FT                   /old_locus_tag="KLTH-ORF4700"
FT   CDS_pept        237157..238761
FT                   /locus_tag="KLTH0G03058g"
FT                   /gene_family="HOG000198767" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4700"
FT                   /product="KLTH0G03058p"
FT                   /note="similar to uniprot|Q12412 YOR161C Saccharomyces
FT                   cerevisiae PNS1"
FT                   /db_xref="GOA:C5DLS4"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS4"
FT                   /protein_id="CAR24735.1"
FT                   /translation="MSEKYSRPAQPPPSYAPQQQQDQQQPEQQQQQPDQDYQFRQDQYY
FT                   NLNSKSDGAPIGSFEESFPTENDNKFRLNDWPFTIFFLLTVCGFIAIAGITLRAWANTY
FT                   SLTGSGIYDGQNTGTLNTNSAVLLVFSCVIALIFSMLGLVLMRASPKWFIYCGMVFNII
FT                   SGLGTAIAYLSMRYWSAGIVFLVFTLITAWCYWGMRSRIPLSVAILKTVVDVMKRLPQV
FT                   YFISFLGSILASAFAMLFSAVIVATYMKYDPSQTNGTCAQGGGSCTKSKLIGILVLVFF
FT                   CGYYISEVLRNVIHCTVSGVYGCWYYMSKSDQGMPRWPSFGSLKRALTVSFGSICFGSL
FT                   IVSLIETAKTVFNLLRNGQITNVSDSAWAQCLFIVIDWIIGFLEWLARYFNHYAYCFIA
FT                   LYGKPYLRAAKETWYMLREKGMDALINDNLINIALGFFSLFASYMAALFAFLYLRFTSP
FT                   SYNSGGGFNAPLMAFSFVIALQICNIANETVRSGTATFFVALGNDPEVFRVSYPQRFDE
FT                   IFRAYPDVLKKLSHQNV"
FT   gene            complement(<238995..>241895)
FT                   /locus_tag="KLTH0G03080g"
FT                   /old_locus_tag="KLTH-ORF4698"
FT   CDS_pept        complement(238995..241895)
FT                   /locus_tag="KLTH0G03080g"
FT                   /gene_family="HOG000181190" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4698"
FT                   /product="KLTH0G03080p"
FT                   /note="similar to uniprot|Q99189 Saccharomyces cerevisiae
FT                   YOR160W MTR10 Nuclear import receptor mediates the nuclear
FT                   localization of proteins involved in mRNA- nucleus export"
FT                   /db_xref="GOA:C5DLS5"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS5"
FT                   /protein_id="CAR24736.1"
FT                   /translation="MSYNIGDIGTALQCITSSSEQETKKQALQFLEHFQKSPEAWNLCH
FT                   EALASNGGQISLELQVFSAQTLRNKVTYDLSQLDGHLFTFKDSLLQLITQHSQKLIVTQ
FT                   LSVALARLAIQFLEWREPIAEIIGSLRQFPSKLLEFLKILPEETLDIKSTPLSEDEFRS
FT                   RTHELIDQIAGDVLQYLISAAESLRSGSTEVSVSQLLNCVNSWAYEIPIEELLSVNTLM
FT                   SLIFHALNQGEESDPEVFDVAVECMCTVLKETRDVPSEAVIKALYEQLVSMQTTLLPVD
FT                   QISDFEDYAEVMDGLTRVFVEAGEAWCIHIAKNPQIFKPLVSVLLLLTCKNTDLDVVKY
FT                   TFPFWFNLKQMLVLPRFKDQRAAYQDIFTELVDGIITHLHYPTGSFSSREEEDKFRDFR
FT                   YDMGGVLKDCTAVVGSATALSRPYEKITNALNEPNPLANWQNLEAPLFSLRTMAQEISK
FT                   NENVVLPQLFRLLCTLPEHPKVRYATTLVLGRYTEWTSKHPDFLEMELNYIFNGFQHAN
FT                   GSIEILTASSHALMYFCQDCSSLLSGFVSQLIEFYWKIETMVESESLFEVCQGLSCVID
