(data stored in ACNUC8465 zone)

HOGENOMDNA: LACTH_8

ID   LACTH_8; SV 1; linear; genomic DNA; STD; FUN; 1423902 BP.
XX
AC   CU928180;
XX
DT   05-JUN-2009 (Rel. 101, Created)
DT   08-OCT-2009 (Rel. 102, Last updated, Version 2)
XX
DE   Kluyveromyces thermotolerans strain CBS6340 chromosome H complete sequence.
XX
KW   FUN; genomic DNA.
XX
OS   Lachancea thermotolerans
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Lachancea.
XX
RN   [1]
RP   1-1423902
RA   Genoscope - CEA;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RP   1-1423902
RX   DOI; 10.1101/gr.091546.109.
RX   PUBMED; 19525356.
RG   The Genolevures Consortium
RA   Genolevures Consortium, Souciet J.L., Dujon B., Gaillardin C., Johnston M.,
RA   Baret P.V., Cliften P., Sherman D.J., Weissenbach J., Westhof E.,
RA   Wincker P., Jubin C., Poulain J., Barbe V., Segurens B., Artiguenave F.,
RA   Anthouard V., Vacherie B., Val M.E., Fulton R.S., Minx P., Wilson R.,
RA   Durrens P., Jean G., Marck C., Martin T., Nikolski M., Rolland T.,
RA   Seret M.L., Casaregola S., Despons L., Fairhead C., Fischer G.,
RA   Lafontaine I., Leh V., Lemaire M., de Montigny J., Neuveglise C.,
RA   Thierry A., Blanc-Lenfle I., Bleykasten C., Diffels J., Fritsch E.,
RA   Frangeul L., Goeffon A., Jauniaux N., Kachouri-Lafond R., Payen C.,
RA   Potier S., Pribylova L., Ozanne C., Richard G.F., Sacerdot C., Straub M.L.,
RA   Talla E.;
RT   "Comparative genomics of protoploid Saccharomycetaceae";
RL   Genome Res. 19(10):1696-1709(2009).
XX
DR   StrainInfo; 318472; 1.
XX
CC   The Kluyveromyces thermotolerans sequence is made of 8 chromosomes (A to
CC   H). The sequence was annotated by the Genolevures Consortium.  For more
CC   information go to
CC   http://cbi.labri.fr/Genolevures.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1423902
FT                   /organism="Lachancea thermotolerans"
FT                   /chromosome="H"
FT                   /strain="CBS 6340"
FT                   /mol_type="genomic DNA"
FT                   /note="label:Klth0H"
FT                   /db_xref="taxon:381046"
FT   gene            complement(<1..>1980)
FT                   /pseudo
FT                   /locus_tag="KLTH0H00110g"
FT                   /old_locus_tag="KLTH-ORF2312"
FT                   /note="some similarities with uniprot|P33302 Saccharomyces
FT                   cerevisiae YOR153W PDR5 Short-lived membrane ABC (ATP-
FT                   binding cassette) transporter actively exports various
FT                   drugs expression regulated by Pdr1p also involved in
FT                   steroid transport cation resistance and cellular
FT                   detoxification during exponential growth"
FT   gene            complement(<3987..>5309)
FT                   /locus_tag="KLTH0H00132g"
FT                   /old_locus_tag="KLTH-ORF2311"
FT   CDS_pept        complement(3987..5309)
FT                   /locus_tag="KLTH0H00132g"
FT                   /gene_family="HOG000148525" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2311"
FT                   /product="KLTH0H00132p"
FT                   /note="highly similar to uniprot|P40896 Saccharomyces
FT                   cerevisiae YJL213W Hypothetical ORF"
FT                   /db_xref="GOA:C5E1W4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W4"
FT                   /protein_id="CAR30025.1"
FT                   /translation="MKTCTIDVNERNNKKLEDLVAPWRLKPLQNYYITNTNLIDVVEGK
FT                   THPEAYIFINEGKISKVNFGREPKSETSKDYEIIEGTGKYVMPGLFDNHVHMGAVPGEM
FT                   GLAQLAMMPESVAVLRLRFTMEASLARGFTTVRDCGGIEGFVKAAVANGSLIGPRLITC
FT                   GHAISQTGGHGDLRPGSLPASAFDSCSCHTGTVGVVADGVDGCYTAAREEFRRGADFIK
FT                   MMGSGGVASPTDKITNLQFCHDEIKALVDVAKTYHTYVTAHVYTPEAIQNCIKLGVKGV
FT                   EHGNLLDEETAELMAELGCYLTPTLVTYKIMASDQFGTFLGPVNRKKNAEVLGQGIDAI
FT                   KIAQEKGVKICFGSDLLGPLGGYQTQEFFIRGKVQSARDVLLSATVTPAEMNGLGNKLG
FT                   QVKPGFIADLLMMKSNPLEDVSIMDEPETNLVFVMKEGRIY"
FT   gene            complement(<6702..>8039)
FT                   /locus_tag="KLTH0H00154g"
FT                   /old_locus_tag="KLTH-ORF2306"
FT   CDS_pept        complement(6702..8039)
FT                   /locus_tag="KLTH0H00154g"
FT                   /gene_family="HOG000190850" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2306"
FT                   /product="KLTH0H00154p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W5"
FT                   /protein_id="CAR30026.1"
FT                   /translation="MVRKAHLPLLASIASACATCPSISDVNVLSADDGSSSFWGTGLGA
FT                   YIELTLSATEKGECWFSAPSNVFGNFPACPFSWDYGTVNSAGGNNYSIQFNQIPHGGVA
FT                   KLGFLTSLAEGYKSSITSGKTDTYSFVTSSGEHKSSVSFNDFPSDQVYCGSCGTQQEGN
FT                   SLSFDVSVPAAIIESAFTINIEKQQGYKFQTGGIKLYYTQSSNSFDEASNEQLVPSSSI
FT                   TDSSTEDKISIAFNGNLPSGCSGLRLSYDVAVLEEMTYYSSVCNVEFSSFSQQLTAYVY
FT                   TKNHMGSIETPAVSKGPGCGSQTSSSSGYSSSTVTTLSPSTGFTSSSTSAAVTSATSSS
FT                   GCDDGCDDGSGSSSSSSSPAAPTSSSGCDSGCDDNTATSSATPSTSTSSSSSSGTSCDS
FT                   GCDENSGSGSGSGSGHGSGHYAGHGGRHNWGHNSGHKGGQGSGCKS"
FT   gene            <10151..>13992
FT                   /pseudo
FT                   /locus_tag="KLTH0H00176g"
FT                   /old_locus_tag="pseudo-Klth0H-10151-13992"
FT   gene            <17248..>17763
FT                   /locus_tag="KLTH0H00198g"
FT                   /old_locus_tag="KLTH-ORF2293"
FT   CDS_pept        17248..17763
FT                   /locus_tag="KLTH0H00198g"
FT                   /gene_family="HOG000035426" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2293"
FT                   /product="KLTH0H00198p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5E1W6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W6"
FT                   /protein_id="CAR30027.1"
FT                   /translation="MLFIRKAAIGDLSDITNIIESAKIFLKSQNIDQWQNGYPNQEQAR
FT                   VDIAGGQCYVLICNNEVAAVGTITTDVDPSYTTIQGSWRKDSRKSYASLHRLAVSERFR
FT                   GKHLAQELLSGMIMKCKELGFVDVRVDTHKQNKVMQALLVKNYFEYRGVIYKNENRSSR
FT                   NAYQLLLH"
FT   gene            complement(<18972..>19883)
FT                   /locus_tag="KLTH0H00220g"
FT                   /old_locus_tag="KLTH-ORF2292"
FT   CDS_pept        complement(18972..19883)
FT                   /locus_tag="KLTH0H00220g"
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2292"
FT                   /product="KLTH0H00220p"
FT                   /note="similar to uniprot|P32331 Saccharomyces cerevisiae
FT                   YPR058W YMC1 Putative mitochondrial inner membrane
FT                   transporter member of the mitochondrial carrier (MCF)
FT                   family"
FT                   /db_xref="GOA:C5E1W7"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W7"
FT                   /protein_id="CAR30028.1"
FT                   /translation="MSEELTSPQVVDDLVDSHDVNQAFKDIFCGTVGGFAQVLVGQPFD
FT                   ITKVRLQTSPVPSTAVEVIKNLVKNEGILAFYKGTLVPLVGVGACVSCQFGINEAMKRH
FT                   FRRDHTESDQTLTLSQYYTCGFVSGFANAFLASPIEHVRIRLQLQTKSLDKAEYRGCID
FT                   CTKKLLQGGALMRGLSATMLRTSHGFGVYFATYEALIANQAHHGVLRQEIPAWKVCLYG
FT                   AFSGAFFWAMTYPFDVIKSVMQADSLKSPKYGRTVFSVARSIRRERGIGAFLKGFWPTM
FT                   LRSLPVNGATFAAFETAMRLIN"
FT   gene            <20372..>21772
FT                   /pseudo
FT                   /locus_tag="KLTH0H00242g"
FT                   /old_locus_tag="pseudo-Klth0H-20372-21772"
FT   gene            complement(<23047..>23715)
FT                   /locus_tag="KLTH0H00264g"
FT                   /old_locus_tag="KLTH-ORF2285"
FT   CDS_pept        complement(23047..23715)
FT                   /locus_tag="KLTH0H00264g"
FT                   /gene_family="HOG000258441" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2285"
FT                   /product="KLTH0H00264p"
FT                   /note="similar to uniprot|P40008 Saccharomyces cerevisiae
FT                   YER004W FMP52 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="GOA:C5E1W8"
FT                   /db_xref="InterPro:IPR014843"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W8"
FT                   /protein_id="CAR30029.1"
FT                   /translation="MSSRALIIGATGLCGSAFVKYVAKDPSFTEIATISRKALNGNYDG
FT                   KVRSLILEDSSNWSAAVPENYDILFSGLATTRGEAGKENFYKVDHDMNLQLARSAKEKG
FT                   YSTYVVVSSTGADENSMFYYMKTKGELERDILALGFERTIILRPGPLLGERTKSKGLLN
FT                   GLSSKIGSIVYRTKLQSVFGCPVYGDEVAKVGVKLALDTSDTAKIKIVESAEILRLAGV
FT                   "
FT   gene            complement(<24401..>26059)
FT                   /locus_tag="KLTH0H00286g"
FT                   /old_locus_tag="KLTH-ORF2283"
FT   CDS_pept        complement(24401..26059)
FT                   /locus_tag="KLTH0H00286g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2283"
FT                   /product="KLTH0H00286p"
FT                   /note="some similarities with uniprot|P53857 Saccharomyces
FT                   cerevisiae YNL234W similar to globins and has a functional
FT                   heme-binding domain involved in glucose signaling or
FT                   metabolism regulated by Rgt1p"
FT                   /db_xref="GOA:C5E1W9"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1W9"
FT                   /protein_id="CAR30030.1"
FT                   /translation="MFVGTNHRPNAAPQFVESLLTESQSTEDICLQSGDLKHRVSSDRS
FT                   SERIRLLRQSAVSSDTYPRSFLDAYHDEFSSSSSNGELTSERGESEKGDEAKIPKGITP
FT                   EASVTFQKHYKMSLQLQPHEIEMVRCSWSILLDDECSKPKYDAFVDKCVKPRINVPYKP
FT                   PANEDSKNNVKEQLANSGKYEDDLKVPTFLFGAQFLHNIREIIPTIENSFPGIQHAASG
FT                   VTGVVGMAISNLEDLSVMDYYLSSLGKHHARILGVYASHFDVAGIAFLKTLRDRFGYHY
FT                   TKELDELWSRIYIYLANSMLQYGIDPILQDSGSSEITLGFPQLKEDSLSTSNADLSSKD
FT                   SCGENEKIVGSLSDLSKNSTYSSKSAKEVSLVSSNKLLSRTSGWQSSKSSASSGQEGIN
FT                   SKTKKKEPTRNVGSVRGGGAWSGSHPQPTLAEESNVHYGASVRGGGGWQRSSGRSPSEK
FT                   DFKGNSIGVVNDGKHALSTSRINGKSNFSLPASRPGATYAGKTSDITGKTHLRCSENYE
FT                   MVTKAYSTVNSTARSSGGVRGGGGFNSGNGDCTLM"
FT   gene            <28695..>30227
FT                   /locus_tag="KLTH0H00308g"
FT                   /old_locus_tag="KLTH-ORF2280"
FT   CDS_pept        28695..30227
FT                   /locus_tag="KLTH0H00308g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2280"
FT                   /product="KLTH0H00308p"
FT                   /note="weakly similar to uniprot|Q12300 Saccharomyces
FT                   cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
FT                   /db_xref="GOA:C5E1X0"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X0"
FT                   /protein_id="CAR30031.1"
FT                   /translation="MGFLQKVFLAEEDIQGSKFRAIFIGLFVAFGGVLFGYDTGTISGI
FT                   LAMKYVKEHFTHRGSFTAGETSLITSILSAGTFVGAISAPLVSDTMGRRFGLIASTIVF
FT                   SIGVILQVAATGQDLLIVGRVIAGLGVGILSAIVPLYQSEAAPKWIRGAVVSCYQGAIT
FT                   VGLLLAACVNQGTHARTDSGSYRIPIAIQFAWALILFVGMIVLPESPRFYVKQGKIEKA
FT                   GNALSRLRGLPADHPIVEGELEEILANFNYEKSLGSTTVWDCFKRGNHQLKRMLIGLAI
FT                   QALQQLTGINFIFYYGTQFFQNSGIKNPFIIQVIMNVVNVVMTWPGVLLVELAGRRNLL
FT                   LWGAVGMCVSELIVASVGTALPDSTAANKTLIAFSCTFIASFAATWGPLAWVVVGEIYP
FT                   LRVRGKSVALCAASNWLFNFAIAYATPYLVDQEHANLQSKVFFIWGGCTFLCFLFVYFF
FT                   IYETKGLTLEQIDELFETCTSAPDSKNFIPSSGYAHESPDAEKAVVEAVEKV"
FT   gene            <31537..>36237
FT                   /locus_tag="KLTH0H00330g"
FT                   /old_locus_tag="KLTH-ORF2275"
FT   CDS_pept        31537..36237
FT                   /locus_tag="KLTH0H00330g"
FT                   /gene_family="HOG000034152" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2275"
FT                   /product="KLTH0H00330p"
FT                   /note="similar to uniprot|P53855 YNL242W Saccharomyces
FT                   cerevisiae ATG2 Peripheral membrane protein required for
FT                   the formation of cytosolic sequestering vesicles involved
FT                   in vacuolar import through both the Cvt pathway and
FT                   autophagy"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X1"
FT                   /protein_id="CAR30032.1"
FT                   /translation="MPSWFAQNLQRRLLLYFLQKASLFSNIDVSALDVSLGSSSHFTFH
FT                   DLDLDVESINIPDIALRSGFIEKLELSLTVSGGVKVEGSGLVFVVKPLLTNTYHPQSSS
FT                   FSLSKTVYDLASSVMQYSDKENTPEEDLSGEDNSSESDNRSYENFAAPAPSVLQSMRNK
FT                   ALDLALSNLKIQLKDVTIQFLFPQNNVLELSLQEALVLSANKAREVQLSNLQLLHWKQT
FT                   KSPDEEVESKTDLSMSDSLVYSKAEATSIYMSALQSFQEHENESTFVPQKSEALSFDTL
FT                   SMKFRGFASIDDLSISDIAIDFNECIIDLPLLLELNESISLPLLAMFSSKFHNNISDTA
FT                   KYQPQNLQNYKRFQNEQDIREESLFSNLKGSSAIIKLPGQLKVRLKSLLVKICESGIMS
FT                   STLGDISVLHQGFPIFTHVPTVPPFFSLMCIPGARKIDIALHHDISVVLDVHSLTDIFR
FT                   CVKSFEKCMAAWQQAVPRKSQPRGVKPKPYSIGIESETCHLELRLGEGTLNANLSAFSV
FT                   PNIFESVSLNSVEMNMKKNAQETPLVSIENIKLVTPENPMQFNSYDHGYQEIVISSKCC
FT                   INIESIRAEVPFLELESLSLEVQNLLKKVVASPDIKRSEYSPRKSGNRQLKRSVRILGS
FT                   SSIISKQSSTAQYVIQICTVDICLKDILGHDFGDLRGHLSDFFIYMGTDQRFTAHSNKL
FT                   SINRVSLSQGESLVDVLLVKNEQAPVLMVHKKLTGKICCTLRSVCLRYDAHILDLLKNR
FT                   KTSNDSASQILPKPAAEVKQNTTVLEFKLLECSISLKPYRLKSSVILILNKASIEFVLP
FT                   NFRSKGTLKACYILLIDDISNLVDQPGTNYPSLLSFYTERGFANVGKFDKMTLSLTKSR
FT                   NTMEIRADVNSVSLSLCADSAQALIQTIIDLGVPLTFPEDQKYRTKPTPTDILDDIEND
FT                   FFTEAKIQINPISTKEDPISIFDNFLDKSPEVVDTDSNMPAGESGSPKFGDQRFMVTEE
FT                   DYFSSKGCYPVQSIPEDPDVELSIVFGVENVSLKLYDGFDWKYTRNSISEIISQMESVL
FT                   RQQDLNQDPELIKASIFDSIYLFADKGTDVDSLRQHINRDLQSEPSVFVKGSSKKTRLR
FT                   PSRDFKVRIGISGITAIFTKFVVDEPTEFTSDLSADTLHDVKLQVRDIEVVDNVPSSTW
FT                   NKLLTYLKDKPRAKGSEMLSLNIQTVRPIDFLAATELIMYVHVLPLQVHIDQDTLEFLT
FT                   RFAEFKDSRFELIDEFPDFVYIQKLEVEAVQIRMDYKPKKVDYSGLKSGHASEFMNFFI
FT                   LEGSRFQLQHLIVYGVNGFPELNKTLNNAWLPDITGNQLKGILSGVAPMKTLVTLGSGV
FT                   KALVSTPVKEYKRDQKLGRGLQKGTQVFVKVTTGEFVRLGVKLASGTQALLENAEELMG
FT                   GEGSRARDHSINGFEFDLVPEETVKQYEKLMGGTNPSHKGRVSEAIVVEPPSNEKEPPR
FT                   IFSLYADQPNTLQRGLKEAQSSFGRNIQLAYDALKKAQGEIKESESAQETASSMARVVP
FT                   VALIRPIIGATEALSKTLQGISNEIDEEQVTYLQDKYKSRRPRETL"
FT   gene            <36466..>39633
FT                   /locus_tag="KLTH0H00352g"
FT                   /old_locus_tag="KLTH-ORF2272"
FT   CDS_pept        36466..39633
FT                   /locus_tag="KLTH0H00352g"
FT                   /gene_family="HOG000165645" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2272"
FT                   /product="KLTH0H00352p"
FT                   /note="similar to uniprot|P35688 Saccharomyces cerevisiae
FT                   YDL240W LRG1 Putative GTPase-activating protein (GAP)
FT                   involved in the Pkc1p-mediated signaling pathway that
FT                   controls cell wall integrity appears to specifically
FT                   regulate 1 3-beta-glucan synthesis"
FT                   /db_xref="GOA:C5E1X2"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X2"
FT                   /protein_id="CAR30033.1"
FT                   /translation="MSYATEPHKQQVLNRNNDRTINSGHLATVPNERLQEKRPSLPHQQ
FT                   SSRTAKICARCNKAIARGSLKALGRYYHEECFVCYDCGKVCKPKYFPFEDPKTRKLIPL
FT                   CQQDYFKRNNLLCFVCGKALRGVYYNAFGKLYDEEHFCCKICKEKCGVNTCFNYQDDLY
FT                   CKYHFLKFFSNRCKGCQYPISDQYIEFPRGEEVHRWHPECYGVHKYWHVSLPPEAVGLP
FT                   QIKRADPNDIFLGEEHLSNRTDLEKYVFTFNKLVSKTWSVLYRFEEETAICISDMFQYL
FT                   TSFDQLKGLNSTALFVLKIECLFRALDSLDSLCGYNLFGKPQGKYGDPADDRLEAADND
FT                   VSSETVDTINLKYAKFPRNLSTKVMIYLQLLRKLSSASREKDVNVSSLMSVITGVAHFL
FT                   KLLVRHGLQTALDRNRSVHSANALIKFLREIEKNELVSGDPFRLINVSINATDCCAACG
FT                   KYIQEDCIQFKARRWHKGCFSCSICQRHIDLYGVADAAFNTKANSVLCAQCAVGDPDSS
FT                   SGFKSVTKLAQLIFLLKIALVRSKAVMEIQLKNREALKRSNSVKESISMQQTYIRTLND
FT                   IKRLKSRRQSVPLTTNKQEARRSRILETSEMDTGRSSQPEDKCLVIQTDKSPETEPENQ
FT                   NMFNSTKTLTLDDISRIVAAEQARELRPNAFAYFKKLKDNDDDAVNIMNKKSGIYYSEL
FT                   KFEELYLIKLISLSLLNASSIDVMKDEATVNSLVPSPPKSLKNGANFWSKMRTIMSKDG
FT                   KRGYSKKVFGTSLEVLTTQWGVDSDLGIGPSKIKIPIIVDELISSLRQLDMSVEGVFRK
FT                   NGNIRRLRELAVAIDDNPSEVPDLSKENAVQLSALLKKFLRELPDPLLTFPLYKLWIEI
FT                   AKIESDLERHKYFGLLYALLPGFNRSVAEVLFSFLHWTSSFSHIDSQMGSKMDIHNLST
FT                   VITPNILYEQGATSAQPTVHGGAIHNTYNDAFAQNEGENYFLAIEVVDYLINHNEDLSV
FT                   VPKYMATLLKEVKEKQLFGFEAIKGFVSAQLEGGRLNFSEYDVVESVKMKTSSSVAKLE
FT                   VKGNNAS"
FT   gene            complement(<39762..>41297)
FT                   /locus_tag="KLTH0H00374g"
FT                   /old_locus_tag="KLTH-ORF2267"
FT   CDS_pept        complement(39762..41297)
FT                   /locus_tag="KLTH0H00374g"
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2267"
FT                   /product="KLTH0H00374p"
FT                   /note="highly similar to uniprot|P11412 YNL241C
FT                   Saccharomyces cerevisiae ZWF1 Glucose-6-phosphate
FT                   dehydrogenase"
FT                   /db_xref="GOA:C5E1X3"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X3"
FT                   /protein_id="CAR30034.1"
FT                   /translation="MSKPTEFKENTSIVVFGASGDLSKKKTFPALFGLFREGYLDPSCK
FT                   IIGFARSNLSDEDLHEKIKPNLKTNNDEKGSEKIEQFLKMVSYISGPYDKDEGFDKLAK
FT                   ELDSYEKKQGVKSPHRLFYLALPPSAFVTVATQIKKKVYAEHGETRVVVEKPFGHDLDS
FT                   FRELQSDLSPLFREDELFRIDHYLGKEMVKNLVFMRFGNTFLNAAWNKENIQMIQISFK
FT                   EPFGTEGRGGYFDEIGIIRDVMQNHLLQVLTLLTMERPVTFDSEAVRDEKVKVLKAFAP
FT                   IDHKDILIGQYGKSEDGSKPGYLDDDTVNPDSKCVTFAALGFKIQNERWDGVPIVMRAG
FT                   KALNEGKVEIRIQFKAVPSGVFSEVAHNELVIRVQPDEAIYIKCNSKTPGLSTTSQVSE
FT                   LDLTYARRFKDFWIPEAYEALIKDVLSGDHSNFVRDDELDISWKLFTPLLKYLEGPDAP
FT                   KPEEYAYGSRGPAELVNFLKSHDYVFEDSGSYQWPVITPEVTKKKQNSTDSKM"
FT   gene            complement(<43400..>44791)
FT                   /locus_tag="KLTH0H00396g"
FT                   /old_locus_tag="KLTH-ORF2263"
FT   CDS_pept        complement(43400..44791)
FT                   /locus_tag="KLTH0H00396g"
FT                   /gene_family="HOG000191744" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2263"
FT                   /product="KLTH0H00396p"
FT                   /note="similar to uniprot|P23503 YNL240C Saccharomyces
FT                   cerevisiae NAR1 Nuclear architecture related protein
FT                   component of the cytosolic iron-sulfur (FeS) protein
FT                   assembly machinery"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X4"
FT                   /protein_id="CAR30035.1"
FT                   /translation="MSSLLSEKDLNDFISPGLACVKPAEPIEKGEKQEGDLEVGKESND
FT                   MGKVSISLQDCLACSGCITSSEEILLSQQSHTVFLEAWKNLARDTALVVSIPPQCRLSL
FT                   AHYYDMSLESFDKSFLTLMKEKFGARYIVGTQIGRNITVNQTNKLLTERKSLSSSKKPA
FT                   LCAVCPGFVLYAEKTKPELVPYLLDVKSPQQITGALLKKAIPNIYHLTIMPCFDKKLEA
FT                   SRKDGEGEVDCVITPREFATMLQEQDLKLTDFLTSTDETVLKQSCSPPGWDISVHWASN
FT                   EGSASGGYAYQYILHQKSLHPGSCISTITGKNSDLKEFRLMDVSNENVIASSSELYGFR
FT                   NIQNMVRKLTSSGSASRNIKVLRKRATTSSNNGSSFGSAVDPSKTDFIEVMACPGGCIN
FT                   GGGLLNGEANSSRRRALAKSLELEYGKVIPKVSCSDHPRDDSTYKYKFSAIEKSQDVLT
FT                   VGNTW"
FT   gene            <46022..>48457
FT                   /locus_tag="KLTH0H00418g"
FT                   /old_locus_tag="KLTH-ORF2261"
FT   CDS_pept        46022..48457
FT                   /locus_tag="KLTH0H00418g"
FT                   /gene_family="HOG000192536" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2261"
FT                   /product="KLTH0H00418p"
FT                   /note="similar to uniprot|P13134 YNL238W Saccharomyces
FT                   cerevisiae KEX2 Subtilisin-like protease (proprotein
FT                   convertase)"
FT                   /db_xref="GOA:C5E1X5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X5"
FT                   /protein_id="CAR30036.1"
FT                   /translation="MRLAFCKYFLLQVLLLSIVSQAVRVPVKDHSSRSYFAVESVLEVP
FT                   RLLKLHPNWVFEHEARGLDKHYVFSTKKDEYSKRDEVEASYEGVKSYHPLPPKKLQKRL
FT                   PVPDRPVDSSLEVVNEVRDRLSIEDPLFGIQWHLVNGNYPGHDVNVSGLWYENVTGHNV
FT                   VVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGEIAAVKNKA
FT                   CGIGVAYNAKVAGIRILSAEVTAEDEAASLIHALDVNDIYSCSWGPLDDGRVLQGPDDL
FT                   VRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGYTNSIYSITVGAIDHKGLHPP
FT                   YSESCSAVMVVTYSSGSGEHIHSTDIHGKCSDTHGGTSAAAPLAAGVYSLVLEANPNLS
FT                   WRDVQYLSILSSEEINDDDGEWQEGALGKRYSHKYGYGKLDAYRIVTMGREWENVGPQS
FT                   WYYSSVQKVGKSTNSTDEDLVSSISVSSEQLKNANFKRVEHITVTVSIETTIRGRTTIN
FT                   LVSPKGIVSKLGVVRRSDTSPEGFQNWTFMSVAHWGEIGEGDWSLHVRTTEDSNNVEFK
FT                   DWRLKLFGESLDASKAKTFEFGNDKEPTEDLQQQQQEESVSDHPTSLASSTQPTFTAAS
FT                   SITSTHSTVSATTTTAETSDQDVNSPNKLPRPFEGLRYFLAIFAVGFLVLVLYYYFFVK
FT                   SRRLVRRSRAEAYEFDIIDTDSDHDSSLNSASNTSVPMMGELNEEDFNFDLSDEELLRS
FT                   ATVSPAPRYEQNVPAGASSDDLPTADPSKGKVHSENSSNNNGKRNNMPREGSQGPNNG"
FT   gene            <48723..>50072
FT                   /locus_tag="KLTH0H00440g"
FT                   /old_locus_tag="KLTH-ORF2259"
FT   CDS_pept        48723..50072
FT                   /locus_tag="KLTH0H00440g"
FT                   /gene_family="HOG000172196" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2259"
FT                   /product="KLTH0H00440p"
FT                   /note="similar to uniprot|P53584 Saccharomyces cerevisiae
FT                   YNL237W YTP1"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X6"
FT                   /protein_id="CAR30037.1"
FT                   /translation="MGSHYGCPRKLVAYLAIALLLVEQETCAGMQMDDTEGLTRPDIVQ
FT                   AGPKTFHWLCTLALLLLLPSVSTALSFAGKLYFSMFLQIVSLAYAVAEAFILRFPDGDG
FT                   IENRTSRGTAWFMLALLGVTVFFGSLATGTGALVQNKRLQSLASHTGEKTLRYIHRALS
FT                   FAVVLTGWIKCCLAPVAMFGFCRDKHTGQCIAHGIMGTAFVLYGFVYSMVLVVPWIRNS
FT                   QAEYSQDRIDSWVMCAWGIVNTFTEHRWGREDWNHGDYQHTAMGIIWWAGGLLGIFLSR
FT                   NGRRTFVPSLLIIFTGWAMSEHSQKLIISTKVHALFGLVLMAGGALRIVEISFLLRDRR
FT                   AASEILSFQYLAPFCLVCSGVLFMGANEEQLQLVLRLGADHSAYSLVAISAAFVVYLWI
FT                   LLCLELYLKLVKLAEKGPLDSYTNNRGLESLTEFELDDVDGENHETVSRN"
FT   gene            <51279..>54104
FT                   /locus_tag="KLTH0H00462g"
FT                   /old_locus_tag="KLTH-ORF2257"
FT   CDS_pept        51279..54104
FT                   /locus_tag="KLTH0H00462g"
FT                   /gene_family="HOG000113525" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2257"
FT                   /product="KLTH0H00462p"
FT                   /note="similar to uniprot|P32259 YNL236W Saccharomyces
FT                   cerevisiae SIN4 involved in positive and negative
FT                   regulation of transcription"
FT                   /db_xref="InterPro:IPR021665"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X7"
FT                   /protein_id="CAR30038.1"
FT                   /translation="MSLFGTEDGEFVAWSKSGLIAYLDSRSSHANLCITFMETINGTNW
FT                   RLHPCKRYVVHPHLLETQSPAGASSIVGGGGGGSSRSFHNLNSVHWNNLSSHTGEQLAA
FT                   CDELGNLTIIAAGQSMEGQGTLDKMIVLCQDNIYKTYNLTAPLQEVNPAAKIYRKQAKK
FT                   EVHTTIIEFMWIGTQKPVLTMLGARKDSTTSTFHSQIQQCQPYGLFHPASIKSAFIALR
FT                   RGGQLDFWYQFSNSRDHKKISLQLNGSHEARSKQFEWFQMGGFAQMEDDQALLIGAFSK
FT                   LSNSLSFYRLHVNWNLSSQNSMNDPSLKLQHLLEIKPDYVGPQGELLNFTNFELLSPTH
FT                   DRQSPLELLMCYEVAGLSRSIVKRYSLIKAVPSAILTIEFGVLNTEIPSSGSDYSFSEN
FT                   EVITFDSGVTAAKSYNSETLVIFKLKNGRIEVYNRKTWRKENHEFNKINASASHAATLS
FT                   SPFCTGLNFPEIPPPAVTGWSEIAPALGGVLTKSRFDGELQFHPVTAPVTDDSQNDSNI
FT                   AAAFAYAFVCANHLQASGEDLSIAIKTYMLRIRQQSVARSDVFLREVICIIYHLFGLTP
FT                   DASKEVKDKLIMSRPIQRAMLLQLELGSSFDNSNVYNMSRTAMSLRNILFAFNGVSRNI
FT                   QVLIHHSATMNFQQSNGKLFQFAFSKQDLIYSLIPCAKWFVKLVTFLTQQMIVLVNSPQ
FT                   DKDNTLVLGILSSKMTRQLLLSVLSEIRKIIHLVTKFPETAFPILNESSIYLRKVLGDS
FT                   PVNFEKFETFLADVNNKFTSLSEQQAQGNAMKDSYLIIEGDIPEEISHLKEFMLSYSNT
FT                   AVLSHIKPSEVYFSDTRGLRIFASELFSDSIFKLLQPLEKGLVVNSKVLSESISSSSFC
FT                   VAESDDISKDTLKNLNEGQKVKRCCRCGAITRAGYTVSKDNTIVPTSISTKRWTSLYLK
FT                   TCICSGFLYEL"
FT   gene            <54539..>55867
FT                   /pseudo
FT                   /locus_tag="KLTH0H00484g"
FT                   /old_locus_tag="pseudo-Klth0H-54539-55867"
FT   gene            complement(<56283..>57424)
FT                   /locus_tag="KLTH0H00506g"
FT                   /old_locus_tag="Klth0H.mRNA.at.316.m"
FT   CDS_pept        complement(join(56283..57332,57377..57424))
FT                   /locus_tag="KLTH0H00506g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.at.316.m"
FT                   /product="KLTH0H00506p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X8"
FT                   /protein_id="CAR30039.1"
FT                   /translation="MMKTSDVERLAYLHQERHLKNDGFCEFIENVATNQYLLRYTYGNL
FT                   VIRQATNKLTQRTPQLVLETLEDNGVFHNEERILIEKFTEQLIANQIQFETRKRSRGRG
FT                   KNFCYNKNYHSGGKFKLKYTNTDFRKLTGFCRSDFDRVVEALKMPSYIGAYSLDAFECF
FT                   FIFVVRLKSGCTYTVLTSLCGREASTISRIITFVTCYLFHIASSCLSVTNASWLAGRLA
FT                   NIDQSLLSSSRSISNSRIVGFIDGTHVKIARPHGNARLENAAYSGHKKTHTLKYQAVTT
FT                   PDGICIDLAGPFAGSQHDSFLFANSGLYRRLKPALKVGGIQYRISGDPAYRSSDLLTVG
FT                   YKGQNLTNGQKEYNKILSGSRVSIE"
FT   gene            <57753..>58538
FT                   /locus_tag="KLTH0H00528g"
FT                   /old_locus_tag="KLTH-ORF2244"
FT   CDS_pept        57753..58538
FT                   /locus_tag="KLTH0H00528g"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2244"
FT                   /product="KLTH0H00528p"
FT                   /note="highly similar to uniprot|P32379 Saccharomyces
FT                   cerevisiae YGR253C PUP2 Alpha subunit of the 20S proteasome
FT                   involved in ubiquitin-dependent catabolism human homolog is
FT                   subunit zeta"
FT                   /db_xref="GOA:C5E1X9"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1X9"
FT                   /protein_id="CAR30040.1"
FT                   /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEG
FT                   VVLGVEKRVTSPLLEGDSIEKIVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYD
FT                   EDISIESLTQSICDLALRFGEGASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGT
FT                   FYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAELLVLKILKQVMEEKLDEGNAQLSCV
FT                   TKEDGFKVYSDEKTAAIIKELKDKEAQENSETQDVEMST"
FT   gene            complement(<58659..>59945)
FT                   /locus_tag="KLTH0H00550g"
FT                   /old_locus_tag="KLTH-ORF2243"
FT   CDS_pept        complement(58659..59945)
FT                   /locus_tag="KLTH0H00550g"
FT                   /gene_family="HOG000192257" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2243"
FT                   /product="KLTH0H00550p"
FT                   /note="highly similar to uniprot|Q03330 Saccharomyces
FT                   cerevisiae YGR252W GCN5 Histone acetyltransferase
FT                   acetylates lysine 14 on histone H3 catalytic subunit of the
FT                   ADA and SAGA histone acetyltransferase complexes founding
FT                   member of the Gcn5p-related N-acetyltransferase
FT                   superfamily"
FT                   /db_xref="GOA:C5E1Y0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y0"
FT                   /protein_id="CAR30041.1"
FT                   /translation="MTSKRKDGAEEGSEAKRQKVERNVKDEPESQPEVVDLLEEQPATE
FT                   SRANSGDKEEKESDEAGVTHFTFDGQEYKFKERASVIEEKEGKIEFRVVNNDNTKENMM
FT                   VLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRPFDNREFAEI
FT                   VFCAISSTEQVRGYGAHLMNHLKDYVRATSKIKYFLTYADNYAIGYFKKQGFTKEISLD
FT                   KSVWMGYIKDYEGGTLMQCSMLPRIRYLDAAKILLLQEAAVQRKVRLMSKSYVVHPGLK
FT                   IFKDLENIKPIDPMEIPGLKESGWTPEMDELAQRPKRGPHFAAMQNVLTELQNHAAAWP
FT                   FLQPVNKDEVPDYYEFIKEPMDLSTMEIKLENNRYEKMENFFYDARLIFNNCRAYNGEN
FT                   TSYFKYANRLEKFFNTKMKEIPEYSHLVD"
FT   gene            complement(<60065..>61960)
FT                   /locus_tag="KLTH0H00572g"
FT                   /old_locus_tag="KLTH-ORF2239"
FT   CDS_pept        complement(60065..61960)
FT                   /locus_tag="KLTH0H00572g"
FT                   /gene_family="HOG000162379" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2239"
FT                   /product="KLTH0H00572p"
FT                   /note="similar to uniprot|P38862 Saccharomyces cerevisiae
FT                   YHR171W ATG7 Autophagy-related protein that is a member of
FT                   the E1 family of ubiquitin-activating enzymes mediates the
FT                   conjugation of Atg12p with Atg5p a required step in the
FT                   formation of autophagosomes"
FT                   /db_xref="GOA:C5E1Y1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR006285"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y1"
FT                   /protein_id="CAR30042.1"
FT                   /translation="MSDPHLKFVAPCQSFLDTSFFQELARLKLDVLKLDSAIKELTSSI
FT                   GISHIPRGSPCAHLFLDSHSFGSRERKEGEMLIKGSLYNFNTIEEFKKVDKTRFLRDRA
FT                   DELWKEGIEDPNDCVKFSIISFADLKAFKFFYWVCVPCFQLDSLTASVRGSGPFKSTSK
FT                   FDEWFAAHPGCWSCLVGESGELMEFNKVNSVRSSTLCMRDTSTVDMVPSALAKSFISLL
FT                   KHFRSDLKEVRLIFIRSETASSFWVDTDMSSILAPDNTKLKVTGWERNLQNKLTPRAVD
FT                   LSSLIDPLHVADQSLDLNLKLMKWRIAPEINLDIIKNTSVLLLGSGTLGCYVARVLLAW
FT                   GVRKITFVDNGTVSFSNPVRQPLFTFNSCGKPKAAAAADSLREIFPLVEAEGVELAVPM
FT                   IGHPITSESKQNEDYKRLLELIKAHDVVFLLMDSRETRWLPTVMGYAEDKIVINAALGF
FT                   DSYLVMRHGNYETDQKADRLGCYFCQDVVAPSDSLTDRTLDQMCTVTRPGVALMAASQS
FT                   VELLVSLLQHPMRNGGRPDEKVILGDLPHQIRGFLSEFKTLQLRVTAYEHCSACSSIIV
FT                   EEFKSRGWDFVRDALNDYKTVEDLCGLSEVQLKAEEVMNDVLDEWDDDGEDGELL"
FT   gene            complement(<62142..>63680)
FT                   /locus_tag="KLTH0H00594g"
FT                   /old_locus_tag="KLTH-ORF2235"
FT   CDS_pept        complement(62142..63680)
FT                   /locus_tag="KLTH0H00594g"
FT                   /gene_family="HOG000168152" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2235"
FT                   /product="KLTH0H00594p"
FT                   /note="highly similar to uniprot|P38861 Saccharomyces
FT                   cerevisiae YHR170W NMD3 Protein involved in nuclear export
FT                   of the large ribosomal subunit acts as a Crm1p-dependent
FT                   adapter protein for export of nascent ribosomal subunits
FT                   through the nuclear pore complex"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y2"
FT                   /protein_id="CAR30043.1"
FT                   /translation="MNYTPLDQSAFNNHQAATVLCCNCGTPMDGSSGLVMCYDCIKLTV
FT                   DITEGIPRESNVSFCRNCERFLQPPGQWVRAELESRELLALCLRRLKGLNKVRLVDASF
FT                   IWTEPHSRRIRVKLTVQGEAMANTIIQQTFEVEYVVVAMQCADCARSYTTNTWRATVQI
FT                   RQKVSHKRTFLYLEQLILKHNAHVDTINIQEAKDGLDFFYAQKNHAVKMLDFLNAVVPI
FT                   KSKKSEELVSQDTHTGASTYKFSYSVEIVPLCRDDLVVLPKKLAKSLGNISQFVLCSKI
FT                   SNTIQFLDPMTLQTSDLSPSVYWRSPFDSLADVSQLVEFIVLDVDPTGQTKGKWVLADI
FT                   TVARASDLGSNDQVYYVRSHLGAICHPGDSVMGYFIANSNYNSDLFDALNMEHVPDVVL
FT                   VKKQYIRKTRKNRSWKLKRMAREHKDIEASQDYSSRQQKQEMERAEKDYELFLQELEED
FT                   AEMRQAVNLYKSAQQAPQDGEMDEDEEEDAPQIDIDELLDELDEMTLDEGAPPA"
FT   gene            complement(<63837..>64415)
FT                   /locus_tag="KLTH0H00616g"
FT                   /old_locus_tag="KLTH-ORF2233"
FT   CDS_pept        complement(63837..64415)
FT                   /locus_tag="KLTH0H00616g"
FT                   /gene_family="HOG000074561" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2233"
FT                   /product="KLTH0H00616p"
FT                   /note="similar to uniprot|P53317 Saccharomyces cerevisiae
FT                   YGR251W Protein required for cell viability"
FT                   /db_xref="InterPro:IPR022592"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y3"
FT                   /protein_id="CAR30044.1"
FT                   /translation="MSRAKEIQEKLSLQAKLQASFNASALKASEWLPKDSLEDQKSDLT
FT                   SSKDSFYSLPVIGVGAGLSFEEKEESNAQGEVSTIGEFINSNKKLSSLAKKKKGKHATN
FT                   SQSQSGGIFKVSSSDTRAMVALKRKMKSGRRQELRNKISRPSALDMSHPGLGTKEDLRH
FT                   SDSDEEPQVTKTSKKSYGLLFESKKPKRK"
FT   gene            complement(<64621..>65922)
FT                   /locus_tag="KLTH0H00638g"
FT                   /old_locus_tag="KLTH-ORF2232"
FT   CDS_pept        complement(64621..65922)
FT                   /locus_tag="KLTH0H00638g"
FT                   /gene_family="HOG000268802" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2232"
FT                   /product="KLTH0H00638p"
FT                   /note="highly similar to uniprot|P38719 Saccharomyces
FT                   cerevisiae YHR169W DBP8 Putative ATP-dependent RNA helicase
FT                   of the DEAD-box family involved in biogenesis of the 40S
FT                   ribosomal subunit"
FT                   /db_xref="GOA:C5E1Y4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y4"
FT                   /protein_id="CAR30045.1"
FT                   /translation="MSSEFATLGISKWLVEALQAMKITQPTAIQKACIPQILQGKDCIG
FT                   GAKTGSGKTIAFGAPMLTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVAL
FT                   VVGGESIVDQAINLQRKPHFIVATPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADILLT
FT                   DTFSEHLATCISILPPKEKRQTLLFTATVTDQVKALQNAPAAEGKPPLFSYEVESMDKV
FT                   AIPSTLKTTYLLVPEQVKEAYLYQILTNATYNESSAIIFVNRTVTAEILRRTLKQLDVR
FT                   VASLHSQMPQQERTNSLHRFRANAARVLIATDVASRGLDIPTVQLVINYDISSNPDTFI
FT                   HRAGRTARAGRSGESICFVAPRDVSRIEAIEERINKKMEEFKDVHDTAVIRKALNKVTV
FT                   AKRESLMSMEKENFGERRKLHLKKSGLSKSYRNN"
FT   gene            complement(<67991..>69601)
FT                   /locus_tag="KLTH0H00660g"
FT                   /old_locus_tag="KLTH-ORF2230"
FT   CDS_pept        complement(67991..69601)
FT                   /locus_tag="KLTH0H00660g"
FT                   /gene_family="HOG000094448" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2230"
FT                   /product="KLTH0H00660p"
FT                   /note="similar to uniprot|P38860 Saccharomyces cerevisiae
FT                   YHR168W MTG2 Putative GTPase member of the Obg family
FT                   peripheral protein of the mitochondrial inner membrane that
FT                   associates with the large ribosomal subunit required for
FT                   mitochondrial translation possibly via a role in ribosome
FT                   assembly"
FT                   /db_xref="GOA:C5E1Y5"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y5"
FT                   /protein_id="CAR30046.1"
FT                   /translation="MVLRRPIQRASLRVRFNSTAPDNAPKASDNEIWLRKLSNNRKLAH
FT                   APEVSQKIQPASSSQDHRNRFEIISTPPDTSFIGVKAPLSEFTSLSHIQSNNQRHAQAK
FT                   KFVDVRILKCRSGQGGDGAVSFFRDAGRAIGPPDGGDGGDGGSVFVQAIEGLNSLAKLK
FT                   TSYIAEDGANGAAKQLDGARGKDVLISVPVGTVVKWCLNPSAVRSFIEKFKNRGTVNLR
FT                   QLLEQNKVSLQCTGRFEMDQKPSFIQLFRESYEAGEGWHFKGKDEEYHLEKNWFKQLKE
FT                   KVSIYDLELASSELSADKFPLLGIDLDKPSDRPICLVKGGKGGLGNMHFLTNLIRNPRF
FT                   SKMGRSGLEQFFMFELKSLADIGLVGLPNAGKSTILNKISKARPKIGHWEFTTTHPSIG
FT                   TFNVGAEGFGFTVADIPGIIKDASKDKGMGLEFLRHIQRSKGWTIVVSLEREDPLADLQ
FT                   LLISELGGMEEVARKNVLVVCNKADIEPHNPQSLDKFLDVQGFCETQNWDIIPISALKG
FT                   ENIDLLIEKMARCAETSAT"
FT   gene            complement(<69803..>70579)
FT                   /locus_tag="KLTH0H00682g"
FT                   /old_locus_tag="KLTH-ORF2228"
FT   CDS_pept        complement(69803..70579)
FT                   /locus_tag="KLTH0H00682g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2228"
FT                   /product="KLTH0H00682p"
FT                   /note="some similarities with uniprot|O13539 Saccharomyces
FT                   cerevisiae YHR167W THP2 affects transcription elongation"
FT                   /db_xref="InterPro:IPR018557"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y6"
FT                   /protein_id="CAR30047.1"
FT                   /translation="MSSKTVERLLDDLHKSLDVNYAHSSELIESLSVLSSDSTDDKMIE
FT                   AIRALQKTFHSFTTSLADLRDENINAMESHNTKRKVEPFANVAKSRLSATFDENGNAST
FT                   LLSYVDEVITGNNLNLEHINLIGRLSSVLTEMLPSELDDSTQNLELAQILEAYNTDSKG
FT                   SEDTDCLKEKLLDWIDSIKMEKARYSLENQHILRDSLKALTMEVTRWRENYESIEGMMF
FT                   GENANSISQMLHKVQRLRPQLNSGSGEGQEEDVKME"
FT   gene            <70712..>72577
FT                   /locus_tag="KLTH0H00704g"
FT                   /old_locus_tag="KLTH-ORF2227"
FT   CDS_pept        70712..72577
FT                   /locus_tag="KLTH0H00704g"
FT                   /gene_family="HOG000115852" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2227"
FT                   /product="KLTH0H00704p"
FT                   /note="similar to uniprot|P16522 Saccharomyces cerevisiae
FT                   YHR166C CDC23 Subunit of the anaphase-promoting
FT                   complex/cyclosome (APC/C) which is a ubiquitin-protein
FT                   ligase required for degradation of anaphase inhibitors
FT                   including mitotic cyclins during the metaphase/anaphase
FT                   transition"
FT                   /db_xref="GOA:C5E1Y7"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR007192"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y7"
FT                   /protein_id="CAR30048.1"
FT                   /translation="MLESSLMNFLSELKLELRESAVQLSRLKLYNSSKWSAEALCGMCE
FT                   IPSVPVMKTFMKNDDSPLRNRSNIQFEQQESPQKHLSGMESSEYDLYLLASTLFECKEY
FT                   DRCAYYLADSKHPELKFLKLYSKYLSWDKKTQENMESSLAPRSSKQNTGFRENAEIANR
FT                   EIMNRLHSHESGNSNALKKSQKSVDLDNGESTSIPMILKELNNYLLLEGEKPTFGISLL
FT                   HYLRGVLYKIQDIPSNAISSFLSSLTLFPFNWVCWTELLSCISRTDESVLLLKILSEKF
FT                   TDEKTQVMLKFFKLSIFQEFSGNIDDFIQELDYLLSIFPNFAFLKTQHALINYHYMDYV
FT                   SAGLIFEQIIKLDPYRLEDMDTYSNILYVMQKPSKLAYLAQFASGVDRFRAETCCIIAN
FT                   YYSAKQEHEKSILYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIECYRRAVDINPRD
FT                   FKAWYGLGQAYEVLDMHLYSLYYFQKSCALKPLDKRMWQALASCYEKVDNLEESIKCYT
FT                   RALQLSLDSDIDTTILFRLAVLYEKQKDIISCKEYMLRCVEAQHSTDGFINDETTKASL
FT                   WLARYEARYKNFSEAYKHALRVTHGSSQEIEEARAIVRECRKRMD"
FT   gene            <72819..>80063
FT                   /locus_tag="KLTH0H00726g"
FT                   /old_locus_tag="KLTH-ORF2226"
FT   CDS_pept        72819..80063
FT                   /locus_tag="KLTH0H00726g"
FT                   /gene_family="HOG000184103" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2226"
FT                   /product="KLTH0H00726p"
FT                   /note="highly similar to uniprot|P33334 Saccharomyces
FT                   cerevisiae YHR165C PRP8 Component of the U4/U6-U5 snRNP
FT                   complex involved in the second catalytic step of splicing"
FT                   /db_xref="GOA:C5E1Y8"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR012591"
FT                   /db_xref="InterPro:IPR012592"
FT                   /db_xref="InterPro:IPR012984"
FT                   /db_xref="InterPro:IPR019580"
FT                   /db_xref="InterPro:IPR019581"
FT                   /db_xref="InterPro:IPR019582"
FT                   /db_xref="InterPro:IPR021983"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y8"
FT                   /protein_id="CAR30049.1"
FT                   /translation="MSGLPPPPPPPGFNASVPPPPPPGFRKRTSVSRSEDDFNVKDLKE
FT                   QLLPPPPPPPMPSSISALPPPPPHHHHHKGPDTSKPALKKQKLLSHCLESPRLSVEELK
FT                   ERKREWISSQKKRFRQSSSKCARGKTQKRGVIHSHKVDMPPEHLRKIINDHKDMSSKRF
FT                   IHDKRAFLGALKYMPHAILKLLENMPQPWEQVKEVRVLYHNTGALTFVNEIPRVIEPVF
FT                   TAQWSAAWIAMRREKRDRRHFKRMRFPPFDDEEPPLSYHEHIQGIEPLDGITLQLDEVD
FT                   DALIKDWIFDSKPLLDEKSCVNGSSYKTWSIDHRTMANLHRLSSPLLDSGLDSNKNYLF
FT                   EKKSFFTAKALNNAIPGGPKFEPLFSAEEENDINEFNSLDRVIFRVPIRTGYRIAFPHL
FT                   YNSRPRAVQLSWYHTPIACLAEETQDENAETFRFDPSFNLISASYGTSRPLSLESEDFL
FT                   LDANFRPLLSSEKVCLPDTKAAISLYHAPYPFNLRSGRTVRAQDVALVKKWYLQKPETD
FT                   VPVKVRVSYQKLLKNYVLNELKSSKLGKQSKKKLLRSLRNTKFFQQTSIDWVEAGLQLC
FT                   TQGFNMLNLLIHRKGLTYLHLDYNFNLKPTKTLTTKERKKSRFGHAFHLMREILKAIKL
FT                   LVDAHVQYRLGNVDAFQLADGVYYILNHLGQLTGIYRYKYKVMHQIRACKDLKHVVYNR
FT                   FNRVIGKGPGCGFWQPAWRVWIFFMRGIIPLLERWLGNLLARQFEGRSSEVIKTATKQR
FT                   LDAYYDLELRAAVMNDILDMMPEGIRQNKSKTILQHLSEAWRCWKANIAWNVPGMPEPI
FT                   KNIIERYIKAKADGWVSAAHYNRDRIKRGAHVEKTVVRKNLGRLTRLWIKHEQERQQLI
FT                   EKNGPEITPLVATTIFKTMVDWLEQNNFSPVPFPPLTYKNDTKILVLALENLKNAFASK
FT                   VRLNASEREELALIEEAYDNPHDTLNRIKKYLLTQRVFKPVDLSMKDQLQTISPVYSVD
FT                   PLEKITDAYLDQYLWYEADKRQLFPNWIKPSDTEIPPLLVYKWAQGINNLSEVWDVNNG
FT                   QSTVLLQTKLEGLAEKIDLTLLNRLLRLVMDPNLADYITAKNNVVLNFKDMSHVNKYGL