FT                   RQTDDQVGASLELFLKPHLSKLVDAVSVWKANNNDKKATAEVCGKIDLIFAIFEELKPR
FT                   YETPEQGREPLQPYICTIWETLESLLVNQEAFNNPDVAEIAMKWVRKVALNFHIFIAPI
FT                   LPSVANFLAQSYASTGFGVYLWCSGSIIAVFGDDESFPIDQQTKEAVWEFTCTQCVTFM
FT                   NNFTGIEATKLESYHEAIQDFFMMMTDVVMFFPDRFVTSDILLSPVFSIGLNCVTKITN
FT                   YDAYITIVRFLDDVLSWGFETPPISTATLDVVPEQWRQKILTEVVQAQGSLLVRTLLIG
FT                   LVTNFSSDAHPDAIGCLVKCLRLCQDCSANDPTVSLGWLNEAMDTLGNVSAQERTNLVS
FT                   TVGNALPQKDMRRVRTGLKDFVSWYTRKNVSPRLYK"
FT   gene            <243531..>243815
FT                   /locus_tag="KLTH0G03102g"
FT                   /old_locus_tag="KLTH-ORF4695"
FT   CDS_pept        243531..243815
FT                   /locus_tag="KLTH0G03102g"
FT                   /gene_family="HOG000223543" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4695"
FT                   /product="KLTH0G03102p"
FT                   /note="similar to uniprot|Q12330 YOR159C Saccharomyces
FT                   cerevisiae SME1 Required for pre-mRNA splicing, cap
FT                   modification and U1 U2 U4 and U5 snRNA stability"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS6"
FT                   /protein_id="CAR24737.1"
FT                   /translation="MAPNNPKVTVPPINCIFNFLQQQTLVNFWLFEQVQTRIRGRISGF
FT                   DEFMNVVIDDASEIPIDTKTGSELPDQAVKLGRILLKGDNITLITPVSD"
FT   gene            complement(<243931..>244845)
FT                   /locus_tag="KLTH0G03124g"
FT                   /old_locus_tag="KLTH-ORF4694"
FT   CDS_pept        complement(243931..244845)
FT                   /locus_tag="KLTH0G03124g"
FT                   /gene_family="HOG000248282" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4694"
FT                   /product="KLTH0G03124p"
FT                   /note="similar to uniprot|P17558 Saccharomyces cerevisiae
FT                   YOR158W PET123 Mitochondrial ribosomal protein of the small
FT                   subunit PET123 exhibits genetic interactions with PET122
FT                   which encodes a COX3 mRNA-specific translational activator"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS7"
FT                   /protein_id="CAR24738.1"
FT                   /translation="MGKGAAKFGFQSGLLPNARSILKNPTIKQTSIIEKVKAPKPKGPH
FT                   GVGYAKNIAHPKGSHRDSPDVKFIDVEELISKTVPEPQHTRIPKTVQQEARLHKAQLRR
FT                   SYLSESFRNEEKRLLHQEKMLQEKEAAHAEERQKELLALNESRSSDLTIPTMENTLQGP
FT                   LMRQRTPEEMKILDMKRKHNRDIQQFQAKERKLEKLLKLFHVTDHFIVTEDQLIKKIDE
FT                   VFANEASEALRTKLSVGSSRPRSRSEKDIGDALFGSLGGGEFVGLPTIKEYVSGEMHTF
FT                   ANEVEDRNKQLLQQRKENLDTIL"
FT   gene            complement(<244963..>248622)
FT                   /locus_tag="KLTH0G03146g"
FT                   /old_locus_tag="KLTH-ORF4691"
FT   CDS_pept        complement(244963..248622)
FT                   /locus_tag="KLTH0G03146g"