FT                   IRGLQFSSFVYQFYGLMLDLLILGPQRASELAGPSQAPNNFLQFKSLDVEKRNPIRLYC
FT                   RYFDVVHILFHFEEQDSEALVLDFLSENPDPNFENAVGYNNKKCWPKDARMRLMRPDVN
FT                   LGRAVFWEISNRVPISLVNITWENSFASVYSKSNPNLLFTMCGFEARILPNFRTEEMIS
FT                   FDEGVWDLVDERTKQRTAKTFLRVSDEHVEKFNDTIRGILMASGSTTFTKITARWNTAL
FT                   ISLFTYFREAVVSTESLLDVLVKCETKIQNRVKLGLNSKMPTRFPPAVFYTPKELGGLG
FT                   MLSASHILIPASDLSWSKQTDTGITHFRAGMTHEDEKLIPTIFRYITTWENEFLDSQRV
FT                   WADYVAKRQEALKQNRRLAFEELEGSWDRGIPRISTLFQKDRHTLAYDKGHRARSQFKD
FT                   FSLERNNPFWWTDTHHDGKLWNLNAYRTDVIQALGGIETILEHTLFKGTGFNSWEGLFW
FT                   EKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLWWSPTINRANVYVGFLVQLDLTGIFL
FT                   HGKIPTLKISLIQIFRAHLWQKIHESIVFDVCQVLDGEMDMLQIESVEKEAIHPRKSYK
FT                   MNSSAADVTLSSNHTWNVSSPSLLHNTNDNFNVSNSSKVWIDVQLRYGDYDSHDISRYV
FT                   RAKFLDYTTDNVSMYPSPTGVMIGIDLAYNMYDAYGNWFDGLKTLLQNGMKTIMKANPS
FT                   LYVLRERIRKGLQIYQSQTQEPFLNSSNYAELFSDETKLFIDDTNVYRVAVHTTYEGNI
FT                   ATKPINGCIFTLNPKTGELFLKIIHTSVWAGQKRLSQLAKWKTAEETSALIRSLPKEEQ
FT                   PKQVIVTRKAMLDPLEVHMLDFPNISIRPTELKLPFSASMAIEKLSDVVTKATEPQMVL
FT                   FNIYDDWLERVSSYTAFSRLILLLRALRTNEERAKMILKADPTIPIKEHHLWPSFSDDQ
FT                   WIEIESQMRDLILVEYGKKYNVNIASLTQTEIKDLILGQNIKAPSVKRQQMAELEMSKT
FT                   TQNSNGLDSSSGSAMKIKSTNAQGEEIMVVTSTNFETQTFSTKNEWRKRAIANSLLYMR
FT                   LKTIYLASDDFVEEKDVFILPKNLLKRFVEISDTKAQVAGYIFGKKAAGHEKVKEIRTI
FT                   VIVPQLGNTHTVQLSMLPEYSPYLQDLELLGWTHTQSQELKYMSAPEVTTHSNIFKGEK
FT                   DLVSLSVCLNPGSISLAAYTVSEEGYSWGSSNKNLFDAEPQGFDPEFSEHAQLMLSDRV
FT                   TGNFLVPSNDVWNYAFMSAVFSPSAKYELKLDIPIEFYNELHRSIHFLQFSDMVENEEL
FT                   EPEKEDVFA"
FT   gene            complement(<81177..>81479)
FT                   /locus_tag="KLTH0H00748g"
FT                   /old_locus_tag="KLTH-ORF2222"
FT   CDS_pept        complement(81177..81479)
FT                   /locus_tag="KLTH0H00748g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2222"
FT                   /product="KLTH0H00748p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Y9"
FT                   /protein_id="CAR30050.1"
FT                   /translation="MPYSFNIFVGYGFPFNLRTLVAVSSQRSYRTFIPDDILQGMTRCK
FT                   ALGGLSATPDPKSLEKKWVDRLEASRLNCAQVVPRRGVALELDIALQKVLQYLSA"
FT   gene            <81755..>86374
FT                   /locus_tag="KLTH0H00770g"
FT                   /old_locus_tag="KLTH-ORF2221"
FT   CDS_pept        81755..86374
FT                   /locus_tag="KLTH0H00770g"
FT                   /gene_family="HOG000112234" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2221"
FT                   /product="KLTH0H00770p"
FT                   /note="similar to uniprot|P38859 Saccharomyces cerevisiae
FT                   YHR164C DNA2 Essential tripartite DNA replication factor
FT                   with single-stranded DNA-dependent ATPase ATP-dependent
FT                   nuclease and helicase activities required for Okazaki
FT                   fragment processing involved in DNA repair pathways
FT                   potential Cdc28p substrate"
FT                   /db_xref="GOA:C5E1Z0"
FT                   /db_xref="InterPro:IPR014808"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z0"
FT                   /protein_id="CAR30051.1"
FT                   /translation="MRSNETKKHGLSPLASPDRSKQEEHEHHPSRSSAVTRASRKKAVQ
FT                   SKKKYKFAPVDTLTRGASSEPPVLQSLSLSQVRKSKVANAPRVDHDPNLVPKPPTTLKA
FT                   VSKPSKASTSAVGVPKVLEDAPPEEVIWQYSPFKNPRADFSDRDRGYKSTSEDSAIEHV
FT                   VKESSTPIVPNKFKRVLNFPHMHDGQEMLPDAAVMASKKSSLRTNSVPKSFSLQPPSRA
FT                   STRDIDEIINDIEDGFEIKPPFQGKDIPSSPTKMVSQRLRERQGGIQEDSLLTNDSLFA
FT                   HGGTKRVEVDDKLRCSSEDHCSKENKERTDNAESTGDENEEDDEDDESLIELLTQKFVS
FT                   NPSNERGPTNHENEGANSQQSNLLSSDGTQDDSLLEYFQSSETGQHKADPSCAPEKVNF
FT                   ESTIESVEARFSQNVVVQENLNESEKWQSYVEKALCATSREGMERWVVIESKEFLVSNK
FT                   GLQKVLKCLDHKGSVSNLVVRSPWSRLTFKEGDVVHTISGSNTTNRRLFSDDRDPETGK
FT                   INDNLLILNPDILISATTVGRAVECERRALLSNQISGPGEPSLPALVGNIVHELVQMCL
FT                   KYKLDHVHILQERMSSFLDGILDNYVADIIMCQSTKDALLQQITAEHIPNIKQFLDAFV
FT                   KRDKSRTFPSARSFANKQEMSISNIIDIEENIWSPMYGLKGFIDATVETTLPNDSTFVA
FT                   PLELKTGKFKSISHEAQGTIYNLLLSDRYELPVNFFLLFYTKTNDFTKHDTLLHSLKHL
FT                   IVLRNHISEYLRHELSEVTENKWQGTTLPSILGSAACDNCYSKTECMVINNLCEDGSPK
FT                   ESGLKKGEYEALTGHLTSNRLNYKEFYMRYEDLIVKEESSLKGINNEIFLIDSKTRESL
FT                   SGKCVSNLVIVASEDDSESKLIRYTFCRKEGAAESLPSLINSQLSKNDMVIISDEAGHF
FT                   ALCTGRVVSISTMEITISTSRRLQSNNVRAPGFEKGRKQVLETVLMPSKSAKLGQKSIT
FT                   YRIDRNEVQQGLALARFNLLNLFLPSVPEGAVTTDPSTGQEIAFKRSWGGDQKTREIVV
FT                   DGRTPRFVAPSEPPRVPYDEGLKSRFNEDQWKAFEKVMRLDDYALILGMPGTGKTTLIV
FT                   EIVKSLVARGKTILLTSYTHSAIDNILIKLKNCDIDICRLGHKHRVHQEAWEFVPDFTE
FT                   ASTFEKFKEQVEKPSVVATTCLNIHDTLLSLRSKDFDYVILDEASQLSLPICVGPLKFA
FT                   ERFVLVGDHYQLPPLVKNDAARVGGLDLSLFKMLCEKHPDSVVELTHQYRMCEDIMTLS
FT                   NYLIYDGKLKCVSEEVRDQKLEIPHMAELDTMHVPGKHGQWLDIVLNSEKRVVFLDHDK
FT                   CPAFQEIAEKDNIKNPGEAELVWQCVAAMVRCGVSRRDIGVMTLYRAQLRILRKMFEAE
FT                   EHNELEILTADQFQGRDKRCVIISMVRSNDGLNGGSLLRELRRVNVAMTRAKCKLIIIG
FT                   SKATISSVESLRGFMSLLESRGWLHSLPPDCLESYNIPRPAPSQHSRRKKQGSVVANIT
FT                   AESKFTQDKSVLRDTLNGM"
FT   gene            <88079..>90586
FT                   /locus_tag="KLTH0H00792g"
FT                   /old_locus_tag="KLTH-ORF2215"
FT   CDS_pept        88079..90586
FT                   /locus_tag="KLTH0H00792g"
FT                   /gene_family="HOG000142071" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2215"
FT                   /product="KLTH0H00792p"
FT                   /note="some similarities with uniprot|P53316 Saccharomyces
FT                   cerevisiae YGR250C Hypothetical ORF"
FT                   /db_xref="GOA:C5E1Z1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z1"
FT                   /protein_id="CAR30052.1"
FT                   /translation="MTVAEQTEQVASALADVAITDQGPQEAVGSPTAVGTEQEPAGEQE
FT                   ARGREQTRTHAQEQTPGTGQGSAAESSGTSEEDGARSLERDQSQEEFPSKSNSPNSSAL
FT                   QLDQLANTNLLTVRIKWVDNQLLDYKTTQLVNKLSELSHARKGFVVNPSVIENYEYLSD
FT                   SSRLAVLGENQDVYMHESGTKEFADFHSDESSAGGSWLYDYVLQAQFKHWADLEVVRDS
FT                   VVAALGESTIVSKWSVSDNAHALTHPGNLYVRGIPKDLTIDDLVPVFAKFGPVLSMKII
FT                   CDSNTGDSLGYGFLSYPLGSQASRCIKELNGNLMNGSPLFINYHVERKERERIHWDHIK
FT                   EDNDDERFKGVFIGNLPIEDVQGKLITPEDVIAEFQKRLGDGGETSQIVSYYLPKRNSQ
FT                   SDIEYKDDDDKTDDIETCVSKHEESPLKGYGFIKFASHTQALGAIEKFNDMEWLGNKLI
FT                   VNKAVQSKPQSHYHHHHHHHHHQNHNEYRGRRHSERSPSSRQKSMTNISFYAPFSGSQA
FT                   GFGFYGNPPNARYPAPSDLGPHDIAADSSPNSSPSPHQGYIPPPQLSHRYGAPPSLSST
FT                   PESSTAPSSRNDSFFQMHSQGGMMPPSPFMLPIPTKDQQESNLYVKHLPLSWRDEDFFQ
FT                   FYENFGEIISAKIITVGGSKNDGSSDNTFAKQSEPALGSSKGYGFVCFKNPLDASRAML
FT                   ITDRYQVDENHTLYVSFAQKRAKSISNGDTVMVSTNNSRPSSRKNYYYNNARQDFLGKY
FT                   NPKFLNAMFNQQNGGRSYPRPRGSWPAPMPMPVAPPHMVPMMPPVVLPSPISPEAIVPG
FT                   GDIEQDSIAEAPVQIKQGSTTKS"
FT   gene            complement(<90962..>92134)
FT                   /locus_tag="KLTH0H00814g"
FT                   /old_locus_tag="KLTH-ORF2209"
FT   CDS_pept        complement(90962..92134)
FT                   /locus_tag="KLTH0H00814g"
FT                   /gene_family="HOG000142070" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2209"
FT                   /product="KLTH0H00814p"
FT                   /note="some similarities with uniprot|P53050 Saccharomyces
FT                   cerevisiae YGR249W MGA1 Protein similar to heat shock
FT                   transcription factor; multicopy suppressor of pseudohyphal
FT                   growth defects of ammonium permease mutants"
FT                   /db_xref="GOA:C5E1Z2"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z2"
FT                   /protein_id="CAR30053.1"
FT                   /translation="MQNKTFIHQLHAILQQPELERWIRWEPDEQLRGVFSLRPHDAAFS
FT                   TNVLKRYFKHGNVSSFVRQLHMYGFHKLAAPTAPTSTEPASPATSPAASAGSSVAGGGT
FT                   SSADGSAGAAATTAGTKSGKSAVVWQFSHPSGAFCRDSTMSELGRIQRKSGGVGKNGKR
FT                   KNVLSAVCVNYVDTTAAASIVSRPSSAMSGSDEAPQMTPLPSLRPLTTPAPPESARSPS
FT                   SPDLLSQKGSSGSSNSVPQLSALYPGSTPVPAGPQNLTLQHLQHNINLIQRGMVTILDV
FT                   LQQFPPQSSTEAETISATLQALRNDIISADTKWTHLRYPIVSAHSSFSSVGSSFSNAPP
FT                   GSGSRFPSLSTQKSSVFSNTRFSNASIPRSSSSGQSTTDNWGLAPPHKKK"
FT   gene            complement(<92994..>94133)
FT                   /locus_tag="KLTH0H00836g"
FT                   /old_locus_tag="KLTH-ORF2195"
FT   CDS_pept        complement(92994..94133)
FT                   /locus_tag="KLTH0H00836g"
FT                   /gene_family="HOG000256285" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2195"
FT                   /product="KLTH0H00836p"
FT                   /note="similar to uniprot|P38858 Saccharomyces cerevisiae
FT                   YHR163W SOL3 Glucose-6-phosphate dehydrogenase weak
FT                   multicopy suppressor of los1-1 mutation homologous to Sol2p
FT                   and Sol1p"
FT                   /db_xref="GOA:C5E1Z3"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z3"
FT                   /protein_id="CAR30054.1"
FT                   /translation="MCACAWERKKRRGAGAGAGRASLRTGRDITLDGMPCTHVTCAMPN
FT                   GCAPARDVYHTVRGVSLHTDSQDPQRHLARALPSPPTNATRAIYRRPALPYIKTRRPRA
FT                   AGLHAPTALHAHFLPPPVPMVPVYTYDDSAALSRDLALYILAQQDAALQRGDRFNLAVS
FT                   GGSLLKALRAGLVEDAELRARANWARWHVFFCDERIVPLEHADSNYGAFKAQVLDPLLQ
FT                   HDGVLGPTCYAINESLVGLGENDRLAAEYESLLPAQFDLILLGCGPDGHTCSLFPGDTH
FT                   SYLLDANTDRRVAWCHSSPKPPADRITFTLPTLASAHALCFVAEGAAKQPVLQRILQSS
FT                   PDTSLPAALVTDRFAQRVSWFVDSAAVQDLSVPAVTYNH"
FT   gene            <94956..>95480
FT                   /locus_tag="KLTH0H00858g"
FT                   /old_locus_tag="Klth0H.mRNA.254.p"
FT   CDS_pept        join(94956..95027,95139..95480)
FT                   /locus_tag="KLTH0H00858g"
FT                   /gene_family="HOG000188910" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.254.p"
FT                   /product="KLTH0H00858p"
FT                   /note="similar to uniprot|P53311 Saccharomyces cerevisiae
FT                   YGR243W FMP43"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z4"
FT                   /protein_id="CAR30055.1"
FT                   /translation="MSAAGAAFRRFLNSETGPKTVHFWAPTLKWALVFAGISDVSRPVD
FT                   KLSGVQNLSLLATGVIWTRWSFVIKPKNMLLASVNFFLACTAGYQLTRICNYRRAQGDT
FT                   PGQVANYVINGPPPTHLPSERQHALTRQPSPAT"
FT   gene            complement(<95812..>97068)
FT                   /locus_tag="KLTH0H00880g"
FT                   /old_locus_tag="KLTH-ORF2181"
FT   CDS_pept        complement(95812..97068)
FT                   /locus_tag="KLTH0H00880g"
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2181"
FT                   /product="KLTH0H00880p"
FT                   /note="highly similar to uniprot|P53312 Saccharomyces
FT                   cerevisiae YGR244C LSC2 Beta subunit of succinyl-CoA ligase
FT                   which is a mitochondrial enzyme of the TCA cycle that
FT                   catalyzes the nucleotide-dependent conversion of
FT                   succinyl-CoA to succinate"
FT                   /db_xref="GOA:C5E1Z5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z5"
FT                   /protein_id="CAR30056.1"
FT                   /translation="MLSRTIAANQLKNSLRASKQIRNLSIHEYRSAELLRQYGVGTPAG
FT                   EAAFEPQQAYDIAKKLGHDALVVKAQALTGGRGKGHFDTGLKSGVHMIESAEQARDLAK
FT                   QMLKHRLITKQSGAKGKPVSAVYVVERVNAKHEAYLSILMDRQSKKAMIICSSEGGMNI
FT                   EEVAAKNPDAIKKFTVTESEGLTAETAKQISKSLGFSAEAEADAADAVTKLYKIFKEKD
FT                   ASQIEINPLSEVEGQDTKVMCMDAKFGFDDNASFRQEEVYSWRDLSQEDADEVVAKKSD
FT                   LNFVKLQGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIETAFKLILSN
FT                   EKVDGIFVNIFGGIVRCDFVAQGLVSATKNLAVSVPIVARLQGTNLEEGRRIIEESGLK
FT                   IYSFDELDPAAQKVVELTR"
FT   gene            complement(<97752..>99944)
FT                   /locus_tag="KLTH0H00902g"
FT                   /old_locus_tag="KLTH-ORF2175"
FT   CDS_pept        complement(97752..99944)
FT                   /locus_tag="KLTH0H00902g"
FT                   /gene_family="HOG000204601" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2175"
FT                   /product="KLTH0H00902p"
FT                   /note="similar to uniprot|P53313 Saccharomyces cerevisiae
FT                   YGR245C SDA1 Severe Depolymerization of Actin"
FT                   /db_xref="GOA:C5E1Z6"
FT                   /db_xref="InterPro:IPR007949"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012977"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z6"
FT                   /protein_id="CAR30057.1"
FT                   /translation="MVRKSRAAILPTNVILLQNLVKRDPQSYREEFLQQYSHYESLRDI
FT                   FMLNAMENQVADDSNTSQFVELVGFVSQVCSCFPEETANFPNELRQLVLEYHKSLPFEV
FT                   REKIITSLTMLRNKGVISAETLIQTMFPLLIAYSSHSNALGPNSHAKEVRKLVYSTLIS
FT                   LLKNCNTGSKNQKLNKSTQAICFNLLEQPDSQGVWASRLTRELWRRGIWDDSRAVEIMT
FT                   QAALHDDVKIAYSGVLFFLGADREREENFEDNSDDEDIDVDALKHKMQINKKSGKRGKK
FT                   LEAAVKSVKKKKAGAKTPQGFLNFSAIHLLRDPQGFADKLFTKQLSSKNNNRFDIDQKI
FT                   ALMQLLSRLIGTHKLMVLGIYSFFLKYLTPKQRDVTKIMASAAQACHDLVPPETISVMV
FT                   RKIADEFVSDGVASEVAAAGLNTIREICSRAPLAIDETLLQDLTEYKGSKAKGVSIAAK
FT                   SLVSLYREVAPEMLRRKDRGKVASMEMQDASRKGKESRRPKFGEESHVQGIAGIELLAQ
FT                   WKKDNEKVDDEEGDDKNWEVAEDSDSDADDDDGEWVTMESDKEYDVDMGDSDDEDAKAA
FT                   KKAEAAEEDEPAAPAEKIDAETAFRDLASTRVLTPADFAKLQELRTEQGVARLMGVRNE
FT                   ETVDSDRLVGPVKHKNTKEERLQSVLEGREGREKFGSRKKSRGTEHSTTNREKQRKKNF
FT                   VMMIHKRSVKGKQKMSLRDRQKVLRQHITKQKKRGF"
FT   gene            complement(<100199..>101914)
FT                   /locus_tag="KLTH0H00924g"
FT                   /old_locus_tag="KLTH-ORF2171"
FT   CDS_pept        complement(100199..101914)
FT                   /locus_tag="KLTH0H00924g"
FT                   /gene_family="HOG000198688" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2171"
FT                   /product="KLTH0H00924p"
FT                   /note="similar to uniprot|P29056 Saccharomyces cerevisiae
FT                   YGR246C BRF1 TFIIIB B-related factor one of three subunits
FT                   of RNA polymerase III transcription initiation factor
FT                   TFIIIB binds TFIIIC and TBP and recruits RNA pol III to
FT                   promoters amino-terminal half is homologous to TFIIB"
FT                   /db_xref="GOA:C5E1Z7"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR011665"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z7"
FT                   /protein_id="CAR30058.1"
FT                   /translation="MAKCKVCGGVDFERDISNANNDLVCKDCGTVSEDNPIVSEVTFGE
FT                   SSSGAAVVHGSYVGAGQSHAAFGPRGGSSALESRQATINNARRKLRAVSHALGIPEYVT
FT                   DAATQWYTLALSNNFVQGRRSQNVIAACLYIACRKEKTHHMLIDFSSRLQVSVYSIGAT
FT                   FLKMVKALHITKLPLADPSLFIQHFAEKLDLGDKKIKVVKDAVKLAQRMARDWMYEGRR
FT                   PAGIAGACLLLACRMNNLRRTHSEIVAVSHVAEETLQQRLNEFKSTKSGKLSINEFRDD
FT                   AAVESEAQPPSFQRNRAKEKRLRQKIVENEFETSDEALTRNPILSQVLGAQELSSREVL
FT                   YYLKQFSQRREKNTQRENISSSTNGLRTHGEATGHSEDAAVSSDSEAGTEHRPDADVDP
FT                   NSRSHFQDAIDGYSVETDPHRPRNLHLLPTTSALLSKVADDPEDLQDVDDEELDSQLLD
FT                   EEASKLKERIWIGINGDFLLEQESKRLKQEADMASGNASVKKRGGPRRKRKAASDADGV
FT                   LADIKDDSGLHAALKLAEDTGDFTTADNVKNMIQKSSFSKKINYNAIDGLFGSS"
FT   gene            <102427..>103074
FT                   /locus_tag="KLTH0H00946g"
FT                   /old_locus_tag="KLTH-ORF2167"
FT   CDS_pept        102427..103074
FT                   /locus_tag="KLTH0H00946g"
FT                   /gene_family="HOG000111920" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2167"
FT                   /product="KLTH0H00946p"
FT                   /note="similar to uniprot|P53314 Saccharomyces cerevisiae
FT                   YGR247W CPD1 Cyclic nucleotide phosphodiesterase hydrolyzes
FT                   ADP-ribose 1'' 2''-cyclic phosphate to ADP- ribose
FT                   1''-phosphate no detectable phenotype is conferred by null
FT                   mutation or by overexpression"
FT                   /db_xref="GOA:C5E1Z8"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR012386"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z8"
FT                   /protein_id="CAR30059.1"
FT                   /translation="MGIALWFVPHSNSPVYDTIQSLILSLQTLFPDAPVFEPHLTVTSQ
FT                   LKCENLTGVNQILTSCVAAVGAIRESVRGKDGAIVSFSGVSVGKGYFTKVRLTCIENRY
FT                   LMGIAQVIRELFVAEKPEEAAEWLTEEFRPHVSLVYSDMYHVNQALERVIAQRIEDALD
FT                   LQLHKVRVAGDHNQCTWHFDSPMTGWGVPGVFKVVRCEGPVDEWEVLGSVEV"
FT   gene            <103482..>105353
FT                   /locus_tag="KLTH0H00968g"
FT                   /old_locus_tag="KLTH-ORF2165"
FT   CDS_pept        103482..105353
FT                   /locus_tag="KLTH0H00968g"
FT                   /gene_family="HOG000141818" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2165"
FT                   /product="KLTH0H00968p"
FT                   /note="similar to uniprot|P26370 Saccharomyces cerevisiae
FT                   YDL170W UGA3 Transcriptional activator necessary for gamma-
FT                   aminobutyrate (GABA)-dependent induction of GABA genes
FT                   (such as UGA1 UGA2 UGA4) zinc- finger transcription factor
FT                   of the Zn(2)-Cys(6) binuclear cluster domain type localized
FT                   to the nucleus"
FT                   /db_xref="GOA:C5E1Z9"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5E1Z9"
FT                   /protein_id="CAR30060.1"
FT                   /translation="MAEAPQPRNNAISVTACAKRTHRKTGCVPCKIRKKRCSEHKPVCT
FT                   DCQRLGFYCVYLPEKCPKEKVQYYREKVEKQLLEKKTTLDRRKASGVVQAEAQSSSINE
FT                   VVPEESGGTSVSNDEKEGQHVVSNDGLDESQRLLDVTNVAELLGADGGSDSLIPGLLSL
FT                   SGSPLSPRTLASTPAPSLSDPVLAELDDTALHLYQYYRDRLALIVSIAPSQQNHYRKIF
FT                   LPMAHQNEGVMYGLLAWAARHLSLTVDENDTALDGSAAPSSLVAGPLTDPRYTELANKY
FT                   TLFSLQRLSYRNSGFLMSLAQILVLCGAEICQGDVTRWQTLLQCATSMIKEHAPDGDIG
FT                   ALLAKSELASSLADTQTTRWLLSNFVYHDIMGSDQTHFPMSQYARVLQNPMNPLESPVD
FT                   PLHGVNRPVFQILGQVKNLARQVKQELRQELQRSGDLDEKDETRDPRDSASPTAAPAPS
FT                   RETMAIAQELQGALYRISPSESDLAWYDNFAEIGSDIRPLAETLFSVFRTAALILLKTA
FT                   VLRQTTDSYEIRFLVSQLSDELDCVLGSQLEGGLCFPLFICGINAHDRAQRISVEIKFA
FT                   DFIKRYKFRNVERALVVMRQLWESADNGVTQDWFDIVDSVGWDLNFA"
FT   gene            complement(<105471..>105998)
FT                   /locus_tag="KLTH0H00990g"
FT                   /old_locus_tag="KLTH-ORF2161"
FT   CDS_pept        complement(105471..105998)
FT                   /locus_tag="KLTH0H00990g"
FT                   /gene_family="HOG000185150" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2161"
FT                   /product="KLTH0H00990p"
FT                   /note="similar to uniprot|Q05776 Saccharomyces cerevisiae
FT                   YLR193C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniProtKB/TrEMBL:C5E200"
FT                   /protein_id="CAR30061.1"
FT                   /translation="MVLWYQNSHTFNNDFRTVSLAFFNRYPNPYASHVLSIDTLSRELS
FT                   PAGDLCTTRLIKKTGKLPQWVKPFLGRISESWIIEMSEVDVRNQVLRTYTRNLDHTRII
FT                   QVEEFTTYNFDKKSGKTQASSTVKFSSGFNVGIRSRIEQWSHSKFDENVKRSRMGMAFV
FT                   MERLEQHRQAWS"
FT   gene            complement(<106313..>106945)
FT                   /locus_tag="KLTH0H01012g"
FT                   /old_locus_tag="KLTH-ORF2160"
FT   CDS_pept        complement(106313..106945)
FT                   /locus_tag="KLTH0H01012g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2160"
FT                   /product="KLTH0H01012p"
FT                   /note="no similarity"
FT                   /db_xref="UniProtKB/TrEMBL:C5E201"
FT                   /protein_id="CAR30062.1"
FT                   /translation="MQLLKFLAIIASAGAAFGSSGALGGMGSNQDSESKESSKSLVQTA
FT                   NVVSTPQEQTSKTAAASQTLQSTTAGSVESQFASEITSPSATASISNNGGPVTVLTSGS
FT                   VTSTVWWTPSVTKWWTPASELTASSDSSSPSSDASSDTVSTSRIVETITSGSHVTTITT
FT                   DVLTSVKKSSTKSSSTASISNSTNAAAPLSIDVLLSIGALALGAIAA"
FT   gene            complement(<107338..>108687)
FT                   /locus_tag="KLTH0H01034g"
FT                   /old_locus_tag="KLTH-ORF2159"
FT   CDS_pept        complement(107338..108687)
FT                   /locus_tag="KLTH0H01034g"
FT                   /gene_family="HOG000189123" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2159"
FT                   /product="KLTH0H01034p"
FT                   /note="similar to uniprot|P14743 Saccharomyces cerevisiae
FT                   YLR195C NMT1 N-myristoyl transferase catalyzes the
FT                   cotranslational covalent attachment of myristic acid to the
FT                   N-terminal glycine residue of several proteins involved in
FT                   cellular growth and signal transduction"
FT                   /db_xref="GOA:C5E202"
FT                   /db_xref="InterPro:IPR000903"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022676"
FT                   /db_xref="InterPro:IPR022677"
FT                   /db_xref="InterPro:IPR022678"
FT                   /db_xref="UniProtKB/TrEMBL:C5E202"
FT                   /protein_id="CAR30063.1"
FT                   /translation="MAQDPDQAKKLQELLKMLSLSQNDASKLTQPQRKQFEEYKFWKTQ
FT                   PVPRFDDEVEDEGPINSSQRPENIPNEPLPLLSEFEWCTVDITDPHQLEDVFVLLNENY
FT                   VEDQDATFRFNYSREFFNWSLKPPGWRKDWHVGVRTRQSKRLVAFISAVPATLRVRTKL
FT                   VKSVEINFLCIHKKLRSKRLTPILIKEVTRRVNKQDIWQALYTAGVVLPSPAATCRYAH
FT                   RPLNWSKLYEVGFTGLPANASKTQMIAKYTLPKEIDTPGLRPLEEKDLDEVYDLLEKYQ
FT                   SRFDLVQVFTKEEFRHLLLSSTSVVYSYVVESNNKITDFVSFYSLPFTVLNNPHYKELG
FT                   IGYLFYYASDADFDYSDRYDSEGSLKLKKRLNRLISDVCIKARDLKMDVFNAMSCQDNS
FT                   LFLDDLKFGPGDGFLNFYLFNYRVRPILGGLRKDNSFDAEKRSNVGVVML"
FT   repeat_region   complement(108814..110229)
FT                   /locus_tag="KLTH0H01056t"
FT                   /old_locus_tag="dnatranposon.3"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   LTR             complement(110755..111173)
FT                   /locus_tag="KLTH0H01100t"
FT                   /old_locus_tag="Klth0H.LTR.1"
FT   gene            <113798..>115537
FT                   /locus_tag="KLTH0H01122g"
FT                   /old_locus_tag="KLTH-ORF2153"
FT   CDS_pept        113798..115537
FT                   /locus_tag="KLTH0H01122g"
FT                   /gene_family="HOG000212580" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2153"
FT                   /product="KLTH0H01122p"
FT                   /note="similar to uniprot|P21304 Saccharomyces cerevisiae
FT                   YLR196W PWP1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C5E203"
FT                   /protein_id="CAR30064.1"
FT                   /translation="MISSTTWVPRGFPSEFPEKYELDDEEMERINQLAQLNLDDAKDGI
FT                   ESEHDDSELGGEEKNSNEASVRGSAKLASQADNDDNLEEYDMEHYGVKEDEMLGEGAEA
FT                   SMFPGLSDEVKFHEGEDGEDAILSLPTQQDSQEEKQELQVYPTDNMVLATRTEDDVSYL
FT                   DVYVYDDGAGFHDAEVNQEPGDDKDPDVARGLVRDSSLYVHHDLMLPAFPLCVEWVNYK
FT                   PGSSSDDAANFAAVGSFDPQIEIWNLDCVEKAFPDMILGDPHATSNVGGSKSKKNKKNK
FT                   KNKNKHVLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEGIAARSVASIHSNKN
FT                   VSSSQWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQFADENTF
FT                   MCGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISALNVNPFIPNLLATGAMGEKTVKFW
FT                   KISESGPSMVLSRDFGVGNVLTTSFAPDIEVAGNIVIGGVDKGLKLWDVFTNRSIRKNL
FT                   SKELSSLQRQARAEASKIGRASRIARKYTKNDNPDTVVTVDDQGEDEEEGDGQRESGWE
FT                   DTE"
FT   gene            complement(<115683..>116168)
FT                   /locus_tag="KLTH0H01144g"
FT                   /old_locus_tag="KLTH-ORF2151"
FT   CDS_pept        complement(115683..116168)
FT                   /locus_tag="KLTH0H01144g"
FT                   /gene_family="HOG000141819" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2151"
FT                   /product="KLTH0H01144p"
FT                   /note="weakly similar to uniprot|P32772 Saccharomyces
FT                   cerevisiae YDL169C UGX2 Protein of unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:C5E204"
FT                   /protein_id="CAR30065.1"
FT                   /translation="MLLSSVMVNSEIPIVYATPFVVSSPNTVQFVIATSQSQGFAWNQD
FT                   IFASQYQQMCKVAFDGHEDHADTVLKRVRSLVQGDGAASFNDSVFDEEDQDMDGKDQYL
FT                   SRRVSQELTRPRRRSERTISFTSDSKNGSYQRTESVIIDVGADTEENRYYRSLLSNS"
FT   gene            <116579..>118102
FT                   /locus_tag="KLTH0H01166g"
FT                   /old_locus_tag="KLTH-ORF2149"
FT   CDS_pept        116579..118102
FT                   /locus_tag="KLTH0H01166g"
FT                   /gene_family="HOG000196309" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2149"
FT                   /product="KLTH0H01166p"
FT                   /note="highly similar to uniprot|Q12460 Saccharomyces
FT                   cerevisiae YLR197W SIK1 Component of the small (ribosomal)
FT                   subunit (SSU) processosome that contains U3 snoRNA"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012974"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="UniProtKB/TrEMBL:C5E205"
FT                   /protein_id="CAR30066.1"
FT                   /translation="MAPIEYLLFEEPTGYGIFKVKLQQDDIGSRLKEVQAQINDFGSFT
FT                   KLVELVSFAPFKGAAQALENANDISEGLVSEYLKAVLDMNLPKGSNKKTVTLAISDKNL
FT                   GPSIKEVFPYIDCMSNELAQDLIRGVRLHGDKLLKDLQQGDLERAQLGLGHAYSRAKVK
FT                   FSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYKFAKLVLFI
FT                   KDKASLTEDSLHDLTAILDDDAGIAERVIDNARISMGQDLSETDMENVCVFAERVTSLA
FT                   DYRRQLYDYLCSKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKA
FT                   LFRALKTKGNTPKYGLIYHSGFIGKASAKNKGRISRYLANKCSIASRIDNYSDEPSNVF
FT                   GTVLKKQVEQRLEFYSTGAPTLKNELAIQEAIELYNKDKPEEPVKESKKRKLEANEDED
FT                   SEEDQKPAKKDKKDKKDKKDKKEKKEKKDKKDKKEKKEKKEKKEKKKKD"
FT   gene            complement(<118222..>119093)
FT                   /locus_tag="KLTH0H01188g"
FT                   /old_locus_tag="KLTH.mRNA.268AT.m"
FT   CDS_pept        complement(join(118222..119019,119088..119093))
FT                   /locus_tag="KLTH0H01188g"
FT                   /gene_family="HOG000115598" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.268AT.m"
FT                   /product="KLTH0H01188p"
FT                   /note="similar to uniprot|Q05778 Saccharomyces cerevisiae
FT                   YLR199C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR018855"
FT                   /db_xref="UniProtKB/TrEMBL:C5E206"
FT                   /protein_id="CAR30067.1"
FT                   /translation="MLFKQWNEYSEPRHHLDAPLEENTDLDSLQPAPLPEVMLEKPIDT
FT                   AGFKRAFIVTNIFRSLFEDRLARAEQISSFVVVWQTKGREQHLYREDYQTQEDSRSTDE
FT                   TKRLEFPVHKLDDGTLFICVREDFLHVPPISINLLSREIAKLCGGLEVLLFGSSDRVER
FT                   VKYVGFPGNVGKGLPLLTPPELITNFTASIMTQLLSNKVRFDGYVAPSEGPSGYEKLSM
FT                   ETMDLLIDLCWSEVRFGNREDYVKSCHRNWRLNGTVMGAQTGLYL"
FT   gene            <119243..>119584
FT                   /locus_tag="KLTH0H01210g"
FT                   /old_locus_tag="KLTH-ORF2145"
FT   CDS_pept        119243..119584
FT                   /locus_tag="KLTH0H01210g"
FT                   /gene_family="HOG000196242" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2145"
FT                   /product="KLTH0H01210p"
FT                   /note="similar to uniprot|P52553 Saccharomyces cerevisiae
FT                   YLR200W YKE2 Yeast nuclear gene"
FT                   /db_xref="GOA:C5E207"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniProtKB/TrEMBL:C5E207"
FT                   /protein_id="CAR30068.1"
FT                   /translation="MSSSAQDLTMNYNTSQHELEELVIARQKLETQLQENKIVQDEFDG
FT                   LREETQVYKLTGNVLLPVEQFEAKSNVSKRLEFITAEINRCEENIKTKQGLLEKLRAEL
FT                   LQTQQARQQ"
FT   gene            complement(<119673..>120446)
FT                   /locus_tag="KLTH0H01232g"
FT                   /old_locus_tag="KLTH-ORF2144"
FT   CDS_pept        complement(119673..120446)
FT                   /locus_tag="KLTH0H01232g"
FT                   /gene_family="HOG000246701" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2144"
FT                   /product="KLTH0H01232p"
FT                   /note="similar to uniprot|Q05779 Saccharomyces cerevisiae
FT                   YLR201C FMP53"
FT                   /db_xref="GOA:C5E208"
FT                   /db_xref="InterPro:IPR012762"
FT                   /db_xref="InterPro:IPR013718"
FT                   /db_xref="UniProtKB/TrEMBL:C5E208"
FT                   /protein_id="CAR30069.1"
FT                   /translation="MLALSRILARRLYHPSALEHQLAHSFAPLTYGPGSTQFKVLEHAL
FT                   NKHVPSYGFNERALVASLNDLDLGPSLLSVIGASNSPSFLNASPAVLELIKFHLVTKRY
FT                   ALTKELDPARTSSPAEPPALETLFHRRLELNKPIAPHLTQLLSSLSIPGEFLVQTALPE
FT                   LHRLSDDMVYFSKEPDANDFAWYSKRIALSCAFVSSELFMAQDRSANYADTFEFAAEKL
FT                   HNVSKLGQYYNNTEEYMWYTLLMSVNLAKSQLTRS"
FT   gene            <121076..>122221
FT                   /locus_tag="KLTH0H01254g"
FT                   /old_locus_tag="KLTH-ORF2140"
FT   CDS_pept        121076..122221
FT                   /locus_tag="KLTH0H01254g"
FT                   /gene_family="HOG000294674" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2140"
FT                   /product="KLTH0H01254p"
FT                   /note="highly similar to uniprot|P32771 Saccharomyces
FT                   cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
FT                   (glutathione-dependent formaldehyde dehydrogenase)"
FT                   /db_xref="GOA:C5E209"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniProtKB/TrEMBL:C5E209"
FT                   /protein_id="CAR30070.1"
FT                   /translation="MSEGKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAV
FT                   CHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFC
FT                   KSGKTNLCGSVRATQGKGVMPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAID
FT                   PKAPLDKTCLLGCGVTTGYGAAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKII
FT                   VVDINDQKKQWSLDFGATDFVNPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMR
FT                   SALEACHKGWGQSIIIGVAAAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDY
FT                   MDGKLKVDEFITHRRGFTDINSAFEDLHHGDCLRTVLDLSK"
FT   gene            complement(<122337..>124010)
FT                   /locus_tag="KLTH0H01276g"
FT                   /old_locus_tag="KLTH-ORF2139"
FT   CDS_pept        complement(122337..124010)
FT                   /locus_tag="KLTH0H01276g"
FT                   /gene_family="HOG000161181" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2139"
FT                   /product="KLTH0H01276p"
FT                   /note="some similarities with uniprot|P32770 Saccharomyces
FT                   cerevisiae YDL167C NRP1"
FT                   /db_xref="GOA:C5E210"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniProtKB/TrEMBL:C5E210"
FT                   /protein_id="CAR30071.1"
FT                   /translation="MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENKH
FT                   VELGNGCTLQDAVAQLEKDISEHAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQ
FT                   HPKVFDLWKEYDRWCMNHPETSAMRQNPLGKRTKDLAEMRSVLGLDGTEEGAHPDANQN
FT                   GGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVT
FT                   ADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWT
FT                   VKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANT
FT                   KQPRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCF
FT                   RCSFPAASGAGMNNNGYMKNPLQPHNAQAGSQQQAAYKMRTPAGLQAMQVQSGPHMGQP
FT                   QQQQQQQQRMRYNQGQRFGQGQQHQGGSNVPFRAGDWKCATCTYHNFAKNVVCLRCGGP
FT                   KSTEHQQKELGTVNSYTDIQDIGNGMGISLNTRSFSEPAW"
FT   gene            complement(<124206..>124850)
FT                   /locus_tag="KLTH0H01298g"
FT                   /old_locus_tag="KLTH-ORF2137"
FT   CDS_pept        complement(124206..124850)
FT                   /locus_tag="KLTH0H01298g"
FT                   /gene_family="HOG000224472" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2137"
FT                   /product="KLTH0H01298p"
FT                   /note="similar to uniprot|Q12055 Saccharomyces cerevisiae
FT                   YDL166C FAP7 Essential nuclear protein involved in the
FT                   oxidative stress response"
FT                   /db_xref="UniProtKB/TrEMBL:C5E211"
FT                   /protein_id="CAR30072.1"
FT                   /translation="MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQ
FT                   HECYDGYDEARKSHIVDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDN
FT                   TVLYDRLKSRGYHEAKIQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDR
FT                   IASWSAAWLEQNPKGVTNELVERGSDEEDGTDEEGGSYGNSASSGEDGEDA"
FT   gene            <125017..>125589
FT                   /locus_tag="KLTH0H01320g"
FT                   /old_locus_tag="KLTH-ORF2136"
FT   CDS_pept        125017..125589
FT                   /locus_tag="KLTH0H01320g"
FT                   /gene_family="HOG000246523" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2136"
FT                   /product="KLTH0H01320p"
FT                   /note="highly similar to uniprot|P06100 Saccharomyces
FT                   cerevisiae YDL165W CDC36 Component of the CCR4-NOT complex
FT                   which has multiple roles in regulating mRNA levels
FT                   including regulation of transcription and destabilizing
FT                   mRNAs by deadenylation basal transcription factor"
FT                   /db_xref="GOA:C5E212"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="UniProtKB/TrEMBL:C5E212"
FT                   /protein_id="CAR30073.1"
FT                   /translation="MEKYGLSALLPLIRREDQSPDYDSSMTLGIDLSPVLHSLGIPNNQ
FT                   PSRNRVLDTFQSPWVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKIS
FT                   LFQDETLFYLFYKHPGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASE
FT                   RGSYVFFDPQRWEKCQRDFVLFYNAIM"
FT   gene            complement(<125673..>126941)
FT                   /locus_tag="KLTH0H01342g"
FT                   /old_locus_tag="KLTH-ORF2134"
FT   CDS_pept        complement(125673..126941)
FT                   /locus_tag="KLTH0H01342g"
FT                   /gene_family="HOG000186050" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2134"
FT                   /product="KLTH0H01342p"
FT                   /note="similar to uniprot|P32335 Saccharomyces cerevisiae
FT                   YLR203C MSS51 Protein required for the maturation and
FT                   translation of COX1 mRNA involved in maturation of COX1 and
FT                   COB mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C5E213"
FT                   /protein_id="CAR30074.1"
FT                   /translation="MQRCILSRNTVRSCQHNVQKRHIMGFVRNALGLDPPPSPDEPTPE
FT                   NRFHPWDQSPSPDLRERAATIRALAKCPVTGREINYTCPKSGIPTHYSREAWENDLEYQ
FT                   QSKRPEILKKVNIYEHDLRSGRPFPEFDFPLDQDFDRMVNLTNWDLFFYTRGFYSMDTE
FT                   FQLAAVTKMLSYPVTIGSVLHQFSPYSLNPKGPVTLEGLKSLAALRYTLYPEQNRRVTS
FT                   ITKNSPLRIFILGARAEAQLPGHVWKQLQFMFPETNIELHFVGPESYYDRNKREYVHSS
FT                   SPIVRRVDETLSFVYHTDYFHVFHEAQDFFPYDPYTDIFFCFHPGFAAPESRENWMGKT
FT                   MEALLETKCAVFTTGFNELDLRRDVGTVVGKHGKELDMLMEPVHNAFGSTKWELNDMNP
FT                   QEVYQFNMFIAGFRGKRYHAIEV"
FT   gene            <127939..>128232
FT                   /locus_tag="KLTH0H01364g"
FT                   /old_locus_tag="KLTH-ORF2131"
FT   CDS_pept        127939..128232
FT                   /locus_tag="KLTH0H01364g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2131"
FT                   /product="KLTH0H01364p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:C5E214"
FT                   /protein_id="CAR30075.1"
FT                   /translation="MLGAFTRAFSSLVKTRAPAARLSSTLHAFRGFELPLRCMEPLMLL
FT                   RPLAPVERAPTAMEEMLADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK"
FT   gene            complement(<128402..>129325)
FT                   /locus_tag="KLTH0H01386g"
FT                   /old_locus_tag="KLTH-ORF2129"
FT   CDS_pept        complement(128402..129325)
FT                   /locus_tag="KLTH0H01386g"
FT                   /gene_family="HOG000246524" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2129"
FT                   /product="KLTH0H01386p"
FT                   /note="similar to uniprot|P32339 Saccharomyces cerevisiae
FT                   YLR205C HMX1 ER localized, heme-binding peroxidase involved
FT                   in the degradation of heme"
FT                   /db_xref="GOA:C5E215"
FT                   /db_xref="InterPro:IPR002051"
FT                   /db_xref="InterPro:IPR016053"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C5E215"
FT                   /protein_id="CAR30076.1"
FT                   /translation="MTTIPSPTDVGALANRINFHTRDQHNKIDKQMSAKFAFAMKHGFI
FT                   YRQGVLAFFYVFQAIEQELDRLRQEAQTPEEEQTRDILNQFWTEEFRRAPRILQDLELL
FT                   YAKEFPTSASLRTFLEETTLAPELQGFVDYVHASIRSRPTAILAYCHVLYLALFAGGRV
FT                   MRSTIYRSTGLFPKFPNLTTEEVVRRGTNFFTFSDAGVQAENQLRKNYKRGYELATRQG
FT                   LTEEQKLNILDVSNAIFEWNTRVVTEIGEINRQELMGKLSFRLLTFVIEEWQYSDKLTR
FT                   KQKSLVLATGVVLQILMMYWVLRKFF"
FT   gene            complement(<129752..>131923)
FT                   /locus_tag="KLTH0H01408g"
FT                   /old_locus_tag="KLTH-ORF2126"
FT   CDS_pept        complement(129752..131923)
FT                   /locus_tag="KLTH0H01408g"
FT                   /gene_family="HOG000036006" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2126"
FT                   /product="KLTH0H01408p"
FT                   /note="similar to uniprot|P04819 Saccharomyces cerevisiae
FT                   YDL164C CDC9 DNA ligase found in the nucleus and
FT                   mitochondria an essential enzyme that joins Okazaki
FT                   fragments during DNA replication also acts in nucleotide
FT                   excision repair base excision repair and recombination"
FT                   /db_xref="GOA:C5E216"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:C5E216"
FT                   /protein_id="CAR30077.1"
FT                   /translation="MLRLVRAEMSSIKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDP
FT                   IGAGSGSPSSSPPLATGSSDAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATK
FT                   GDPAKLGASAPKDSKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPI
FT                   TYLLINKLGPDYQPGLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARA
FT                   VQPTMFKPKPLTTGEVFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLE
FT                   SKLRIGLAEKSVLVALSKALLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETA
FT                   LEHGIMELDKHCVLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLL
FT                   PDGSMRIYSRNGENMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVL
FT                   STRKRKGVAVEDVKVRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLAS
FT                   EVTTMSLDELQHYLDQAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGD
FT                   SLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSP
FT                   TAIPTPKAFYVHSESAPPDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRF
FT                   IRLRDDKTPEEATSSEQVVEFYESQSHVS"
FT   gene            <132738..>134246
FT                   /locus_tag="KLTH0H01430g"
FT                   /old_locus_tag="KLTH-ORF2120"
FT   CDS_pept        132738..134246
FT                   /locus_tag="KLTH0H01430g"
FT                   /gene_family="HOG000216614" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2120"
FT                   /product="KLTH0H01430p"
FT                   /note="some similarities with uniprot|Q12518 Saccharomyces
FT                   cerevisiae YDL161W ENT1"
FT                   /db_xref="InterPro:IPR001026"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniProtKB/TrEMBL:C5E217"
FT                   /protein_id="CAR30078.1"
FT                   /translation="MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAER
FT                   SWDSVSFFEIMDMLDKRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKT
FT                   LREFTHEDETGVDQGQIVRVKARELTALLQDEERLREERELKGRNRRPRRRKNSDSYDD
FT                   DMQRALEESRMTAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQM
FT                   QQAQQQMFGLQQQQTQQPMYYDVFGNPISAEEYLQYQQQMLEQQQMLEQQQQQQALAQQ
FT                   LAQQQYLAQQQYLAQQQQQQQALAQQQYMQAYAQQQNAQQQLLPLETGSNNPFAKNAQQ
FT                   PSAEDPSKYAAASSPQRTQQLSPQLQPQPEQFQQQQQQIPQQPLKQTRTGNQSVTDKFS