FT                   /gene_family="HOG000142077" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4691"
FT                   /product="KLTH0G03146p"
FT                   /note="similar to uniprot|Q04183 YDR407C Saccharomyces
FT                   cerevisiae TRS120 Component of the targeting complex
FT                   (TRAPP) involved in ER to Golgi membrane traffic"
FT                   /db_xref="InterPro:IPR013935"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS8"
FT                   /protein_id="CAR24739.1"
FT                   /translation="MKEYSLLGPAAVRTLVVPIGQWERKSFLKKVQLYQERFEARLVDI
FT                   TPLEDATFNPQGFPQGRLMFWFHTNMLNEEQMLFLHDFEPYRKTFVVVGLVNTLDQDPQ
FT                   SSLEALQKRYPDSISHNLVYFGVSAPESKNVYCATSSNVETTVCDIGRNFLEALSLYYS
FT                   SYKHVTLRSPGAVGGASVTKTSLMRQPAAAPASAVSRVASMDTSSTSGLKRSGSIKSLG
FT                   LNATSADQQRAKARQCKILANFQLLAGRYVDSLNNFADAAFTLHKYHDYIWLGSALEGL
FT                   IISMVLLSQLRVSFQIPAIVSLLCQIKDFEQLPQATSSQRNSLSSAPMQSPRNSVSSMS
FT                   SKVHTVDVQNVALPPLIKALSEKTLHYYEVSLSHNTEYAPQVVYCEHVLRILSYMTSYH
FT                   YPRTSSKIPSQSDGIQTPRNSNPLWTQDSSADCFTKWEICQFSNKLFELQLKEMDLVSQ
FT                   IKIYTSLACIYRDIGFHKKQSFVSRILLVSLLPQLESEAIFNFWKETEEETLKSLLGAY
FT                   GIHRQPETLIEDAADCSWVTIQKNILLLCISMASKIYDKQKVCEYSLILLQRYSHVLTQ
FT                   SEQNSLLQNNILPAAGDTNILGYWDPFLLRNLQIIHLENRREVPQEKLIGAEEPGETKQ
FT                   RHSQVFNPFKQNAINSVTDQKRVSETAKKFLLGETAELVLTFQNPFKFNLEISHLSFDA
FT                   DDEKLVQFLKDSTIRELPFRVKANSMRSLHLPVTFLKETGGKTHLLKRLNVGVLSLKPT
FT                   SLNIVLAENFKNPEKHTTSRAKLGSFEFQVIAEQPEIEFMSSTLNENTCMILDGTKKTF
FT                   EIVLRNQSLCRSANYLQFTHITNVEMNLKSDYWKNMSPDDLYDAEYQLKWMQNNCIKIR
FT                   NAPDTIPPNTSVTLSLDLDVTKASFQFSKFEIVLEYGYKPDGTARSIFTKTLRIPFDVT
FT                   LKRSLEAPGLEVIPLIEHIRGEDGALISTDRINDKATSNHSAKTGSALLLLDIRNSWYD
FT                   GAKLRVHFEDYSSEEEILASTNTKRFVIPIKKYSFDHDWDHKEIPKLVSGRQFVSSGMA
FT                   QDEITIMRRKFWCREAILKGLKCDWKLQDASQTAGSLDFRQFLDKFDARTVDILYTQRD
FT                   SPFNVEISTQRSELRLGETLSICAKIGFNQKFPCSETKPAKLEFLIYNRRTGKLLPRSN
FT                   TSILYNGQLSKRIIPKYDSEVKIELVPIDKGDYEVGCCLESVFNDVPVYFRVI"
FT   gene            <249621..>250412
FT                   /locus_tag="KLTH0G03168g"
FT                   /old_locus_tag="KLTH-ORF4686"
FT   CDS_pept        249621..250412
FT                   /locus_tag="KLTH0G03168g"
FT                   /gene_family="HOG000182856" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4686"
FT                   /product="KLTH0G03168p"
FT                   /note="highly similar to uniprot|P25043 YOR157C
FT                   Saccharomyces cerevisiae PUP1 Endopeptidase with trypsin-
FT                   like activity that cleaves after basic residues"
FT                   /db_xref="GOA:C5DLS9"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLS9"
FT                   /protein_id="CAR24740.1"