FT                   DLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNMPQGKHNPFLGQQ
FT                   YTGLPSTSVVPSYTGYGFGNQNVQKQTNQNRANGADQGVSLIDL"
FT   gene            complement(<134324..>134584)
FT                   /locus_tag="KLTH0H01452g"
FT                   /old_locus_tag="KLTH-ORF2116"
FT   CDS_pept        complement(134324..134584)
FT                   /locus_tag="KLTH0H01452g"
FT                   /gene_family="HOG000141955" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2116"
FT                   /product="KLTH0H01452p"
FT                   /note="weakly similar to uniprot|Q3E829 Saccharomyces
FT                   cerevisiae YDL160c-a"
FT                   /db_xref="InterPro:IPR018552"
FT                   /db_xref="UniProtKB/TrEMBL:C5E218"
FT                   /protein_id="CAR30079.1"
FT                   /translation="MPNSIPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREA
FT                   LLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGLLLLDM"
FT   gene            complement(<134657..>135802)
FT                   /locus_tag="KLTH0H01474g"
FT                   /old_locus_tag="KLTH-ORF2115"
FT   CDS_pept        complement(134657..135802)
FT                   /locus_tag="KLTH0H01474g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2115"
FT                   /product="KLTH0H01474p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008603"
FT                   /db_xref="UniProtKB/TrEMBL:C5E219"
FT                   /protein_id="CAR30080.1"
FT                   /translation="MIAQWLCSCSTEPNSIYKLNICAKCHRVSCNWCQKPELLIKYCPG
FT                   CFRVAESEGQLRCVHNCLECPRCELILSVSMEKLASGHKRFEMVCNGCSWRYKTPEVST
FT                   LKTLTGCVEELRKKEDPYTQRFNSLREFYGFKRELQYMEEGGEVSESIASKELFDRLNE
FT                   TKLYKMINEECPIEFKDTKDSGDIALPLPLRLRAKFDYRCPSCGEWLTKSHPDPRSSRF
FT                   LLESFAAHMLPSLEIVHRSKVEPSVSDENAMALVFTASDQSDTPVEITILGSATIHIPV
FT                   RQFTLAYDGPVKCESTMETIKRLVTRVPTYQLNSNTNILATEKSRRLTRPETAPHKNNM
FT                   IDQGSGWCILPMYILEPAKTHRIQLTIPIKGVYVTLQAVLH"
FT   gene            <135932..>138172
FT                   /locus_tag="KLTH0H01496g"
FT                   /old_locus_tag="KLTH-ORF2113"
FT   CDS_pept        135932..138172
FT                   /locus_tag="KLTH0H01496g"
FT                   /gene_family="HOG000112949" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2113"
FT                   /product="KLTH0H01496p"
FT                   /note="weakly similar to uniprot|Q05787 Saccharomyces
FT                   cerevisiae YLR207W HRD3 Resident protein of the ER membrane
FT                   that plays a central role in ER-associated protein
FT                   degradation (ERAD) forms HRD complex with Hrd1p and ERAD
FT                   determinants that engages in lumen to cytosol communication
FT                   and coordination of ERAD events"
FT                   /db_xref="GOA:C5E220"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5E220"
FT                   /protein_id="CAR30081.1"
FT                   /translation="MRLQHLWTAAVWCQLVLSTQDPWQEAVALLETLPMKADPMVSSAQ
FT                   ESDPYMEQVGRGIKITLPIDYYEREQESNYKSFFENEASPVQQEAYKKLVRSSDEFNNT
FT                   EATYTLAQMHLVQNFGFPHNKTLAFKYMQRFNELTDFQNASAVFELGVMHITGLFGAIP
FT                   IDVSKGLAFYEQAAKLGDYRARMALAYRYLNGINTPKDLNRSQFLYSLLARELREHFND
FT                   TEWNIFPPYVESYSVRIPDFSGGLLGSGLSVTASSAKRTRSSRPDITSSILTNLQSGKI
FT                   VLRFVGGQGDFLEDDDDDENKIVDYYYTALDNYQGTYTQKRNLEKAFYLLNSTVHEFRP
FT                   FLKFMDPLPKYYYARCLELLGHMYLTGEGIERADVDSSEVCLKDAIGIRDALPQAYLDL
FT                   GIINHYFRNNITEAVKCYTHLRESQSSTGAELFQLDKIYKSGLLPKDGEFASLWIEKES
FT                   SPNVISIGMLPEKFIEHAAIFYGCNRAVYENAVNYESDVFFKGPGGGSLVALNGFRRFV
FT                   HSRENLVAPHLREAFVELLLGNTEAALWLYAQAAEQGFETAQTNTAFLLYQPSFLLEDP
FT                   PQVPQERKLLAATYYKRAYGQHNTDALVVAGNIYYNMGLYVEAAELYRASSTPQGSWNL
FT                   GYMYEFGLGVKQSFRLASRHYKSSLSQTRKVYLGVKLTLLKLQLKKWLSWLSDKPIVRP
FT                   LLGASADEENGSLGTSLPGSGTFKWMKKKQERQTHAPEQTTPWSLLSRFFSF"
FT   gene            <138469..>139353
FT                   /locus_tag="KLTH0H01518g"
FT                   /old_locus_tag="KLTH-ORF2110"
FT   CDS_pept        138469..139353
FT                   /locus_tag="KLTH0H01518g"
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2110"
FT                   /product="KLTH0H01518p"
FT                   /note="highly similar to uniprot|Q04491 Saccharomyces
FT                   cerevisiae YLR208W SEC13 Component of both the Nup84
FT                   nuclear pore sub-complex and of the COPII complex (Sar1p
FT                   Sec13p Sec16p Sec23p Sec24p Sec31p Sfb2p and Sfb3p) which
FT                   is important for the formation of ER to Golgi transport
FT                   vesicles"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5E221"
FT                   /protein_id="CAR30082.1"
FT                   /translation="MVTITNAHTELIHDAVLDYYGKRLATCSSDKSIKIFEVEGETHRL
FT                   VETLYGHEGPVWQVDWAHPKFGVILASSSYDGKVLIWREENGRWSQIAVHAVHSASVNS
FT                   VKWAPHEYGPLLLAASSDGKVSVVEFKENGTTAPILIDAHAIGVNTASWASAALQDGAA
FT                   PQQMRRFVTGGADNLVKVWKFNPDANTYLLEDTLEGHSDWVRDVAWSPSVLLRSYLASV
FT                   SQDRTCIIWTQENSQGPWKKTLLKEDKFPDVLWRASWSLSGNILALSGGDNKVTLWKEN
FT                   LEGKWEPAGEVEQ"
FT   gene            complement(<139430..>140347)
FT                   /locus_tag="KLTH0H01540g"
FT                   /old_locus_tag="KLTH-ORF2107"
FT   CDS_pept        complement(139430..140347)
FT                   /locus_tag="KLTH0H01540g"
FT                   /gene_family="HOG000045183" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2107"
FT                   /product="KLTH0H01540p"
FT                   /note="similar to uniprot|Q05788 Saccharomyces cerevisiae
FT                   YLR209C PNP1 purine nucleoside phosphorylase specifically
FT                   metabolizes inosine and guanosine nucleosides"
FT                   /db_xref="GOA:C5E222"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="UniProtKB/TrEMBL:C5E222"
FT                   /protein_id="CAR30083.1"
FT                   /translation="MNVFDLEEQRLLIGYAVEFLKHAFFEHFTRFEPRTLIICGSGLGG
FT                   IVDKVAPKPAPLVIPYEKIPGFKSSTVAGHQGKLVFGYMKGSPVVLMCGRLHYYEGHAL
FT                   HETVFPIRVVNELKTVKHLIVTNACGAINPSYQTGDLMCLNDHINMPGIAGQHPLRGPN
FT                   FEEYGPRFLPLSDAYDLDLRKLLFNKRAELGLERPLHEGVYTYVSGPTFETRAEARLIR
FT                   LVGGDVVGMSTVPEVIVARHCGIRVLALSLITNEVVTDFPASAMDESPVPLDRGKATHE
FT                   EVLEAGFLASVDVERLVEEVVGEL"
FT   gene            complement(<140915..>142390)
FT                   /locus_tag="KLTH0H01562g"
FT                   /old_locus_tag="KLTH-ORF2105"
FT   CDS_pept        complement(140915..142390)
FT                   /locus_tag="KLTH0H01562g"
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2105"
FT                   /product="KLTH0H01562p"
FT                   /note="similar to uniprot|P39517 Saccharomyces cerevisiae
FT                   YDL160C DHH1 Cytoplasmic DExD/H-box helicase stimulates
FT                   mRNA decapping coordinates distinct steps in mRNA function
FT                   and decay interacts with both the decapping and deadenylase
FT                   complexes may have a role in mRNA export and translation"
FT                   /db_xref="GOA:C5E223"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5E223"
FT                   /protein_id="CAR30084.1"
FT                   /translation="MEDDWKSQLNIPKKDTRPQTDDVLNTRGNTFEDFYLKRELLMGIF
FT                   EAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVVPTLEKVKPKVNKIQALIMV
FT                   PTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNEPVHILVGTPGRVLDLAS
FT                   RKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSLLFSATFPLTVKEFMVK
FT                   HLHKPYEINLMDELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCNSTNRVEL
FT                   LAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRGIDIQAVNVVIN
FT                   FDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAAIPAQIDKS
FT                   LYVAEDDSAVPVPFPLASLPNTMANVAGQQQQLPPQLTQPQFTAVPQQYAPQQQQYMPQ
FT                   QQYQYPPQAFMQGPPQSMEQAPSMQGHAPQQTY"
FT   gene            <143065..>144453
FT                   /locus_tag="KLTH0H01584g"
FT                   /old_locus_tag="KLTH-ORF2101"
FT   CDS_pept        143065..144453
FT                   /locus_tag="KLTH0H01584g"
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2101"
FT                   /product="KLTH0H01584p"
FT                   /note="similar to uniprot|P06784 Saccharomyces cerevisiae
FT                   YDL159W STE7 Signal transducing MAP kinase kinase involved
FT                   in pheromone response where it phosphorylates Fus3p and in
FT                   the pseudohyphal/invasive growth pathway through
FT                   phosphorylation of Kss1p phosphorylated by Ste11p degraded
FT                   by ubiquitin pathway"
FT                   /db_xref="GOA:C5E224"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5E224"
FT                   /protein_id="CAR30085.1"
FT                   /translation="MSFASQDVSLRQKSRPGESGLFQPSSLKRKNLKKLTLGGAVGTGR
FT                   GLRTDNMVPVSITGSSGSNGIEAPLGLNGIPNGDLRGYGSSGVSPTSDPSSAGITPTEE
FT                   VPGLTSDLENLSLFQDTTIELQDLVQLGKIGSGNSGTVLKTLHVPDSRIIAKKSIPVEN
FT                   KQLVKSQLMRELSIMRNVKPHDNIVGFFGAFYTASTSNEIVILMEYMDCGSLDKIMSTY
FT                   KAFVARGIQSPTENWFSEPVLSKISFAVLNGLLYLYRGYKIIHRDIKPSNVLINSKGCV
FT                   KICDFGVSKKLINSIADTFVGTSTYMSPERIQGSVYSTKGDVWSLGLMIIELVTGEFPL
FT                   GGHSDTPEGILDLLQRIVNEPPPRLPPQLPNGLQYSREMFDFVNRCCVKDERERSSLQE
FT                   LLCHDFIEKSRSQGDREFRHWCKRIKKWLKEDKMLRREEQERAKLVKRQLESAANAATA
FT                   ARHR"
FT   gene            complement(<144510..>144836)
FT                   /locus_tag="KLTH0H01606g"
FT                   /old_locus_tag="KLTH-ORF2099"
FT   CDS_pept        complement(144510..144836)
FT                   /locus_tag="KLTH0H01606g"
FT                   /gene_family="HOG000248850" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2099"
FT                   /product="KLTH0H01606p"
FT                   /note="similar to uniprot|Q12082 Saccharomyces cerevisiae
FT                   YDL157C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5E225"
FT                   /protein_id="CAR30086.1"
FT                   /translation="MQSNILSVFNPPPQRELSSEETKDCIPCQVMSTMFSLGFGTYLLS
FT                   GKPFEYSEKEKKRGITAEKFQQMNPKWWRTSLRTMGGSLIIFGLIRGSEGWLWNKKKPG
FT                   TNEH"
FT   gene            <144953..>146488
FT                   /locus_tag="KLTH0H01628g"
FT                   /old_locus_tag="KLTH-ORF2098"
FT   CDS_pept        144953..146488
FT                   /locus_tag="KLTH0H01628g"
FT                   /gene_family="HOG000234710" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2098"
FT                   /product="KLTH0H01628p"
FT                   /note="similar to uniprot|Q12510 Saccharomyces cerevisiae
FT                   YDL156W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5E226"
FT                   /protein_id="CAR30087.1"
FT                   /translation="MGELSEFQKRRLENIKRNNDLLKKLNLSGVSNQIKNEAGAKDERK
FT                   PKKKAAKQRVVKKEPKPEKVPTRRSRRLMGESADGKEVPHVSDYELLKGSRSNDPELLD
FT                   NLKSTALVGDVKLSDLLKSEDENELLARFQNYNSKGFSSGDFFKELQKHQKVSEDIQEL
FT                   QQEFNLELYEIFQPNEIKIVQDRISALFFHPSVDQKLVVGGDTTGHVGLWNVIDEEPND
FT                   DLAEPDITTVQLFSKNVAKIDVYPTDPGKLLTASYDGMIRSIQLDSLKSEELLSLKNEY
FT                   DESLGVSDFQFSYENPNEIFLTTLSGEFTTFDTRTKPTSINLRRLADKKIGSFSINPKR
FT                   PYEIATGSLDRTLKIWDLRKTVKNPEWSAFDDYSSHEVVSTYDSRLSVSAVSYSPLDGS
FT                   LVCNGYDDTLRIFDVKDVPPQDLQPKLTLKHNCQTGRWTSILKARFKANMDVFAIANMS
FT                   RAIDIYHSSGQQLAHLKTATVPAVVSWHPLKNWIVGGNSSGKVFLFQSPNKDS"
FT   gene            complement(<146708..>147451)
FT                   /locus_tag="KLTH0H01650g"
FT                   /old_locus_tag="KLTH-ORF2097"
FT   CDS_pept        complement(146708..147451)
FT                   /locus_tag="KLTH0H01650g"
FT                   /gene_family="HOG000074706" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2097"
FT                   /product="KLTH0H01650p"
FT                   /note="similar to uniprot|Q04170 Saccharomyces cerevisiae
FT                   YDR391C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5E227"
FT                   /protein_id="CAR30088.1"
FT                   /translation="MMKQSPLSPPASPLVDLESKPVVKVNNGHCRTVVPVNKVTNIERA
FT                   TLTLAKAFHDSKANDYLMKKFANIPSSEEVPKARINEILHQFNLLYAAKGGEIVEANDF
FT                   DAVAVWTGPGHHFDQDLTNDPVFNHIFFEVLHDKRDEILKELDCYYLFIVGKDLTNPKV
FT                   RGSVRAIFDTYKRKADEEGVALVLEAINEHARSVYEYFGFKNYHTFHFGAGEVDANGKA
FT                   NPNGEGFVGYLMIYYKDELPGAIDN"
FT   gene            complement(<148024..>150129)
FT                   /locus_tag="KLTH0H01672g"
FT                   /old_locus_tag="KLTH-ORF2094"
FT   CDS_pept        complement(148024..150129)
FT                   /locus_tag="KLTH0H01672g"
FT                   /gene_family="HOG000141956" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2094"
FT                   /product="KLTH0H01672p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5E228"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniProtKB/TrEMBL:C5E228"
FT                   /protein_id="CAR30089.1"
FT                   /translation="MTATTAAQSPDNPTKHDSGHALRPKRNRSRAGCFTCRLRRKKCDE
FT                   VHPKCGTCTKHVLKCIWPRKGQGRLTKEMREKMKREVDLYDESSLLVPITSPPVSEGPA
FT                   SRRGSRTQAQHFVNYAIDHASKALVLHSTDLPMNDASQIFNSQSSGEDEEDLEASETES
FT                   HTEGSETAQPVAEPTETPLEQSHALIPTRRDREEWASFLDSPGNLPGTPQTGFFWEKLF
FT                   DMNFTEPIVSPNFSIISPVCASPLPDGDLVAAASIMSAVHTEDDLNAYGLDEEQTEKFY
FT                   GKLMEKFVDWTSTNNQTKRTSVAKLMSQYQFTQQDLLLYYTCVYYFLPAVGPQQTLPQL
FT                   TTTETFVPLLTQHPIVKDVFLCCGATFLAWCQPQKYSQLAERLYQSSKSRLQKELASNR
FT                   IRGDETWAFACFQLLCLTNKLHNGEGISMVDRCVDNLAHSFNIIKRKYQTIKERGSTPT
FT                   DRMLIESFMYNYTVSLLVARDLSKLPNPFSDMFANLTTLLKSPIFNDCDVEWMNNPVLG
FT                   PSVDAFGMLAKVSFLSRMPLPLTSPHWTDEAQKLLQDCLYYTPPQLPEEVRNDERKYEV
FT                   YRPGLLSGSIISKACYLLLSKIIRYDDFDVRNLEIQGVVKYSIQSLRDIEKGNPLLCIL
FT                   LWSLLIIGAFSVDPEDRLVIKEYLKSTSETIHSYGALKIDNLLELIWDRDDINLLFVRE
FT                   NISQVII"
FT   gene            <151103..>152431
FT                   /locus_tag="KLTH0H01694g"
FT                   /old_locus_tag="KLTH-ORF2086"
FT   CDS_pept        151103..152431
FT                   /locus_tag="KLTH0H01694g"
FT                   /gene_family="HOG000167672" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2086"
FT                   /product="KLTH0H01694p"
FT                   /note="similar to uniprot|P24871 Saccharomyces cerevisiae
FT                   YLR210W CLB4 Involved in mitotic induction G(sub)2-
FT                   specific B-type cyclin and uniprot|P24870 Saccharomyces
FT                   cerevisiae YDL155W CLB3"
FT                   /db_xref="GOA:C5E229"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniProtKB/TrEMBL:C5E229"
FT                   /protein_id="CAR30090.1"
FT                   /translation="MQYSRFASDENRVFDHAAHARFTNDENAVPQGPAGLAGSKLALGV
FT                   AESVQTSGRRVALGDVTSQANKQAHGKPGVLAHAHSRHASENHNGPATAQLEHTGAQPM
FT                   SPPMELRSPEKMYSDDTLQGADHVGEDFNDDTSSVSSDSEPLLLVSTEESMRAVQLANQ
FT                   EFYSESPDPLDEDTYDLVMVVEYTQEVFQYLHELEEKYRPHPRYMHFQPELKWSYRSTL
FT                   IDWIVQVHARFQLLPETLYLTVNIIDRFLSRKTVTLNRFQLVGAAALFLAAKFEEINCP
FT                   TLKEILYMLDNSYTKDELLRAERYMINTLEFELGWPGPMSFLRRVSKADDYEYDIRTLA
FT                   KYLLETTIMDCRLVSAQPSWLAAGAYYLSRVILGFNNWTKQHIYCSGYTAEQLFPLATI
FT                   ILENCRHASKRHQAIFEKYSERRHRRSSQVVARWIAMAEERIS"
FT   gene            complement(<152669..>154462)
FT                   /locus_tag="KLTH0H01716g"
FT                   /old_locus_tag="KLTH-ORF2082"
FT   CDS_pept        complement(152669..154462)
FT                   /locus_tag="KLTH0H01716g"
FT                   /gene_family="HOG000207285" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2082"
FT                   /product="KLTH0H01716p"
FT                   /note="similar to uniprot|Q05842 Saccharomyces cerevisiae
FT                   YDL153C SAS10 Component of the small (ribosomal) subunit
FT                   (SSU) processosome required for pre- 18S rRNa processing
FT                   essential nucleolar protein that when overproduced disrupts
FT                   silencing"
FT                   /db_xref="GOA:C5E230"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="InterPro:IPR018972"
FT                   /db_xref="UniProtKB/TrEMBL:C5E230"
FT                   /protein_id="CAR30091.1"
FT                   /translation="MARRKNARQAPKGGQEDFYGLNEVDDFAKKREKVMLDKAGLTEYP
FT                   ESGDSDGLMSDENEEGVMNVDDESSEGDQDEEPEEDDEPLDGEKAYRQVFGRKLDLGDA
FT                   RDAEDGGETMLDNESAWGSTKNEYYGADDLDDEEAAKEIEREALRQQKKHLEDLDMNDY
FT                   LDEEVEEDWAKSAKDFSLGQFQEATNQPQTQVRARDILKMSADGKEKLLKVWCPEFFPL
FT                   SKELAHLAPQLDELKAQQNSSETTSIKITALSSYLGAISSYFTILLHEIQTNDDFKSMK
FT                   EHPIMESILLCKEVWRQAQELPEEVPVEEEQDSEGIASDVENMEDDLLEDENAQESDKE
FT                   SAGAVGSDHEPEYHSDDLDIDISRPRVNQSASNKVPSAEIDDYVESEVADVDAQEKKAR
FT                   KKTLRFYTSKIDQQATKKGDKFKGDDDIPYKERLYERQQRLLEEARKRGQSGPDGTELN
FT                   AQDYDSEDEKVAKNVNTGSSTDYYNEIQQSGLNKKQARKQAHKDAVLASREGKLAELAG
FT                   EVGENGKRAISYQIMKNKGLTPRRKKENQNSRVKKRKKYDQAKKKLKSVRSVYSGGLSG
FT                   VYEGEKTGIKKNLTKSVKFKN"
FT   gene            <154705..>155961
FT                   /locus_tag="KLTH0H01738g"
FT                   /old_locus_tag="KLTH-ORF2080"
FT   CDS_pept        154705..155961
FT                   /locus_tag="KLTH0H01738g"
FT                   /gene_family="HOG000141957" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2080"
FT                   /product="KLTH0H01738p"
FT                   /note="similar to uniprot|P25441 Saccharomyces cerevisiae
FT                   YDL150W RPC53 RNA polymerase III subunit C53"
FT                   /db_xref="GOA:C5E231"
FT                   /db_xref="InterPro:IPR007811"
FT                   /db_xref="UniProtKB/TrEMBL:C5E231"
FT                   /protein_id="CAR30092.1"
FT                   /translation="MSGTGRLPTLSQGNAKPSLKFKPKALARRSKEEREASVPKPAPEE
FT                   IKKPFNNKKKYSKRENGPNGQRRIPKYLLNTRVVNAGFGAENFTGGGGDMRTGFIKTEG
FT                   SNHDYLQKGLKAANEGDEGLDSEGEGATKINMGREYKSSELYASEEEDEDESSSADIDE
FT                   EALQSKRLARFFPVRALRVKHDEVELVKKEIQDTMSDPTTRDPTPGLPKLEDPQDGGQG
FT                   LQEVLNNRSLELQDKLNDLRLQNEFASVDSGEAMQEVALLNQDYRHIQKKIIKINNQPG
FT                   KFMFFQLPAVLPDFEEPKPPAPDAVEEPTVKPENEDEKTEEPTKESQDSSKKPEDSAKK
FT                   PEPETIQEPKPLAGRIGSLRIHKSGRLSVKIGNVEMDVSRGAENTFLQEVVALDEREEE
FT                   RTVELLGQIVGKAVVTPKF"
FT   gene            <156245..>159010
FT                   /locus_tag="KLTH0H01760g"
FT                   /old_locus_tag="KLTH-ORF2079"
FT   CDS_pept        156245..159010
FT                   /locus_tag="KLTH0H01760g"
FT                   /gene_family="HOG000034159" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2079"
FT                   /product="KLTH0H01760p"
FT                   /note="similar to uniprot|Q12142 Saccharomyces cerevisiae
FT                   YDL149W ATG9 Transmembrane protein involved in formation of
FT                   Cvt and autophagic vesicles cycles between the pre-
FT                   autophagosomal structure and other cytosolic punctate
FT                   structures not found in autophagosomes"
FT                   /db_xref="InterPro:IPR007241"
FT                   /db_xref="UniProtKB/TrEMBL:C5E232"
FT                   /protein_id="CAR30093.1"
FT                   /translation="MDGSSSKYHEPERNTFLSRVFGPHSTEGNSMGNTEMTQIQASEQS
FT                   FVQSGGMRMIESDQGSSSDDDASFEREEDDSRVRAFHGIQSVVLDADSDAGSSSGAGSI
FT                   ASVQKLGQGADSDSEYQERRPGAEEDNNDEDSPLFRQNLKSLDFKSPSPVPAGPSVGFG
FT                   PEVSDRRAFKSKFIDKHTQFLKLGKDEAEAESFLFRKNSAWDEENQQPKAQTNVPRIFG
FT                   NFAAIGNTPAARLHTLSPRERALWKWANVENLDIFLQEVYNYYLGNGFYCICIEKALNI
FT                   ATLLFVVFISTFMGCCIDYSKLPHSTKISEVYVHKCYSTQISGTTKVLLWGFYIFVALK
FT                   VAQFYFDVRALRDIHNFYSFLLNISDKELQTVSWQKVIKQIMLLKDQNAVTANVAEVKA
FT                   KNRIDAHDVANRIMRRENYLIALFNNDILDLTLPIPLYRTSTLTKTLEWNLNLCIIGFA
FT                   FNESGYLKQSFLKSSQRSYLEEELRKRFMLAGFLNIILSPFLVAYFILLYFFRYFNEYK
FT                   TSPSALSSRQYTPIAEWKFREYNELYHLFQKRLGLSVEVANNYIDQFPKEKTNIIMKFI
FT                   AFVSGSFVAILALLTVFDPENFLNFEITKDKSVLFYISVFGTVWAICKNSVSGQYRVFD