FT                   /translation="MAGLSFDNYQRNQFLAERSKTVPQATSTGTTIVGVKYDGGVLIAA
FT                   DTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEEVTKLIGSNLELHSMYASREPR
FT                   VVSALQMLKQHLFKYQGHIGAYLIVAGADPTGTHLFSIHAHGSTDVGFYQSLGSGSLAA
FT                   MAVLEANWRPDLKKEEAMQLASDAIEAGIWNDLGSGSNVDLCIMETGKDAEYLRNYRTP
FT                   NVREAKQRSYKFPRGTTAVLSERVLDICQVEEETVDIELEA"
FT   gene            complement(<250460..>251125)
FT                   /locus_tag="KLTH0G03190g"
FT                   /old_locus_tag="KLTH-ORF4682"
FT   CDS_pept        complement(250460..251125)
FT                   /locus_tag="KLTH0G03190g"
FT                   /gene_family="HOG000033575" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4682"
FT                   /product="KLTH0G03190p"
FT                   /note="similar to uniprot|P04161 YDR408C Saccharomyces
FT                   cerevisiae ADE8 Phosphoribosyl-glycinamide transformylase"
FT                   /db_xref="GOA:C5DLT0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT0"
FT                   /protein_id="CAR24741.1"
FT                   /translation="MGARIVVLISGSGSNLQALIDAKARGALSGDIVRVISSSKKAYGL
FT                   ERSSKHGIPTRVHSLYPYTKGIAKEDKSGRADARKNFEIDLASVVLEDKPDLIVCAGWL
FT                   LILGSEFLKRVNGVPIINLHPALPGAFDGTTHAIEMAWKKCQDEGAPLIAGCMVHFVIE
FT                   EVDRGEPVVIKELQLMPGEESLEKYEERVHAAEHVAIVEAVQKVLKANGESAGTEKQH"
FT   gene            <251547..>254195
FT                   /locus_tag="KLTH0G03212g"
FT                   /old_locus_tag="KLTH-ORF4681"
FT   CDS_pept        251547..254195
FT                   /locus_tag="KLTH0G03212g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4681"
FT                   /product="KLTH0G03212p"
FT                   /note="weakly similar to Q04195 YDR409W uniprot|Q7LIJ4
FT                   Saccharomyces cerevisiae SIZ1 SUMO ligase that promotes the
FT                   attachment of sumo (Smt3p small ubiquitin-related modifier)
FT                   to proteins"
FT                   /db_xref="GOA:C5DLT1"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004181"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT1"
FT                   /protein_id="CAR24742.1"
FT                   /translation="MTASSGGLHQEIDFCVQEMEKLRVAELKAVSRAIGLSLSGRKADL
FT                   QDRIRAYLKNSFRLGSIDPWRPKAILVLIDKAKLSDPLPTYESVWQSLRTGAFRHPVAT
FT                   GHQPPSALNPSAIEVHKPPPVPRAPKTRLALQFGESPFYKLRRMLNGSPKLAAKNNGRG
FT                   VCIYRFLLNQEESSILGKGPQFKLYLFSGILDPLENRGDAPIQFPHPNEIRFNDVQVKD
FT                   NVRGLKNKPGTAKPADLTPYLRPSGSENVLQLIYAFTKSDYLMYCYLVEVISPEKILQE
FT                   VLRHPKIVKPATLQYLKETLSEDEDEDLVTTSTVMTLQCPISYCRMRYPSKSVYCQHLQ
FT                   CFDSLWFIESQQQIPTWHCPVCQKKIKIEDLALCEFVEEIIQQCDEEVEQVEISRDGTW
FT                   KPVFEDDPPAPQQHSATEVKLENGHSLEGIVRPGSEDSDEEPISSRRRNLPQNEPVVIS
FT                   LDSDDEEEEAPKAAPQPPGENQTPSQPGQELQERPGGRTAPSNSTLPHENTLANIYGTY
FT                   MDINSGHEPQRSLDPKNANTTPSSARFNFNHGTPNNSETPNSSPFIQPHHQIPNLLGKT
FT                   PLNNNVNESYTSGHEQGQKSPSPTVSVQQSSSRVHPSFGEVNVPLLNAHNQGPNIQSGH
FT                   TPVRRHSENTSAYGQEVRLTYRPSSFANNTLPPPWQDVRGQQSLLGLGGDTSQIHREAR
FT                   RSSTGSYNGENSLEGVQDHSRSPPLVARQPVINGAPIHNSPHSERGATSSAPPFSKPPA
FT                   PAALASTGPLISSPRSQGQPPPLPPVPQSINRAESGQKPASASNARYRKPIVSPFIPKK
FT                   PYVNMLPQKRQISSTSINKVAPTGHNAHSSQTRQPQLENEGVSVSATSPPPLLAQSMAN
FT                   ELDFIDLTSDE"
FT   gene            complement(<254257..>255051)
FT                   /locus_tag="KLTH0G03234g"
FT                   /old_locus_tag="KLTH-ORF4679"
FT   CDS_pept        complement(254257..255051)
FT                   /locus_tag="KLTH0G03234g"
FT                   /gene_family="HOG000213961" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4679"
FT                   /product="KLTH0G03234p"
FT                   /note="similar to uniprot|P32584 Saccharomyces cerevisiae
FT                   YDR410C STE14 Farnesyl cysteine-carboxyl methyltransferase
FT                   mediates the carboxyl methylation step during C-terminal
FT                   CAAX motif processing of a-factor and RAS proteins in the
FT                   endoplasmic reticulum localizes to the ER membrane"
FT                   /db_xref="GOA:C5DLT2"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT2"
FT                   /protein_id="CAR24743.1"
FT                   /translation="MIEEDSGEPKSRRRSLPQDYDGDDVGDVGVIIKGQVYPYIEKNPL
FT                   DSISLTGFLLGGTVGLSIGLLPHSFFKNFNIYLVAVSVFHFLEFYTTAKYNPGKVTSDS
FT                   FLFNNGKAYTFSFVFAVSEALLESIFFDWKTRFSSWYHTTAAIIGLMLMLLGQYIRTSA
FT                   MITAGRSFSHQVKTSQNPDHVLITTGIYAQLRHPSYFGYFWWALGTQLWLMNPVSFALF
FT                   AYVLWKFFHSRINYEERYLNSFFGEEYTKYTQNVGVGIPFIS"
FT   gene            complement(<255316..>256092)
FT                   /locus_tag="KLTH0G03256g"
FT                   /old_locus_tag="KLTH-ORF4677"
FT   CDS_pept        complement(255316..256092)
FT                   /locus_tag="KLTH0G03256g"
FT                   /gene_family="HOG000000746" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4677"
FT                   /product="KLTH0G03256p"
FT                   /note="similar to uniprot|Q03433 Saccharomyces cerevisiae
FT                   YML041C VPS71 Protein of unknown function component of the
FT                   Swr1p complex that incorporates Htz1p into chromatin
FT                   required for vacuolar protein sorting"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT3"
FT                   /protein_id="CAR24744.1"
FT                   /translation="MPFVEEINWKSYNPDVYFTSVNAAGPSGRNRITKTTAASGVRNNK
FT                   RVNYSLPDLEAKIYAQRNGSNSEASNSSAITTTSSALDRYTPEELLKSRKRFMELDTEN
FT                   VLDIKDVSYLMSSVTGISKDRIDSSSGSNSSGGASSNVNRSHRNKFELPKNMELMYRST