FT                   PEESLREVVSYLHYKPKEWEGKYHTEDVKQDFCKLFNLRVILLLRELASLVMTPFILWF
FT                   SLPKSSGKIVDFMREVSVYVDGLGYVCKYATFEVQGRHHDAKSRASRIIKNHQNFDAPQ
FT                   GYDESEHSSASDSEDDDKSVNKMMRSYMYFLDSYQNNDNEVGKHQLPKSGRNGKGPGNV
FT                   DWLNTNYSWKRQFQPGQRPGDFQGNNVGYSSSMPTGTKDPVTKRSSEFKADSRSTGRGQ
FT                   TRFDSSLGESFINSVPLGEYRHLDRAEEVPGGNGVLGLLNQYYKKSDVGR"
FT   gene            complement(<159110..>161554)
FT                   /locus_tag="KLTH0H01782g"
FT                   /old_locus_tag="KLTH-ORF2078"
FT   CDS_pept        complement(159110..161554)
FT                   /locus_tag="KLTH0H01782g"
FT                   /gene_family="HOG000157224" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2078"
FT                   /product="KLTH0H01782p"
FT                   /note="similar to uniprot|Q99207 Saccharomyces cerevisiae
FT                   YDL148C NOP14 Nucleolar protein forms a complex with Noc4p
FT                   that mediates maturation and nuclear export of 40S
FT                   ribosomal subunits also present in the small subunit
FT                   processome complex which is required for processing of pre-
FT                   18S rRNA"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniProtKB/TrEMBL:C5E233"
FT                   /protein_id="CAR30094.1"
FT                   /translation="MAGSQLKNLKNALKEQGFTGQTNVKGSKKLKRKAKEYDRDERTKA
FT                   IARIREQFNPFDVKMNRDKRGAEAKRVAQPVGKPGISKQIGEEQRKQVYEAKKKSKNRL
FT                   GGLLDRRFGENFKGLTEEEKMLERFTREKQSQASSRRSLFNLDDDDDAGDDDVYGEKLT
FT                   HYGKSLSFQDDFQEDDLGLDEDTGNKGSSKRSEREFGDENAELPARKKTKAEVMKEVIA
FT                   KSKFYKQERQKAQEKLEDDIQDVDDEFEDVMAELNSLPKAKKTDQNNSKEFDKEYDTKV
FT                   RELGLDRRAAPAERTKTEEELEKENEEKRQKLEQARLDRMRGMFGEEEDQGVEDLGEEF
FT                   WAGEDSENEDLNETDGSELEDVELPGGDETKSFGGKSKAVSVIPCPQTEEELKDFLQSY
FT                   ELREHPNMVKEIIRTYQPSLAMGNKGKLGVFTGVLLRHILSLSVSYDDSHLELFGSVQN
FT                   SLIAILRSMAQKYNEPLSETCREITSEIQERFKNERSHGLSTADLIFFTLVGYIFSTSD
FT                   HYHLVVTPCNVLIGELLEQTKLNSFQNVFFCAVLARISLSYQNMGKRLVPELVYFFEKS
FT                   LVTLLPLTSKEKSSSGLAHIIQDSEDLNAPQKLDLAAIGSHNLNLRQAMSQDYVPNDQE
FT                   KSALLCNILASLEEAISLVWKELSSFQELTLSFKRILSAFSQIYEDFEKPKVILEKIEK
FT                   FEKFHEHFPLSLQNHRPVSIPSHVPKYEENFNPDKKSYDPDRTRNEVNKMKAQLKKERK
FT                   FTMKEIRKDTRFEARQQIETKKKDYADYHSKMARIINQISTEEGMEKGKYEREKKLRNS
FT                   KK"
FT   gene            <161820..>163145
FT                   /locus_tag="KLTH0H01804g"
FT                   /old_locus_tag="KLTH-ORF2073"
FT   CDS_pept        161820..163145
FT                   /locus_tag="KLTH0H01804g"
FT                   /gene_family="HOG000194265" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2073"
FT                   /product="KLTH0H01804p"
FT                   /note="highly similar to uniprot|Q12250 Saccharomyces
FT                   cerevisiae YDL147W RPN5 Essential, non-ATPase regulatory
FT                   subunit of the 26S proteasome lid"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C5E234"
FT                   /protein_id="CAR30095.1"
FT                   /translation="MSRDAPLKAEKDYTEILKEELPKIEVLAQNDTQGALDKLLVLEKK
FT                   TRQSSDLESSKKVLASIVELLVGKNQWGELDEQLIALSKKHGQLKMSVQFMVQKIMEHL
FT                   EQLQDLKTKVKAIETIRTVTENKIFVEVERARVTRILTEIRRSEGDIDQATDLLCSLQV
FT                   ETFGSMDMYEKIGFILEQMELSILRGDYSQATVLSRKVLRKTFKNEKYEALKLDYFELL
FT                   IKIGLHKRDYLQVAQYYQEIYNTESIKKDEAKWKHALTHVVLFLVLTPYDNLQNDLIHK
FT                   VQLDNNLKKLEKPESLVKLFTTAELMRWPFVKESYESFLNSDDVAFGKNNAHWEDLRKR
FT                   VIEHNLRVVSKYYTRINLSRLNELLDLTETETERFISDLVNQGVIYAKINRPAKIVNFG
FT                   RPKNSSLLLNEWSQNVDQLLEHIETIGHLITKEEILHGLKGN"
FT   gene            complement(<163221..>163757)
FT                   /locus_tag="KLTH0H01826g"
FT                   /old_locus_tag="KLTH-ORF2071"
FT   CDS_pept        complement(163221..163757)
FT                   /locus_tag="KLTH0H01826g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2071"
FT                   /product="KLTH0H01826p"
FT                   /note="weakly similar to uniprot|Q05789 Saccharomyces
FT                   cerevisiae YLR211C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5E235"
FT                   /protein_id="CAR30096.1"
FT                   /translation="MQLRDRKFSESIETYKKSAEAINQLEIQHKSIANVGDLKQALNLL
FT                   KKDLNRKIREIQILGKFSAQSSPIETNDTASHEPMAAYRLSGFQNNILAIVRGKTDPKS
FT                   GVSASEIENSISKEVSQLFKSFALIDQQKFKEYDNKVEQLVRENRKLTGQIVKLKERWD
FT                   SLVESARQKRNQQNE"
FT   gene            <164062..>165513
FT                   /locus_tag="KLTH0H01848g"
FT                   /old_locus_tag="KLTH-ORF2070"
FT   CDS_pept        164062..165513
FT                   /locus_tag="KLTH0H01848g"
FT                   /gene_family="HOG000113306" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2070"
FT                   /product="KLTH0H01848p"
FT                   /note="similar to uniprot|Q12342 Saccharomyces cerevisiae
FT                   YDL146W Protein of unknown function green fluorescent
FT                   protein (GFP)-fusion protein localizes to the cell
FT                   periphery cytoplasm bud and bud neck"
FT                   /db_xref="InterPro:IPR018556"
FT                   /db_xref="UniProtKB/TrEMBL:C5E236"
FT                   /protein_id="CAR30097.1"
FT                   /translation="MERGSSSPDDEEPNAAYSPSIFWEEMEHLLKVPDVTDETQVNTAL
FT                   VKYIKHGSDSYQKCVKTEQGLYRLGVTFTESTMFHRNKMFVVSKLLSLLSVDLLECNLK
FT                   FIISYIILCASKSDLSVLELLVEFQGFTVVYNNLYSTFAYLNRYGEDIAPSSSSGPRSD
FT                   AGTEIESEIIESLKQVSTILMDILFQIFKYSKCDIVNLSIVDDFFVYYLMRTMRSETTE
FT                   DIFNNAKFKLLLALNEQYMIFSYQYELENRVYKYLVDSTVSKSFVELLLLKFNRVTDRS
FT                   LQIMLCKIVYLILTMDESYAKDFFYLNDLHVLVDVLIRELNNIADDEELIRNTVLRVLF
FT                   PLLRNTELAQTQYRRSDLIDILQHLSSLDNVCSSGETKDEHRTTVRLAQKCLKQIDWLQ
FT                   VPVVDTSDQTVPVYSDDSREMSVSTGSLSSPYDFQEKHLYGNYDASLSAESITKRLQPP
FT                   PPPPARKHPHRLGSGQKIAQFRPKS"
FT   gene            complement(<165566..>166972)
FT                   /locus_tag="KLTH0H01870g"
FT                   /old_locus_tag="KLTH-ORF2069"
FT   CDS_pept        complement(165566..166972)
FT                   /locus_tag="KLTH0H01870g"
FT                   /gene_family="HOG000165714" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2069"
FT                   /product="KLTH0H01870p"
FT                   /note="similar to uniprot|P53378 Saccharomyces cerevisiae
FT                   YLR212C TUB4 Gamma-tubulin involved in nucleating
FT                   microtubules from both the cytoplasmic and nuclear faces of
FT                   the spindle pole body"
FT                   /db_xref="GOA:C5E237"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002454"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniProtKB/TrEMBL:C5E237"
FT                   /protein_id="CAR30098.1"
FT                   /translation="MTGEIITLQIGQCGNQVGKQFWSQLIKEHGISRDGQSLSTNESDT
FT                   VEEDDPTIFFKQNDSNRYTPRALLFDLEPSAIADVQNSFPGLFNERNVWVSKDELGAGN
FT                   AWSKGYDHGLENQEEFINMVDKEIDATESFEGFQLLHSVAGGTGSGLGSNFLEALSDRY
FT                   HKKIITTYSVFPSSESEVVIQPYNTILTLRRLIEHSDASVVFDNKALLNLATRVFRDRN
FT                   TSYEQTNQLIASVLSSITNSLRFPSYMYNSLPSIFSTLVPTADLHFLVPSFTPFTSDFI
FT                   PGVRDFKKSSAYDVILDLFDKSNSMVLRNNDTPVYLSIYNSILGPTDQADITRAILKSQ
FT                   QRIKFPPWSSSALHVNVGKKSAYNVTPDSDKVSGMMLANTTSVNALLQTACSSFDVLFK
FT                   RGAFLHMYQDGKMFQNGAEEFIESREVVQSCINEYYAAEQETFMDDVLMEEENIVGNGG
FT                   MLDADGDDII"
FT   gene            complement(<167262..>170891)
FT                   /locus_tag="KLTH0H01892g"
FT                   /old_locus_tag="KLTH-ORF2068"
FT   CDS_pept        complement(167262..170891)
FT                   /locus_tag="KLTH0H01892g"
FT                   /gene_family="HOG000195913" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2068"
FT                   /product="KLTH0H01892p"
FT                   /note="highly similar to uniprot|P53622 Saccharomyces
FT                   cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
FT                   coatomer complex which surrounds transport vesicles in the
FT                   early secretory pathway"
FT                   /db_xref="GOA:C5E238"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR010714"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016391"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C5E238"
FT                   /protein_id="CAR30099.1"
FT                   /translation="MKMLTKFESKSTRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGTL
FT                   LHKFEDHEGPVRGIDFHPTQPLFVSAGDDYTIKVWSLDTKKCLFTLNGHLDYVRTVFFH
FT                   RELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRV
FT                   WDISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLP
FT                   LIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKTIRVWD
FT                   LDKRTPVKQFKRENDRFWLVRAHPNINLFGAAHDSGIMVFKLDRERPCSAINQNQLIFV
FT                   NKEKQVQTFDYNKKVVSLPYVSLKNIGHAWNAFRSLSYNPSQHSVLVNCSDNQGSKFAL
FT                   CPLPKQATGAIEPTGVLEDSGSFATFVARNRFVVYNSSTSSLEVRGLDNKITKSIKIDG
FT                   DNTVKDIVYGGPGSVLLLQAKSVTLFDVQQARKLAEVPSKNVKYVSWSLDNQFIALMSK
FT                   HTITIVTKNLEVVTSMHETIRIKSAAWDETGVLIYSTLNHIKYTLLNGDNGIIKTLENT
FT                   LYINKVHGKFVYALNREGEVEVVTIDPTEYRFKKALVNKNFPEVLRIIKNSNLVGQNII
FT                   SYLQKSGFPDIALQFVQEPQTRFDLALEYGDLNIALEEANKLNSSIVWEQLGKAALQQG
FT                   NIEMVELVYQTQKLFDKLSFLYLITGDLSKLSRMESIAERRGDISSLILNTFYSDSAEK
FT                   RGSVFAQSGALPLAYAIAKANNDDDAVAQILEKAGVDESDVKLPKNLTSSRLCKSPVVS
FT                   EAITQWPLESPGASFFEKALSGQVEGLSLEEGADEEELERDAGIVAPEPNDFSDEEEVL
FT                   EDDGGWDIGEEDLGLEEDAQEAFLADKGTAKIVDENEVTQWTKNCKLPYVLIASGAFEA
FT                   AAQALNKQAGVANFEPLRPRFLEIYESCRTYMAATPAELPSITGVIRAVAEEEERGKLL
FT                   PFVAGIDVVTSKMNEGFSLFKANKLEAAIEIFRDVVYIVTLFATDNEEDESTARKALAK
FT                   AREYILGITIELARRALPADQVKRNLELASYFTTTKLLPPHRSTAFQVAMSQSFKHKNF
FT                   IQASYFASEFLKIVTTGPRADQAQKVKDRADLMAHDAIEVDFDPHAEFAICASTLTPIY
FT                   SGTPTLSDSLTGAKYHASEKGKLDAIALISKIGTPASGLRILI"
FT   gene            complement(<171281..>172708)
FT                   /locus_tag="KLTH0H01914g"
FT                   /old_locus_tag="KLTH-ORF2062"
FT   CDS_pept        complement(171281..172708)
FT                   /locus_tag="KLTH0H01914g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2062"
FT                   /product="KLTH0H01914p"
FT                   /note="similar to uniprot|Q05790 Saccharomyces cerevisiae
FT                   YLR213C CRR1 Putative glycoside hydrolase of the spore wall
FT                   envelope; required for normal spore wall assembly, possibly
FT                   for cross-linking between the glucan and chitosan layers"
FT                   /db_xref="GOA:C5E239"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:C5E239"
FT                   /protein_id="CAR30100.1"
FT                   /translation="MVALALAASLLIGAEFVQCFVETYKSDPAIACSNDNHCPKEWPCC
FT                   SQYGQCGDGPLCVGGCDPRSSFDAHSCAAIPALVPSASSGIQVLGGSTGGAGDREDQFL
FT                   PALDTQFGIYSARHGPKPDAERIQKALESAKMLHYSEFKVEPELSSADYTYSGFLDFDA
FT                   GPQPALMLTMPPETTGSLLSSARSFLYGRVAVTMKAAPGQGVVSAMVLMSAVKDEVDFE
FT                   ILGGDPEFAQSNYYYQGELVHTRMTKARIQPDSCSEFHTYEFDWNENRIHWLIDGAIVR
FT                   TLRREDTYDPVLKIHKYPQTPMRLEVAIWPGGVPSNNPGTIMWAGGLIDWVNAAAIVNG
FT                   GRFQLAVKQVTITPYANAFTQVKPAKLQARSEDSVFFYFYDPDCSNFDEACVRAAPQQK
FT                   EDRVQEAASAPLDSSISVQPSSTPVSSSSVPTPASSRTSAHSSYKPSVFTITRHENIGP
FT                   AMSRQNLLYKLRSWLLS"
FT   gene            <173705..>175792
FT                   /locus_tag="KLTH0H01936g"
FT                   /old_locus_tag="KLTH-ORF2056"
FT   CDS_pept        173705..175792
FT                   /locus_tag="KLTH0H01936g"
FT                   /gene_family="HOG000001131" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2056"
FT                   /product="KLTH0H01936p"
FT                   /note="similar to uniprot|P32791 Saccharomyces cerevisiae
FT                   YLR214W FRE1 Ferric reductase and cupric reductase reduces
FT                   siderophore-bound iron and oxidized copper prior to uptake
FT                   by transporters expression induced by low copper and iron
FT                   levels"
FT                   /db_xref="GOA:C5E240"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniProtKB/TrEMBL:C5E240"
FT                   /protein_id="CAR30101.1"
FT                   /translation="MRVQNLRLLALAVFSFAVTCVRGLELIDSSLASACIYYEKTFDWG
FT                   CHSHGNGAAAYRCRCGNVNWLGTITNCIANNTKSLRLRNHGFRHVARRCYEKGDFNYTL
FT                   ADMQRFYANGTGYLRDPTTADLSSPVFTTLRVNQTEFDWYYKKMKDLTFSVQRSQWFGW
FT                   GLVFFWATIIAVTTLFNFNEKFVGLKLTDNWLARSLMIPSLFENMTQRYPRLRAISPGP
FT                   HPNRLQALVVTAFVIQTIITVGVGYEMKLPHPYLTTRWFMNLDLVSYRVDLMALSLFPV
FT                   IYFFGIRNNPFIPLTGMSYTTFSYFHKWCAYVCVVLAFIHSIIWTVYARHDGGYKMWAM
FT                   DSYWQYGIAAMTLMALLVFHSFKLLRDKIYEVFLFFHQMMNIFFIVCMYYHLNKLGWLG
FT                   WVWSMAGILCFDRAARIVRIILSGGLQKSTLTDCGSGVIKLTVMNPRFLTYRPGSYAFI
FT                   YFMSPQDPWYYPWQSHPFTVLSTAKGKGIHGNEMAVYFKAQKGVTGHMLYKLLRSGEES
FT                   INIRVMVEGPYGDTLPQIAKVNRRIVGVAAGLGVTAVYAQILHLLEAQVPEMGCKLYWA
FT                   VNDLSHVSWFEEELKWLLSQKCQITILCTSPKELEETGSSFNTDNKLLEILDVRSLFAR
FT                   PDLRALVSEEVKEASDQSKDLTFISCGPSTFNIDFRASVSNTLRQKQSIDVALKEESFV
FT                   W"
FT   gene            complement(<175829..>176929)
FT                   /locus_tag="KLTH0H01958g"
FT                   /old_locus_tag="KLTH-ORF2053"
FT   CDS_pept        complement(175829..176929)
FT                   /locus_tag="KLTH0H01958g"
FT                   /gene_family="HOG000231938" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2053"
FT                   /product="KLTH0H01958p"
FT                   /note="similar to uniprot|Q05791 Saccharomyces cerevisiae
FT                   YLR215C CDC123"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="UniProtKB/TrEMBL:C5E241"
FT                   /protein_id="CAR30102.1"
FT                   /translation="MTNEYVELSEIKVSVQQVKNCAFSQWYSKFAGHTPQAKVIKPVPG
FT                   GFLEYLEQDGIKLPNDSQFGKSSYYAEIGNNEDNEYSDWEASSDEEHPQGQDVVQLFPE
FT                   LHKELKDIFREMGSLTPKLTWSSPKDATWILANNTLKCTEVNDMYLLLKASNYITHDLD
FT                   RALAECFDKNSALEQDGPLQHELVLRKWFDLNPALEFRVFVKDSAIIGVSQRDLNYYDY
FT                   LELLTETFKDLLDEFVEDIVLPRFPDSSFVCDVYIPRPFEKVWLIDFNPFARKTDSLLF
FT                   SWNELATIDPYKLESDYELRLVQENNVARFASKEHSENQVPKEVADAITNPKAIQELAE
FT                   KWGELLNMQKAGDSSDDEPGEQNNSL"
FT   gene            <177187..>178773
FT                   /locus_tag="KLTH0H01980g"
FT                   /old_locus_tag="KLTH-ORF2050"
FT   CDS_pept        177187..178773
FT                   /locus_tag="KLTH0H01980g"
FT                   /gene_family="HOG000226735" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2050"
FT                   /product="KLTH0H01980p"
FT                   /note="highly similar to uniprot|P39078 Saccharomyces
FT                   cerevisiae YDL143W CCT4 Subunit of the cytosolic chaperonin
FT                   Cct ring complex related to Tcp1p required for the assembly
FT                   of actin and tubulins in vivo"
FT                   /db_xref="GOA:C5E242"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012717"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="UniProtKB/TrEMBL:C5E242"
FT                   /protein_id="CAR30103.1"
FT                   /translation="MTGKASTNSTFKNREKPQEVRKANIIAARAVADAIRTSLGPKGMD
FT                   KMIKTSRGEVIISNDGHTILKQMAILHPVAKMLVEVSAAQDTEAGDGTTSVVILTGALL
FT                   GAAEKLLNKGVHPTIIAESFQRAAKRSVEILLDMSQKISLSDKQALTRAAATSLSSKIV
FT                   SQHSSFLAPLAVDCVLSIIDENATNVDLNDIRLIKKVGGTIDDTEMVDGVVLTQNVVKT
FT                   AGGPTRIEKAKIGLIQFQISPPKPDTENNIVVNDYRQMDKILKEERAYLLNICKKIKKA
FT                   KCNVLLIQKSILRDAVNDLALHFLSKLGIMVIKDVEREEIEFLSKSLNCKPISDPEFFT
FT                   EDRLGAADLIEEVDSDGSKIVKITGVKSNVARPTVSVIVRGANNVILDETERSLHDALC
FT                   VIRCLVKERALIAGGGAPEIEASRTLMKEARTLQGVEAFVWQEFAAALEVIPTTLAENA
FT                   GLYSIRVVTDLRTLHENGEKNAGISIRRSATTNTFDEHVLQPVLVSTSAITLASECVKS
FT                   ILRIDDITFSR"
FT   gene            complement(<179383..>180156)
FT                   /locus_tag="KLTH0H02002g"
FT                   /old_locus_tag="KLTH-ORF2048"
FT   CDS_pept        complement(179383..180156)
FT                   /locus_tag="KLTH0H02002g"
FT                   /gene_family="HOG000010898" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2048"
FT                   /product="KLTH0H02002p"
FT                   /note="similar to uniprot|Q07560 Saccharomyces cerevisiae
FT                   YDL142C CRD1 Cardiolipin synthase produces cardiolipin
FT                   which is an important constituent of mitochondrial
FT                   membranes required for normal mitochondrial membrane
FT                   potential and function"
FT                   /db_xref="GOA:C5E243"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:C5E243"
FT                   /protein_id="CAR30104.1"
FT                   /translation="MLARPGIFVGQKLPLLCRSTAIRFSSTTPPAPQKMRSVLSSIYTI
FT                   PNMLTITRIAAAPLIGHCIMTNNLVPALGLFSYSCLTDFLDGYMARKYNMKSVAGTVLD
FT                   PMADKILMLVTTVSLACPGGPQVIPIPLASLIIGRDVLLALSAIYYRISSLRHTYGKAT
FT                   WKSFWDVFRYPSAEVRPTKVSKWNTFLQMIYLGWAVATMIFQTRDEDKENDSEQTNIYQ
FT                   RAFEWLGYVVGCTTVLSGASYVFSKNAVKYLKKVR"
FT   gene            <180518..>182566
FT                   /locus_tag="KLTH0H02024g"
FT                   /old_locus_tag="KLTH-ORF2046"
FT   CDS_pept        180518..182566
FT                   /locus_tag="KLTH0H02024g"
FT                   /gene_family="HOG000214585" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2046"
FT                   /product="KLTH0H02024p"
FT                   /note="similar to uniprot|P48445 Saccharomyces cerevisiae
FT                   YDL141W BPL1 Biotin:apoprotein ligase"
FT                   /db_xref="GOA:C5E244"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR019197"
FT                   /db_xref="UniProtKB/TrEMBL:C5E244"
FT                   /protein_id="CAR30105.1"
FT                   /translation="MNVLVYNGPGASPDSVKHALNTLRRLLEPFYAVCTTNARVLQTEP
FT                   WAGKTSAVVFPGGADLPYTKECASVISQLKKFVSKQGGTFIGFCAGGYFATNCVEFAQG
FT                   DPQLEVVGKRELKFFPDTGRGPAFHGFKYNSEAGARAASLRLSNGEELKTYYNGGCVFV
FT                   NAEKYENVEVLAHYNEALDVPYSQDPSSLGAAVVLCQIGKGRALLTGPHPEFVPKLLQK
FT                   TNDDKYNSSVVEVLLEYEKGRLNFMKDILTKAGLHCNNDFADRVAPSLTPLLVMASSNN
FT                   HLIEELENNVRNSDGIFEDGAAILEGETDSFRIYKGFDQYEAAKSELLGEEPDEVPKSI
FT                   IISSASEPFAPRKLTPNFDTAKYFQYLNPQSSVGSLLMYGEVITSTSSLLNNNKKLLSL
FT                   FPRNSMLHVGTIQVSGRGRGGNTWVNPKGVSASTACINLPLVSPTTGRPVSIVFVQYLA
FT                   MLAYCKAILSYAPGFEDLPVKIKWPNDLYAMKPEYYRTKKLRLTGRGLAGSKTPLTDVE
FT                   PAYVKISGLLVNTNFLNNCYSLLLGCGLNVSHDGPTTSLNSWVSILNKEREKANMNPLP
FT                   FVEIEKLQALYMNNLNVVLDTFLNKGPVSVLPEYYDLWLHNDQIVTLTDHQNVKAKIVG
FT                   ITKDYGLLIAKELVSGTNTQFTGNVYHLQPDGNTFDIFKGLISKKVI"
FT   gene            complement(<182788..>188010)
FT                   /locus_tag="KLTH0H02046g"
FT                   /old_locus_tag="KLTH-ORF2041"
FT   CDS_pept        complement(182788..188010)
FT                   /locus_tag="KLTH0H02046g"
FT                   /gene_family="HOG000222975" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2041"
FT                   /product="KLTH0H02046p"
FT                   /note="highly similar to uniprot|P04050 Saccharomyces
FT                   cerevisiae YDL140C"
FT                   /db_xref="GOA:C5E245"
FT                   /db_xref="InterPro:IPR000684"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007073"
FT                   /db_xref="InterPro:IPR007075"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="UniProtKB/TrEMBL:C5E245"
FT                   /protein_id="CAR30106.1"
FT                   /translation="MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQ
FT                   MRAKVGGLNDPRLGSIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCE
FT                   CVCMHCGKLLLDEHSELMRQAIKIKDPKRRFNAVWSLCKAKMVCETEVPSDNDPAQYVS
FT                   RGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRVISADEVLNVFKHISPEDSVRL
FT                   GFNEDFARPEWMILTVLPVPPPPVRPSISFNETQRGEDDLTYKLGDILKANINVQRLEI
FT                   NGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSGRPIKSIRARLKGKEGRIRGNL
FT                   MGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEH
FT                   PGAKYIIRDNGDRIDLRYSKRAGDIQLQYGWKVERHIIDEDPVLFNRQPSLHKMSMMAH
FT                   RVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSAQSN
FT                   KPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDGVIPTPIILKPKPLWSGKQ
FT                   ILSIAIPSGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVDKKTVGSSSGGLIHVVTR
FT                   EKGPKICARLFSNLQKVVNFWLLHNGFSIGIGDTIADEKSMREITEAIIVAKRKVEEVT
FT                   KEAQANLLTAKHGMTLRESFEDSVVRYLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKG
FT                   SFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKGFVENSYLRGLTPQE
FT                   FFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSLGNVIQFIYGED
FT                   GMDAAHIEKQTIDTIASSDAAFERRFRIDLLNPRHALDPSLLESGSEIIGDLKLQALLD
FT                   EEFKQLVEDREFLRKIFVDGEQNWPLPVNIRRIIQNAQQTFRIDQTKPTDLTIRDVVYG
FT                   VKELQEKLLVLRGKSKILQEAQQNAVTLFCCLLRSRLATRRVIQEYRLNKQTFEWVLSN
FT                   VESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNV
FT                   AKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKSITVASEIYYDPDPRSTVIEED
FT                   EEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLF
FT                   VIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKRIENTMLESITLRGVEDITRVV
FT                   MMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIE
FT                   AGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCS
FT                   FEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFDVMIDEESLVKFMPQQKME
FT                   EVADGHDGARTPYNNESGLVNADIDVKDELMFSPLVDSGSTDAMSGGFTAYGGADYGGA
FT                   SSPFSGYGDAPTSPGFGGVASPGFSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSY
FT                   SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT
FT                   SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
FT                   YSPTSPSYSPTSPSYSPGSPSYSPGSPKKENDNDNNNNNNNNN"
FT   gene            complement(<188834..>189946)
FT                   /locus_tag="KLTH0H02068g"
FT                   /old_locus_tag="KLTH-ORF2036"
FT   CDS_pept        complement(188834..189946)
FT                   /locus_tag="KLTH0H02068g"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2036"
FT                   /product="KLTH0H02068p"
FT                   /note="similar to uniprot|P53691 Saccharomyces cerevisiae
FT                   YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
FT                   (cyclophilin) catalyzes the cis-trans isomerization of
FT                   peptide bonds N-terminal to proline residues binds to
FT                   Hsp82p and contributes to chaperone activity"
FT                   /db_xref="GOA:C5E246"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniProtKB/TrEMBL:C5E246"
FT                   /protein_id="CAR30107.1"
FT                   /translation="MSRSKVFFDISIGGIPKGRMVFELYNDVVPKTAENFYKLCEGKSG
FT                   NCKSKPEIPLCYKGSIFHRIIKGFMCQFGDFTNFNGTGGESIYGEKFEDENFTMKHDKP
FT                   FLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGELIQGKRIARAIESQATDSADKPL
FT                   SDVKVDDCGVLPADYVVPEDAEKTPTDEFGDNYDDSLADDSKVDLENVDSVLKAVSAVK
FT                   DIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDISRVDQLRISIFLNIALCAIK
FT                   TGDYQKALTSTTEVVHDAAADDKSKAKALYRRGLAYYHLKDPEMAITDLEFATTYQQND
FT                   AAILKAISDAKKLKKEQVAKQKKSLSKMFS"
FT   gene            complement(<190131..>190814)
FT                   /locus_tag="KLTH0H02090g"
FT                   /old_locus_tag="KLTH-ORF2033"
FT   CDS_pept        complement(190131..190814)
FT                   /locus_tag="KLTH0H02090g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2033"
FT                   /product="KLTH0H02090p"
FT                   /note="some similarities with uniprot|Q12334 Saccharomyces
FT                   cerevisiae YDL139C SCM3 Suppressor of chromosome
FT                   missegregation"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniProtKB/TrEMBL:C5E247"
FT                   /protein_id="CAR30108.1"
FT                   /translation="MIRRYIAALKEEVGDESTNNCMSGVNKKRDKRKVLKNLKGALKGL
FT                   LAADNGSASARPSAEVALTKPSTSEEPKRATPPRSLHTPHVPEQMSQSPKLSKQEPPSS
FT                   DKVVYIMSKESHLIPKLTDEQVMSRHKQADENMKRVWAHLIEKYGSLEDQGDVLDLATG
FT                   EIIEDNGHVRGLGTQTTDNNERYVSVLSDLLDIDTTTDNVWDMSSETEEEASEEAGEPP
FT                   LSPET"
FT   gene            complement(<190872..>191120)
FT                   /locus_tag="KLTH0H02112g"
FT                   /old_locus_tag="KLTH-ORF2031"
FT   CDS_pept        complement(190872..191120)
FT                   /locus_tag="KLTH0H02112g"
FT                   /gene_family="HOG000093840" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2031"
FT                   /product="KLTH0H02112p"
FT                   /note="similar to uniprot|Q05809 Saccharomyces cerevisiae
FT                   YLR218C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5E248"
FT                   /protein_id="CAR30109.1"
FT                   /translation="MAQKEDSKYYKEALEEYKELCNDEEDVWDKRINDTGCYVENMALQ
FT                   LCHADTNDWRQCLGEMALFRKCWDQKGNRERVSTVDK"
FT   gene            <191540..>195439
FT                   /locus_tag="KLTH0H02134g"
FT                   /old_locus_tag="KLTH-ORF2030"
FT   CDS_pept        191540..195439
FT                   /locus_tag="KLTH0H02134g"
FT                   /gene_family="HOG000048339" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2030"
FT                   /product="KLTH0H02134p"
FT                   /note="similar to uniprot|P38968 Saccharomyces cerevisiae
FT                   YDL195W SEC31 involved in protein transport from
FT                   endoplasmic reticulum to Golgi Component (p150) of COPII
FT                   coat of secretory pathway vesicles"
FT                   /db_xref="GOA:C5E249"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="InterPro:IPR009917"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR021614"
FT                   /db_xref="UniProtKB/TrEMBL:C5E249"
FT                   /protein_id="CAR30110.1"
FT                   /translation="MVKLAEYPRTATFAWSYDRSPLLATGTASGTIDADFSSESTLEIW
FT                   SLLSPHEATPQASITADAKFNDLDWSHDNAIIAGALENGVVEFFAPEEPRSVAKLAQHT
FT                   TPVKTVTFNARQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWN
FT                   QNQAHVFASAGSSGYASIWDLKAKKEVIHLSYASPVTGQRNQLSIVEWHPNNSTRIATA
FT                   SGNDSDPSILIWDLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRDNVCVLWNP
FT                   EEGQSLTQYPTRGNWCFKTKFAPQTPDLFASASFDNKIEVQTLQNVTCSLDTDATATKQ
FT                   RESETEFWNNVSVQDANEKPIVKKLQAPAWYGNKSQAAQWAFGGKLVQITSDKKGVKIS
FT                   KPAIPGAEKNVLLDKALETKDFNPIINKRLVQSIDATNEEDWNLLEKLSLDGKDAFLSE
FT                   ALAFDDEDTDETKEKDVKDDGGDFFSSLNEKFVPEGSFRLDASDKLNDLFKSLVRGDKK
FT                   SAISSALEQDLLLESLLIALDSDDQTLKQKVKNAYFTKHGKTSSLARVLHCVSEGDADD
FT                   LVKNIEVDQWKYAVKAIDSYTSDLSKKNELFIALGDRLSDAGNRQDALLLYLSAQSLDK
FT                   VASIWLKEFVGLESKLESKKETVYEAHLECLTEFVERFTVFISLISDDQHQSLANEELI
FT                   AKFLEFVNLTSSNGDFDLALKFLEILPGDNEDVVTEKQRVLIASNKLPSAATKSQKPRY
FT                   AGGNVLSGTSVAGLGLTNDRTPGGVKMPPAQPMQTVNPSAPFAPSTPFNQQTPLRSRAA
FT                   SFAAPAPELLKSNPYAPASTQATTGSKYAPPPITSPSSAPRGSSVASSVPITHKNAGTY
FT                   APAVAQPSVAGAVPPNPYAPSAGAYGNFSGQPAYSQPLKPVANVIGASAPGANSMSPPL
FT                   APPASNAASGQTPHLNKNANDGWNDLPLNVKEKPTRAKAVSVAPVSVAPSSAAPGPQVN
FT                   FGSIPPPPLSRVTSSANLQTPVPQRVPSKTYTPPNGSASPASVNPYAPPLASAAPAPVV
FT                   PSNPYAPSAVSTGQPVPGNPYAPAAAMPSNPYASPPPNGAPQPHLGKSYGPGSGLNGLS
FT                   APPASQKAPIGPPPKHMKRRTHASNDIDSANAILESVQKRSEAPTPQVGGAPPTSIPKN
FT                   QPLSEVTSSGTTPAPLAAEQGSSSGIPVEQQPIVDFLSSELGRVTPLIPQEYTKQLKDC
FT                   NKRLRILFGHLERQDLLTQPTVDKLHSIVALMKERRYADAMQVHVDIATNHAQEAGNWL
FT                   TGVKRLIGIAEVTSS"
FT   gene            <195794..>197944
FT                   /locus_tag="KLTH0H02156g"
FT                   /old_locus_tag="KLTH-ORF2021"
FT   CDS_pept        195794..197944
FT                   /locus_tag="KLTH0H02156g"
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2021"
FT                   /product="KLTH0H02156p"
FT                   /note="similar to uniprot|P10870 Saccharomyces cerevisiae
FT                   YDL194W SNF3 glucose sensor"
FT                   /db_xref="GOA:C5E250"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E250"
FT                   /protein_id="CAR30111.1"
FT                   /translation="MAKGKTLKSMHDHAGELEKRSVLDRNVREFSKKLSSLWFKRRLSD
FT                   KSPQEINMGTGIENEVTNDDGSTGSHLNFNNLESTLFLQPSRPQSSFMSILVGVFVAVG
FT                   GFLYGYDTGLINNITEMDYVKTHFASNKQQFTAKEMSILVSFLSLGTFVGALAAPFISD
FT                   TWGRKSTIIISTFLIFMVGNSLQVAANGTTLLVIGRVFSGVGVGFISAVVPLYQSEAAQ
FT                   KWVRGAIISTYQWAITWGLLVSSAVSQGTHNRQDASSYRIPIGLQFVWSCILGFGMLFL
FT                   PESPRYYVLKDQLDLAAKSLAFLRGVPEDDSGLLEELVEIKANYDYEMSFGSFSYLDCF
FT                   KSSKSRTKQKLRMFTGIAIQAFQQFSGINFIFYYGVNFFSKTGIGGSYLVSFITYAVNV
FT                   GFNIPGLFLVEYMGRRKVLIFGGILMTAANFVIAIVGCVEKSVIADKIVIAFVCLFIAS
FT                   FSATWGGCVWAISAELYPLGVRSKCTAICAASNWLVNFICALITPYLIDTGNHTSSLGT
FT                   KIFFIWGSLNAVGVVIVYVAVYETRGLTLEEIDLLYRLSPNSLASDSWNNRIRKAPGTI
FT                   QQIRNNESRFESEATTVDSHRQNQAPDLGHASQPSASGSSYEDPAPLKRAESPVHNYVD
FT                   LGNGLALTTYNRGPPSLLMDSSDDGESQIGAEGGSFSRDTDENSSSLNDYMIQWMNCQS
FT                   QRSCGSNAEKGSHNSHTQGPRT"
FT   gene            <198169..>199221
FT                   /locus_tag="KLTH0H02178g"
FT                   /old_locus_tag="KLTH-ORF2018"
FT   CDS_pept        198169..199221
FT                   /locus_tag="KLTH0H02178g"
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2018"
FT                   /product="KLTH0H02178p"
FT                   /note="similar to uniprot|Q12063 Saccharomyces cerevisiae
FT                   YDL193W NUS1"
FT                   /db_xref="GOA:C5E251"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniProtKB/TrEMBL:C5E251"
FT                   /protein_id="CAR30112.1"
FT                   /translation="MSKIKERVLRAQDDECKTSHRDKQRVSVVTNATRKSGKPGVTDVK
FT                   GAVGSVLLTPPDSEAVRRKLESQKGVLGKSSGKIEFIFYKILLCVLYMLYACARYTQYH
FT                   YNRAKILILNLAYSPSNTPQLIRQDVLKLQKLPKRLAAIVEKKREGDVGGGVSGVLNDG
FT                   SDLVAWTISAGIKHLALYDFDGHLKRNVDEFRKSVFHKLTKYYDPSNVPKFAIRIPQWN
FT                   KVYFNAPGQEADDTTSKKVAIEISLLSNRDGRETIIELTRTMADLCAQNEMQLSDITMK
FT                   LIDSELTQLVGHEPDLLLYFGPNLDLQGFPPWHIRLTEFYWEQDNDQVTYSVFIRGLKK
FT                   YAACKINVGK"
FT   gene            <199831..>200376
FT                   /locus_tag="KLTH0H02200g"
FT                   /old_locus_tag="KLTH-ORF2016"
FT   CDS_pept        199831..200376
FT                   /locus_tag="KLTH0H02200g"
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2016"
FT                   /product="KLTH0H02200p"
FT                   /note="highly similar to uniprot|P11076 Saccharomyces
FT                   cerevisiae YDL192W ARF1 ADP-ribosylation factor GTPase of
FT                   the Ras superfamily involved in regulation of coated
FT                   formation vesicles in intracellular trafficking within the
FT                   Golgi functionally interchangeable with Arf2p"
FT                   /db_xref="GOA:C5E252"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:C5E252"
FT                   /protein_id="CAR30113.1"
FT                   /translation="MGLYISKLFNSLVGSKEMRILMVGLDGAGKTTVLYKLKLGEVVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAR
FT                   EVLQRMLNEDEIRNAALLVFANKQDLPEAMSAAEITEKLGLHSIRQRPWFIQATCATSG
FT                   EGLYEGLEWLSNSLKNQN"
FT   gene            <201281..>201826
FT                   /locus_tag="KLTH0H02222g"
FT                   /old_locus_tag="KLTH-ORF2014"
FT   CDS_pept        201281..201826
FT                   /locus_tag="KLTH0H02222g"
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2014"
FT                   /product="KLTH0H02222p"
FT                   /note="highly similar to uniprot|P19146 Saccharomyces
FT                   cerevisiae YDL137W ARF2 ADP-ribosylation factor GTPase of
FT                   the Ras superfamily involved in regulation of coated
FT                   formation vesicles in intracellular trafficking within the
FT                   Golgi functionally interchangeable with Arf1p"
FT                   /db_xref="GOA:C5E253"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:C5E253"
FT                   /protein_id="CAR30114.1"
FT                   /translation="MGTSFSKLFSSLFGHKEMRILMVGLDGAGKTTVLYKLKLGEVVTT
FT                   IPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFRNTEGIIFVVDSNDRSRISEAR
FT                   EVLQRMLNEDEIRNAVLLVFANKQDLPEAMSAAEITEKLGLHSIRQRPWFIQATCATSG
FT                   EGLYEGLEWLSNNLKNQS"
FT   gene            <203853..>204632
FT                   /locus_tag="KLTH0H02244g"
FT                   /old_locus_tag="Klth0H.mRNA.311.p"
FT   CDS_pept        join(203853..203855,204273..204632)
FT                   /locus_tag="KLTH0H02244g"
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.311.p"
FT                   /product="KLTH0H02244p"
FT                   /note="highly similar to uniprot|P39741 Saccharomyces
FT                   cerevisiae YDL191W RPL35A and YDL136W RPL35B, proteins
FT                   component of the large (60S) ribosomal subunit"
FT                   /db_xref="GOA:C5E254"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniProtKB/TrEMBL:C5E254"
FT                   /protein_id="CAR30115.1"
FT                   /translation="MAGIKAYELRTKSKEQLESQLLDLKKELAALKVQKLSRPSLPKIH
FT                   TVRKDIARVLTIVNENQRNAVKELYKGAKYQPKDMRAKKTRALRRALTKFEASRTTEKQ
FT                   RKKQIAFPQRKFAIKA"
FT   gene            complement(<204726..>207569)
FT                   /locus_tag="KLTH0H02266g"
FT                   /old_locus_tag="KLTH-ORF2003"
FT   CDS_pept        complement(204726..207569)
FT                   /locus_tag="KLTH0H02266g"
FT                   /gene_family="HOG000248797" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2003"
FT                   /product="KLTH0H02266p"
FT                   /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
FT                   YPR105C COG4 component of oligomeric Golgi complex"
FT                   /db_xref="GOA:C5E255"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="UniProtKB/TrEMBL:C5E255"
FT                   /protein_id="CAR30116.1"
FT                   /translation="MASFEDILLVTKNPADPRGYAVLPEEFEEPLDANQVDAILLYQLV
FT                   ENPNLPLQPFVYLKDCFQKVQQQKRLLKKSQQDIEALQEIDRLVVGYGLILFQVEEFSH
FT                   GDGNFLTYMKGIVARVDDYTDFLTQLINRATQEDTLMEFIENFFVTLKKYIDSLGLFNL
FT                   NDSLNFSSVLTLFELFVSFKPVAASFTKISGFFAAYNAKPNDFEKVTLLGPILTLSPLN
FT                   ASVALQNYGDNLERSQQQTNMIHESLQTQHKMVLDRLFYIVDKIIRGSVESRTDVLTYF
FT                   AQIINKNHLRRGDHAQLNKLASNAFVSNIALLLVRFSQPFLDVSYRKIDKIDVNYFNNL
FT                   NLFLDLSSETRMNSDFKEADEFYDKNKKSEDNKPNFISDCFFLTLAYLHYGIGGTLLYD
FT                   EKVSPQIKRMREEVERITRATQSGDMFARFASMQLPALEKNLQTMQSIQQTLQGFFSHK
FT                   SLQLEVFEFISGACTFLVRVIDPNHQYPHKQIKLPLIPDQVGVENVDNADYLREHAPVP
FT                   FKYYPEFVIEGIINYAQYISKYSLNPMFGNPRLHSFVEMATVILRCPELVSNPHLKGKL
FT                   VQVLSIGAMPIRDNTPGFMMGIFENNELVRENLLYALLDFYVIVEKTGSSSQFYDKFNS
FT                   RYSISIILEEIYQFSEYRRQIIWQSQSNADFFVRFVARMLNDLTFLLDEGLSSLAEVHN
FT                   IQRELENRVRGSAPTREENDQELQSKLASAERQAKSSCGLAEKSITLFNIFSKDIPSAF
FT                   CTPEIVDRLAGMLDYNLASLVGPKCRELKVKNPKKYSFDAKSLLRSLCTVYTNLADQPE
FT                   FISAVAKDGRSFNKELFDRSVHILGNKTGLVNDEFCVKLLQFARDAQDQKVAEEEADLE
FT                   MGEAPDEFLDPLMFTLMKDPVILPASRVTIDRSTIKAHLLSDSTDPFNRMPLKLEDVIP
FT                   NEELKHRIEMFRRNKRE"
FT   gene            <207932..>208915
FT                   /locus_tag="KLTH0H02288g"
FT                   /old_locus_tag="KLTH-ORF2002"
FT   CDS_pept        207932..208915
FT                   /locus_tag="KLTH0H02288g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2002"
FT                   /product="KLTH0H02288p"
FT                   /note="some similarities with uniprot|Q870H2 Saccharomyces
FT                   cerevisiae YDL189W RBS1 Protein of unknown function
FT                   identified as a high copy suppressor of psk1 psk2 mutations
FT                   that confer temperature-sensitivity for galactose
FT                   utilization proposed to bind single-stranded nucleic acids
FT                   via its R3H domain"
FT                   /db_xref="GOA:C5E256"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniProtKB/TrEMBL:C5E256"
FT                   /protein_id="CAR30117.1"
FT                   /translation="MTSNNGMAIGKLTPALVAALFERAHDKQFIIQLENSMVEFMGSPA
FT                   EAYQLEPMNSYYRLLAHHVAEYHGLGHSLSRNNDACVVVFKGETFLRDKSIVLLQNLDP
FT                   SCVTNAVDTQRSESKQSASKSMIAQETRQVYNSAGLKPLAAVSEKEGTRTPETPSTPKK
FT                   PIPIEDDSPQPHQFETSRYRFRQQSEKPRRRKNYKGSTNRTAQPVYFPPPPAFPVPYML
FT                   YNPYPMMFVPPERQFSQFAPVAPVGQYPNPNPFIYGHPAHNKVEPYGPNGSSSTFSSMR
FT                   TYKTEDSESLESLSKDASEKQEPRMSRKDSETSVGKISDKMDKLGL"
FT   gene            complement(<209037..>209639)
FT                   /locus_tag="KLTH0H02310g"
FT                   /old_locus_tag="KLTH-ORF2001"
FT   CDS_pept        complement(209037..209639)
FT                   /locus_tag="KLTH0H02310g"
FT                   /gene_family="HOG000175765" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF2001"
FT                   /product="KLTH0H02310p"
FT                   /note="highly similar to uniprot|Q12434 Saccharomyces
FT                   cerevisiae YDL135C RDI1 Rho GDP dissociation inhibitor"
FT                   /db_xref="GOA:C5E257"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C5E257"
FT                   /protein_id="CAR30118.1"
FT                   /translation="MSDDTEFKEFQDENPDRYKVSAKKTLAEYQKLDAEDESLAKWKES
FT                   LGLSSDTLPLEFPGDKRKVVIQKIQLLVDTESQPITFDLTNDQTLKELASTRHKIKEKS
FT                   IYKLKITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTTKKPFYEVELPESE
FT                   APSGFLARGSYSAISKFIDDDKTNHLTLNWGVEIVKK"
FT   gene            <209858..>210418
FT                   /locus_tag="KLTH0H02332g"
FT                   /old_locus_tag="KLTH-ORF1998"
FT   CDS_pept        209858..210418
FT                   /locus_tag="KLTH0H02332g"
FT                   /gene_family="HOG000176434" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1998"
FT                   /product="KLTH0H02332p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="UniProtKB/TrEMBL:C5E258"
FT                   /protein_id="CAR30119.1"
FT                   /translation="MSLPEFNTFKAADTDFQTAVLETLFEKSNSLIKLTLEDEQFMNAV
FT                   GSSYSEFIEKVRERLVQLCESQGQQESEESRRSELSDIIAAHPKLGEPKKGLSVHSQNE
FT                   QRNLGNGDTLEVQQALKHLNEVYEQHYPGLRFVVFVNGRSRPEIIRVMEGRINSGNAWL
FT                   EEAGLACNEMCDIANDRVLKYVQ"
FT   gene            complement(<210576..>211646)
FT                   /locus_tag="KLTH0H02354g"
FT                   /old_locus_tag="KLTH-ORF1997"
FT   CDS_pept        complement(210576..211646)
FT                   /locus_tag="KLTH0H02354g"
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1997"
FT                   /product="KLTH0H02354p"
FT                   /note="highly similar to uniprot|P23594 Saccharomyces
FT                   cerevisiae YDL134C PPH21 Catalytic subunit of protein
FT                   phosphatase 2A functionally redundant with Pph22p
FT                   methylated at C terminus forms alternate complexes with
FT                   several regulatory subunits involved in signal transduction
FT                   and regulation of mitosis"
FT                   /db_xref="GOA:C5E259"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniProtKB/TrEMBL:C5E259"
FT                   /protein_id="CAR30120.1"
FT                   /translation="MEIDSDVPMQDATEETLDPTLDEDALSKAQEGPGSSGIADHKASK
FT                   PLQLDSGNIGQLDQWIEHLGKCQVLSEDDVSRLCKMAVDVLQFEENVQPVNVPVTICGD
FT                   VHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPKRITILRG
FT                   NHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKVFCLHGGLSPMIE
FT                   TIDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGFTFGQDISEQFNHTNDL
FT                   SLIARAHQLVMEGYAWSHQQSVVTIFSAPNYCYRCGNQAAIMEMDENHNRQFLQYDPSM
FT                   RPGEPTVSRKTPDYFL"
FT   gene            <212454..>213176
FT                   /locus_tag="KLTH0H02376g"
FT                   /old_locus_tag="KLTH-ORF1994"