FT                   KPPVPKKKNTNRVVALKKTLSSRRPLTSYLDALDQVNRSIIFNNVYNKKFFKVLPVITI
FT                   CSICGGYNSISGCVRCGNKICSLRCFNLHNEARCTM"
FT   gene            <256250..>256323
FT                   /locus_tag="KLTH0G03278r"
FT                   /old_locus_tag="Klth0G.tVal.AAC.3"
FT   tRNA            256250..256323
FT                   /locus_tag="KLTH0G03278r"
FT                   /old_locus_tag="Klth0G.tVal.AAC.3"
FT                   /note="tRNA-Val (AAC) cove score=68.42"
FT   gene            complement(<256458..>258407)
FT                   /locus_tag="KLTH0G03300g"
FT                   /old_locus_tag="KLTH-ORF4675"
FT   CDS_pept        complement(256458..258407)
FT                   /locus_tag="KLTH0G03300g"
FT                   /gene_family="HOG000233845" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4675"
FT                   /product="KLTH0G03300p"
FT                   /note="similar to uniprot|P32796 YML042W Saccharomyces
FT                   cerevisiae CAT2 Carnitine acetyl-CoA transferase present in
FT                   both mitochondria and peroxisomes"
FT                   /db_xref="GOA:C5DLT4"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT4"
FT                   /protein_id="CAR24745.1"
FT                   /translation="MREISRVVRRMVSTLQRFSFETRNGESYSALRPNSYYQKKRSTFK
FT                   GTTFSHQNQLPSLPVPVLEETLTKYLESVKPFCRDAEQFEEQERLCQDLVQKEGAKLQE
FT                   RLVRYSEKSRNWLSEFWDNQAYLEYNDPVVPYVSYFYAHKPLPTSHAKIQTDPLIKATA
FT                   IIVSVLKFLEAVKDEALPSEHSGNTLLCMNSFQMMFNNSRVPGDGRDSNVFYSLYENNF
FT                   IVVAFKGNFYKVLTHNASGDVLGPADIWQQLYKITANLDGQVRDNNKVGIGSLTSLPRD
FT                   EWLRAHKELVTNPLSAQSMEAIYKSSFMVCLDLDTKPITLEEKSRYAWHGDGINRFYDK
FT                   PLQFFVAGNGNSGFLAEHSKMDGTPTLHLNDYVCKQMHSLNVAEFLGQINCSVAQNENK
FT                   PQYLPFFVTPATRSHIEAAQVGFHKRIGEHHLKVWHYNKYGKNFMKNVGFSPDAFLQQV
FT                   IQLAIYKYFGKQLPTYEAASTRRFYKGRTETGRSVSTDSAKFVADWENPDVADSQKVAS
FT                   LRSSAKAHSTYLKMASAGHGVDRHFFGLKNMIQPGENMPELFKNPLFIYSSTWLVSTSQ
FT                   LSSEHFDGYGWSQVNDNGFGLAYMLNKDWMHINIVNKPNASGLSVSRLHYYLTQAADEM
FT                   FELLDSDRKHHSKL"
FT   gene            complement(<258857..>259906)
FT                   /locus_tag="KLTH0G03322g"
FT                   /old_locus_tag="KLTH-ORF4671"
FT   CDS_pept        complement(258857..259906)
FT                   /locus_tag="KLTH0G03322g"
FT                   /gene_family="HOG000065932" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4671"
FT                   /product="KLTH0G03322p"
FT                   /note="similar to uniprot|Q7LIJ5 Saccharomyces cerevisiae
FT                   YDR411C DFM1"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT5"
FT                   /protein_id="CAR24746.1"
FT                   /translation="MISVVRLYLETTTSNRVLSNTSISSLLIARENHQTLQMAVPKKQS
FT                   NSNELAQVVSQIPPVTRTLLAGVVAMTIVSSMGIVPREWLLFFLYPTFMKLQLWRMYTS
FT                   CFLLPMDKMAAVFWMYNLYSYSSHLENAHFYSKNNVDYLFLLWSLIGAIVVSVTALRLD
FT                   LSYNLTNSFMGALACIWSIKNWNVTFMFYGLFPLKGKYDPLFQLFLAFVFENHPGGFML
FT                   TLIGYCVGYLYVCLDTRTLGPLYGYIAGKTSSYGLADCGHFRAPWWFSAVCEFFGKSKH
FT                   KVNVIIDKTTSYQGQGHRLGSEKAAAADAARVAAARAERFKTTTVQTNHKTTASGFFPG
FT                   KGQRVGSKD"
FT   gene            <260349..>261050
FT                   /locus_tag="KLTH0G03344g"
FT                   /old_locus_tag="KLTH-ORF4669"
FT   CDS_pept        260349..261050
FT                   /locus_tag="KLTH0G03344g"
FT                   /gene_family="HOG000248508" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4669"
FT                   /product="KLTH0G03344p"
FT                   /note="similar to uniprot|Q04031 YDR412W Saccharomyces
FT                   cerevisiae RRP17 Protein required for cell viability"
FT                   /db_xref="InterPro:IPR019186"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT6"
FT                   /protein_id="CAR24747.1"
FT                   /translation="MGPRTNRQILTQGKNYVAKQARKFGADEVNFDKDSRLEYLTGFHK
FT                   RKLERQKKAQDFIKEQDRLAKIEERKQMREQRRKEAEEQMRKFKETMKEVGDYIGSDQE
FT                   QEEDEQDGKDKEGVDGSASEESWNGFSDDDQENDVKPILKKTKQVYEDDTQVDIEPLEP
FT                   NENFEYLATLNNVKLEQSKKVLDDSIERAAKYAKFLGMDEKPKKKKKFRYLSKAERRQN
FT                   QKKANDNKRRK"
FT   gene            complement(<261183..>262337)
FT                   /locus_tag="KLTH0G03366g"
FT                   /old_locus_tag="KLTH-ORF4668"
FT   CDS_pept        complement(261183..262337)
FT                   /locus_tag="KLTH0G03366g"
FT                   /gene_family="HOG000112387" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF4668"
FT                   /product="KLTH0G03366p"
FT                   /note="similar to uniprot|P16151 Saccharomyces cerevisiae
FT                   YDR414C ERD1 Predicted membrane protein required for the
FT                   retention of lumenal endoplasmic reticulum proteins mutants
FT                   secrete the endogenous ER protein BiP (Kar2p)"
FT                   /db_xref="GOA:C5DLT7"
FT                   /db_xref="InterPro:IPR004342"
FT                   /db_xref="UniProtKB/TrEMBL:C5DLT7"
FT                   /protein_id="CAR24748.1"
FT                   /translation="MVSKIADAPSGFLTLFPLPQRCILLIIVGMWLWLWQITIMHRFFH
FT                   IDVSQLVLSHDPHEALPQQSATRQTEATRRVVSRLTKIILPWCAATSVLLSECTKIQAY
FT                   SPPVWAVCLLNIQSLCQFIFIFATICSYSPMVSRCLRKIMPLGNIEAKPLRLNYILITD
FT                   SLTSYSKPLIDFGFYLCHLVLDPLNEACIISRSPIGTAINLDLAIGSTPVLLRLLQCLR
FT                   EWRRSKYAKDARSSLFNALKYSLHIPIVLCTVYSRSYPTAKPGNHIYWLMLVNSSYSLW
FT                   WDLTMDWELGIFDFSIHGMNRNEVLRRRKVFPNYMYYFAMCADFALRFVWLWELLAGRS
FT                   VFEGEANIFFLQSLEILRRWIWIFIKLEAEAINSDLPEKNYNIE"
FT   gene            complement(<262580..>262711)