FT   CDS_pept        212454..213176
FT                   /locus_tag="KLTH0H02376g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1994"
FT                   /product="KLTH0H02376p"
FT                   /note="some similarities with uniprot|P48568 Saccharomyces
FT                   cerevisiae YDL186W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5E260"
FT                   /protein_id="CAR30121.1"
FT                   /translation="MSVLERPLSHNSPVFVPSPECTARAYTLPANTTGVRQLVIRKQNG
FT                   RVVAAKSQLIDRMEDALVRWRPPASCHAGSTAALKGKHPYQQELDTDVDLTSVPLHASL
FT                   DSIRHYFDNLGHTISRPCSQRPPKTEQLAGSTQSPASSPASSASGMAVQIRQSVQSAGT
FT                   RGTTPRAMAYDADPDNIEARPASYSFPIPAYYLPHTDACPVGESTRENNEEAHGCWAQW
FT                   TTFWDELCDDLAALCSCN"
FT   gene            <214364..>216220
FT                   /locus_tag="KLTH0H02398g"
FT                   /old_locus_tag="KLTH-ORF1990"
FT   CDS_pept        214364..216220
FT                   /locus_tag="KLTH0H02398g"
FT                   /gene_family="HOG000161057" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1990"
FT                   /product="KLTH0H02398p"
FT                   /note="uniprot|Q8J0L0 VMA1 Putative vacuolar membrane H-
FT                   ATPase"
FT                   /db_xref="GOA:C5E261"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005725"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="UniProtKB/TrEMBL:C5E261"
FT                   /protein_id="CAR30122.1"
FT                   /translation="MAGAMENARKEIKRLSLEDHSESEYGSIYSVSGPVIVAENMIGCA
FT                   MYELVKVGHDNLVGEVIRIEADRATIQVYEETAGVTVGDPVLRTGKPLSVELGPGLMET
FT                   IYDGIQRPLKAIKDKAQSIYIPRGIDAPALSRDIKWQFKPSADKKVGDHIAGGDIFGSI
FT                   FENSLLEDHKILLPPRARGTITWIAPAGDYTIDEKVLEVEFDGVKYDYTMYHTWPVRVP
FT                   RPVTEKLSADYPLLTGQRVLDALFPCVQGGTTCIPGAFGCGKTVISQSLSKYSNSDAII
FT                   YVGCGERGNEMAEVLMEFPELFTERNGKKEPIMKRTTLVANTSNMPVAAREASIYTGIT
FT                   LAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFPAYLGAKLASFYERAGK
FT                   AVALGSPDRIGSVSIVAAVSPAGGDFSDPVTTSTLGITQVFWGLDKKLAQRKHFPSINT
FT                   SVSYSKYTNVLDKYYDEHYPEFPQLRNRIREILSNAEELEQVVQLVGKSALSDSDKITL
FT                   DVATLIKEDFLQQNGYSTYDAFCPVWKTYDMMKAFISYHEEAQKSIANGANWAKLADAT
FT                   GDVKHAVSSSKFFEPSRGEQEVHGEFEKLFSNIQERFAESTD"
FT   gene            complement(<217847..>218743)
FT                   /locus_tag="KLTH0H02420g"
FT                   /old_locus_tag="KLTH-ORF1985"
FT   CDS_pept        complement(217847..218743)
FT                   /locus_tag="KLTH0H02420g"
FT                   /gene_family="HOG000141779" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1985"
FT                   /product="KLTH0H02420p"
FT                   /note="similar to uniprot|P48569 Saccharomyces cerevisiae
FT                   YDL183C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR018786"
FT                   /db_xref="UniProtKB/TrEMBL:C5E262"
FT                   /protein_id="CAR30123.1"
FT                   /translation="MSTAGPSGLGKRLLSQGLPPQRATVQKYVLDPVKLIAIPITNKRI
FT                   FLYHKHSSEILNMNSRIVRYETRITEKARKIWSKLEKSPREINQKLVRMVNSQLDKTPW
FT                   TEDSLNTVPSEGYILKTVMENQESRNLTYQEWFKNVDKLDVRPVCMYYPQSVMSERAVR
FT                   EQLKSLWDHGLNYHKKQMWLSILGLPLTLPVVLVPVVPNVPGFYLLYRAYRNFKAFCGA
FT                   KHLKSLVENKSHKLVFTDLPQFSDILRSETEIPEEHLVLNEKNLERVLDMLQIHELRAP
FT                   LEKAVLQERKRLDGHRK"
FT   gene            <219117..>220556
FT                   /locus_tag="KLTH0H02442g"
FT                   /old_locus_tag="KLTH-ORF1982"
FT   CDS_pept        219117..220556
FT                   /locus_tag="KLTH0H02442g"
FT                   /gene_family="HOG000093837" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1982"
FT                   /product="KLTH0H02442p"
FT                   /note="similar to uniprot|Q12516 Saccharomyces cerevisiae
FT                   YDL133W"
FT                   /db_xref="UniProtKB/TrEMBL:C5E263"
FT                   /protein_id="CAR30124.1"
FT                   /translation="MSSSRPEGETSNGEKKYSHALDAEPSDFGGQNSRVSQGHSSTASG
FT                   SDSRDQDGSRSKFLNSYGLVATTVPPFALDEQLKQQNLRQVQTHSALVAEKELGRYCKD
FT                   PFLVSHNLRWGPFAENVGSNAAYFNKATKPATGSPGFTLYEDDAGPSSSAVSTKEEEDQ
FT                   DINKTAGESSSYEEDKSVSKQTRTEAPHDVFADLNGSWGGSERLNAIFNGPLLDSDKLT
FT                   SHKDRNDWSEYLESVKAFYYTNGPLNQDLEAGLRREGSSNLDDTEENKLHTFLEKQRSD
FT                   FKETRKHWRQLERQKKQKWVPTLRKLLLDSQYLPLSFRMFIVILSAIALGLAIRIFQNS
FT                   KGELEFSGSSVPQQASTIMAICVNSIAVLYLFYIAYDEFSGKPLGLRDPVGKLRLILLD
FT                   LLFIIFSSANLALTFNTLYDKQWVCTEGKYSEDELPKMEYICRKQRALASFLFVVLFMW
FT                   VVTFTVSILRVVEKMSSGSPR"
FT   gene            <220805..>223228
FT                   /locus_tag="KLTH0H02464g"
FT                   /old_locus_tag="KLTH-ORF1981"
FT   CDS_pept        220805..223228
FT                   /locus_tag="KLTH0H02464g"
FT                   /gene_family="HOG000176713" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1981"
FT                   /product="KLTH0H02464p"
FT                   /note="similar to uniprot|Q12018 Saccharomyces cerevisiae
FT                   YDL132W CDC53 Cullin structural protein of SCF complexes
FT                   (which also contain Skp1p Cdc34p and an F-box protein)
FT                   involved in ubiquitination SCF promotes the G1-S transition
FT                   by targeting G1 cyclins and the Cln-CDK inhibitor Sic1p for
FT                   degradation"
FT                   /db_xref="GOA:C5E264"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="UniProtKB/TrEMBL:C5E264"
FT                   /protein_id="CAR30125.1"
FT                   /translation="MSDTLPRADDLEATWNFVEPGIHQILGRDGTASSTLKRVDKVLSP
FT                   AMYMEVYTAIYNYCVNKSSSAGQFNTDSSRQNQSSLLVGGEIYQKLKDCLQNYLSGLQR
FT                   DANESFLQFYVRRWKRFTVGAVFLNHAFDYMNRYWVQKERSDGKRHIFDINTLCLMTWK
FT                   EVMFDKNVDLLVKEVLEQIELQRDGHVILQTDTTVAIRSFVALGIDPQDLKKLNLNVYI
FT                   QHFEKPFLESTRQYYRKLSREYLASHSVTEYIFEAQEKIKDEETKIVLYLDEHTKKLLS
FT                   EALNSVLITDHSEALENEFISLLDSRDENKIATLNSLMQRDILLLPKLAQAYEEYVKKT
FT                   GEQEISRLLAEHRAKLSENAEENAGSKKSAAGPAVPPNEYVKKLIEVYETFIKITRDCF
FT                   QNGSLFTKALDNACRAYINANELAIPPGSPKSVTSKTPEMLAKYSDQLLKRSAKATEGA
FT                   SELSADDIMTIFKFLTDKDAFETHYRRLFARRLIHGTSTSEEDEEMVIQRLQSENSMEY
FT                   TGKITKMLQDIRLSKQLEKEFESAIKIAPDYSRAKYPEFQPFVLAETMWPFSYQDVEFN
FT                   LPQELVPTHRGLEKLYTNKHNGRVLKWLWPLCRGEVVADIGKPGKPPFIFTVTLFQMAI
FT                   LLAFNDRSTFTLEEIQEHTSLSASNIASSIIPFIRWKLIQQQPPGLDALSRMDTQFKLS
FT                   TPYKALKTRINFAAGVKSEAPGSIGGKSGEPSELQKIEKELSTERQIFLEACIVRIMKA
FT                   RRKLPHATLVNECIAQSHQRFNAKVSLIKRAIDNLIAKEYLQRCDDGESYEYLA"
FT   gene            <223641..>224963
FT                   /locus_tag="KLTH0H02486g"
FT                   /old_locus_tag="KLTH-ORF1976"
FT   CDS_pept        223641..224963
FT                   /locus_tag="KLTH0H02486g"
FT                   /gene_family="HOG000046858" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1976"
FT                   /product="KLTH0H02486p"
FT                   /note="highly similar to uniprot|Q12122 Saccharomyces
FT                   cerevisiae YDL131W LYS21 and to uniprot|P48570
FT                   Saccharomyces cerevisiae YDL182W LYS20 homocitrate
FT                   synthase"
FT                   /db_xref="GOA:C5E265"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5E265"
FT                   /protein_id="CAR30126.1"
FT                   /translation="MSNSGFQQVTESTTQVERPNPYGPNPADYLSNVANFQLIDSTLRE
FT                   GEQFANAFFTTEKKIEIAKALDDFGVDYIELTSPVASEQSRSDCEAICKLGLKAKILTH
FT                   IRCHMDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIEI
FT                   RFSSEDSFRSDLVDLLNIYKTVDSIGVNRVGIADTVGCANPRQVYELLRTLKTVVHCDV
FT                   ECHFHNDTGCAIANAYTALEGGARLIDVAVLGIGERNGITPLGGLMARMIVAAPEYVKS
FT                   KYKLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILNPHD
FT                   FGLKRYIHFANRLTGWNAIKSRVDQLNLNMSDEQCKEVTMKIKKLGDIRPLSIDDVDSI
FT                   IKDFHSEITTPQLRNMDAQGSDDLNNLDISAPAAKKAKKSQ"
FT   gene            complement(<225069..>225998)
FT                   /locus_tag="KLTH0H02508g"
FT                   /old_locus_tag="KLTH-ORF1972"
FT   CDS_pept        complement(225069..225998)
FT                   /locus_tag="KLTH0H02508g"
FT                   /gene_family="HOG000144409" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1972"
FT                   /product="KLTH0H02508p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5E266"
FT                   /protein_id="CAR30127.1"
FT                   /translation="MPSAPAPLELASAHDHAVLACRLLRAGSLALSAGLDPHLSLWDLD
FT                   SGQNYTIDSYHHGNAAITALDALGDRCAVTGSSDTRLALCDLETGQLLRGLAGHRRVVN
FT                   QVRALGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLE
FT                   PVIRAYDLRRSADHAFSSWPAAHSDAVTSLDVSASGKLCTLAFDHQIHVSDAKLEPTRE
FT                   GSRLLASATLPASANPHKFLQRCKFVRQDRFVAAQGSLFDATSGRQVLDFASQVSARAF
FT                   DVIDMDYDSRSDKLLISTEQGSLYVCQV"
FT   gene            <226577..>226873
FT                   /locus_tag="KLTH0H02530g"
FT                   /old_locus_tag="KLTH-ORF1964"
FT   CDS_pept        226577..226873
FT                   /locus_tag="KLTH0H02530g"
FT                   /gene_family="HOG000183772" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1964"
FT                   /product="KLTH0H02530p"
FT                   /note="some similarities with uniprot|P01097 Saccharomyces
FT                   cerevisiae YDL181W"
FT                   /db_xref="GOA:C5E267"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniProtKB/TrEMBL:C5E267"
FT                   /protein_id="CAR30128.1"
FT                   /translation="MLSQSARASLKKSLKLQLPAMPAMPAVGGRFYSEGSVGSPRGEGA
FT                   DDSFVRRERAQEDYFIRQHEKEQLEKLRQQVKQQQQKIEHLEGRLGDKLKEGQ"
FT   gene            <227237..>227523
FT                   /locus_tag="KLTH0H02552g"
FT                   /old_locus_tag="Klth0H.mRNA.360.p"
FT   CDS_pept        join(227237..227276,227330..227523)
FT                   /locus_tag="KLTH0H02552g"
FT                   /gene_family="HOG000093683" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.360.p"
FT                   /product="KLTH0H02552p"
FT                   /note="similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
FT                   YMR194C-B"
FT                   /db_xref="InterPro:IPR009069"
FT                   /db_xref="UniProtKB/TrEMBL:C5E268"
FT                   /protein_id="CAR30129.1"
FT                   /translation="MTDPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKFYNERG
FT                   ADARTPCCPVPSLLRLKLEQRACGPLDAKRVR"
FT   gene            complement(<227944..>228507)
FT                   /locus_tag="KLTH0H02574g"
FT                   /old_locus_tag="KLTH-ORF1957"
FT   CDS_pept        complement(227944..228507)
FT                   /locus_tag="KLTH0H02574g"
FT                   /gene_family="HOG000141900" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1957"
FT                   /product="KLTH0H02574p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E269"
FT                   /protein_id="CAR30130.1"
FT                   /translation="MLRSTRRYYSTPPTYFGSLGPRLAPATPAAPMAPFHAPREPARKP
FT                   FLELATLFSVLALSFFAVDNYRARLAAELRLEEQALKARQAQELIAKQMNAQRKKRELQ
FT                   ILNERKLVQTRQMKVALHVAMLRKQLLDVGLAPATIEDALQEFERSVRMENSISNVSGT
FT                   RLWVTDESPAKQFVPDVREYEARD"
FT   gene            complement(<228747..>229425)
FT                   /locus_tag="KLTH0H02596g"
FT                   /old_locus_tag="Klth0H.mRNA.5642.m"
FT   CDS_pept        complement(join(228747..229033,229410..229425))
FT                   /locus_tag="KLTH0H02596g"
FT                   /gene_family="HOG000155312" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.5642.m"
FT                   /product="KLTH0H02596p"
FT                   /note="highly similar to uniprot|P05745 Saccharomyces
FT                   cerevisiae YMR194W RPL36A and to uniprot|O14455
FT                   Saccharomyces cerevisiae YPL249C-A RPL36B Proteins
FT                   component of the large (60S) ribosomal subunit"
FT                   /db_xref="GOA:C5E270"
FT                   /db_xref="InterPro:IPR000509"
FT                   /db_xref="UniProtKB/TrEMBL:C5E270"
FT                   /protein_id="CAR30131.1"
FT                   /translation="MAVKSGIATGLNKGKKVTQMTPAPKISYRKGASSNRTKFVRSLVK
FT                   EVAGLAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNDIITASRRH"
FT   gene            complement(<229993..>230814)
FT                   /locus_tag="KLTH0H02618g"
FT                   /old_locus_tag="KLTH-ORF1951"
FT   CDS_pept        complement(229993..230814)
FT                   /locus_tag="KLTH0H02618g"
FT                   /gene_family="HOG000247967" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1951"
FT                   /product="KLTH0H02618p"
FT                   /note="similar to uniprot|P36525 Saccharomyces cerevisiae
FT                   YMR193W MRPL24 Mitochondrial ribosomal protein of the large
FT                   subunit"
FT                   /db_xref="GOA:C5E271"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="UniProtKB/TrEMBL:C5E271"
FT                   /protein_id="CAR30132.1"
FT                   /translation="MLEHRHGDPRASDTTQAMSVNWPRLQRGFSTIPCLFREWRLVECR
FT                   NVAKKPDYKVGDARPIFVPKARKAFPDYEFGESQIFKQSNKGLYGGSFIQYGNNVAESK
FT                   TKTRRRWLPNVIKKGLWSEALSRNVSIRMTAKVLRTVTKEGGIDNYLTKEKSARIKELG
FT                   PTGWKLRYRVLQRQELRENPPHKDAAVVRGIDGAEHTVYFEEALDGETVRVTCGRRKLL
FT                   QLLYPLEKLEHRADGETLTYKQFLDAYAGTSVRDILAALSSYGFDLKTITV"
FT   gene            complement(<230918..>233359)
FT                   /locus_tag="KLTH0H02640g"
FT                   /old_locus_tag="KLTH-ORF1944"
FT   CDS_pept        complement(230918..233359)
FT                   /locus_tag="KLTH0H02640g"
FT                   /gene_family="HOG000141899" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1944"
FT                   /product="KLTH0H02640p"
FT                   /note="weakly similar to uniprot|Q12344 Saccharomyces
FT                   cerevisiae YPL249C GYP5 GTPase-activating protein (GAP) for
FT                   yeast Rab family members Ypt1p is the preferred in vitro
FT                   substrate but also acts on Sec4p involved in ER to Golgi
FT                   trafficking interacts with the yeast amphiphysins Rvs161p
FT                   and Rvs167p"
FT                   /db_xref="GOA:C5E272"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniProtKB/TrEMBL:C5E272"
FT                   /protein_id="CAR30133.1"
FT                   /translation="MSDTQSTEVPSLKDVEAFDRNEEESGVTEEMRTEVSDAALMSPAA
FT                   EEAPANASQTESDLKPKITPATSDLTNQASLVESDLTEELQQKAPENADHSPQTLDSEQ
FT                   QDDSDRSSAHSELNFAAYEEDTGEDYNAETTNPSAINDDSGVGDEDQNHDLIHSSPEKL
FT                   DGPDHTVKQVDQETAPPPLLPDGSGARPLPALPPRSLNTSSPPLPPRGSAALPASTLKK
FT                   SQVHPVPPPLSEELKSEKFRKNAALTHAQPSPPSLPPRSGHKRSASADFDLVISRFNDY
FT                   EEEYLSKDGVTQESLQEGTRMLKSSYTAFLETISAEKEPSQDPEEHRELVEIDWPFWTR
FT                   LVNNYAEVAKKDSVKLEQEITGGIPPQIRGIIWQLMANTKSKGVEEIYGALEACESPHE
FT                   KAIQRDILRTNYIPDDKTDSLFNVLKAYSIYDDAVGYTQGMGFITTALILNVESEAEAF
FT                   GLLISLMKGYGLRDLFLPGMPGLHVKLYQFDRLLEENSPSLYYHLARQGVRSSMYASQW
FT                   FLTCFAYRFPLCFVLRIFDIILVEGVDAILKFAVVLMIRNEKTLLALQFDQLLEFLKDG
FT                   LFAYYLKDSVKERRRAKATKGDSGSTVSLLSRAIPKKESSPEITDEDYDIDAFVEDAMK
FT                   EVQITPITLKRYVAEYEEIHLLESQKEAQFEALRIKNKQLHNEVRKLEHDHTILNREHI
FT                   SIANELIENRLAMETLQDENRDLVAEVAHLKTQLKEEVRKRSLPNPDAELPTDLKADLQ
FT                   ETMARNLQVMSENQELQDKIAQLEQEVALLRQSPSHRCEPGAGQKPANLGNWKGLRKVW
FT                   K"
FT   gene            complement(<233610..>234716)
FT                   /locus_tag="KLTH0H02662g"
FT                   /old_locus_tag="KLTH-ORF1942"
FT   CDS_pept        complement(233610..234716)
FT                   /locus_tag="KLTH0H02662g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1942"
FT                   /product="KLTH0H02662p"
FT                   /note="weakly similar to uniprot|P42933 Saccharomyces
FT                   cerevisiae YMR191W SPG5 Protein required for survival at
FT                   high temperature during stationary phase not required for
FT                   growth on nonfermentable carbon sources"
FT                   /db_xref="UniProtKB/TrEMBL:C5E273"
FT                   /protein_id="CAR30134.1"
FT                   /translation="MSANSWRQWLKLTKRQLKQIRQTLDDEIQTVLERNIPRPQKSLVR
FT                   IPVSTRPSAGFRNGSRYIHTQTQNVARGTGNAQSVGYARSVQGGARGTRPVLSSFNGMY
FT                   RAPGGVPRGLFSNWNMTTSRFKSGRAYSTSAIKITHDAVQNLSISLRCFYNLWDDFLPA
FT                   NESADCQRVPLQACQAPKRSLGAREVSTVRAMEVFRMIQAHKQDLPPSILEELDAMGCV
FT                   VQFELPHLDMSTMPSMVFASDEALNEWRDKMVACHAKLRHIEESVRKIYEHYGALPLEF
FT                   GESFVRVRFPNITAPEAEILMRDLGLTLGLVLPEPQPSTEPSSSPECFEYCSNFSASYC
FT                   GSSRCASQFAPVLSTPSESSFSVLSSQG"
FT   gene            complement(<235527..>237776)
FT                   /locus_tag="KLTH0H02684g"
FT                   /old_locus_tag="KLTH-ORF1938"
FT   CDS_pept        complement(235527..237776)
FT                   /locus_tag="KLTH0H02684g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1938"
FT                   /product="KLTH0H02684p"
FT                   /note="weakly similar to uniprot|P04386 Saccharomyces
FT                   cerevisiae YPL248C GAL4 DNA-binding transcription factor
FT                   required for the activation of the GAL genes in response to
FT                   galactose repressed by Gal80p and activated by Gal3p"
FT                   /db_xref="GOA:C5E274"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR005600"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniProtKB/TrEMBL:C5E274"
FT                   /protein_id="CAR30135.1"
FT                   /translation="MFSLDEAEQACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKV
FT                   RSPLTRAHLTEVENRLHQLERLFGTLFPGYDWKDTSKDPSLSKLRHMLKNQKDQYERTL
FT                   PITTDNLHAPSNVPSHPSQRPPLDQLPRDPLFGFEWSEEEDSQFLQNDGMGVLNVNINN
FT                   KGYFGVGSNSVLLRALYVVDSLFTIQRVPSSSEDLSILSSKQIMDEYVEAYFGQFHAAF
FT                   PIVDESYFRLCYAKKIIPTSEKAWQTLLYAVLALGSWSVVGEDSNIDIEYYKSAKYHLC
FT                   SSVFETGSHSLLASLVLLSNYTQKRNKPNTSWNYLGLAASMAISLGLHREMRDSARTDN
FT                   SGLEIRRRMWWVLYGYDCSMAMTFGRPGQLPKLPDVDILLPSNLDKNGVEVDSPTEFSF
FT                   IIETAKLTKNAHKIISSSTGPYANLAETLKCHQKLDDLANKLPDYFSTGFARWHQKLGA
FT                   DNKWFPLNRFRLRWMYYNLTITIFRPLFLGILNGEKVRVDNHDFTKCLNLCHEAAGSTI
FT                   ESVSEFVSHYKLTTLSAWYATFFLVSATIIPAVGLVTEPGSSQAARWKLRVTTARNTFD
FT                   VLKEKNATAEKFIHVIDSVCGYLLDTSEALSSTPKSFSSILHTEKRPGVAGTSSQQPTK
FT                   DKSMTSISDLANILSPRDFTIPTDTVRSGSSETPDIAVQPENQDEDPFAWRSSSAQPLK
FT                   QDATVFPNWNDQSVQTLFNPGTSNMFNTTTMDDIFNYVFNDNELAPSISNSSNQS"
FT   gene            <238367..>242578
FT                   /locus_tag="KLTH0H02706g"
FT                   /old_locus_tag="KLTH-ORF1933"
FT   CDS_pept        238367..242578
FT                   /locus_tag="KLTH0H02706g"
FT                   /gene_family="HOG000141897" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1933"
FT                   /product="KLTH0H02706p"
FT                   /note="similar to uniprot|P35187 Saccharomyces cerevisiae
FT                   YMR190C SGS1 Nucleolar DNA helicase of the RecQ family,
FT                   involved in maintenance of genome integrity"
FT                   /db_xref="GOA:C5E275"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR015906"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR022758"
FT                   /db_xref="UniProtKB/TrEMBL:C5E275"
FT                   /protein_id="CAR30136.1"
FT                   /translation="MQDNLRAQINWLKKEKAYQPKNEFLLRLLSSDVGGKKQKSQNGSE
FT                   AQSQPEMSVIDLTADSRTIKASSDLGSSARVWNASAVFSTIEGNSTQRPGISYSNPAVT
FT                   SRFGRTSESTQHSQKPASLPATSYVESGSLSANHISDQSSDAVRRTPNRQASLAELVPL
FT                   QDRVIELLKKQTGLLMHKCSIIESTSLSEDAKRVKIQSEVNPSLSTLESEIRTAGSLVE
FT                   AMKSEASHPVARTVGNLATTITHTPAISTVSIRTVANNSILRPPPRPQAPVVGVPQDLI
FT                   TVLDDDDDDDDDDVDVDGEEEPRVIAKVHTSAIGTEDRSSNPAKRSLRPHKEINYRIPE
FT                   LEDSLNYNMKPALAQSRQEDNAEEDTTMEAELEDSQFLLTAEEEHDEIHTSDHDFVADG
FT                   LENLLDETDDGEYHEAVSNADGINSSQGGTFPEGPTQGSTFAGELSNIEVIGSSPVRQI
FT                   SEHQEYSRPKTPELDLVGTGYADDPEFDPIVDSIQQTFPNSYAHRSPVTGSITDNNIGR
FT                   NQALQNSIDDTFTHSDSDDFEDFDAERENLTQKSGIRKLDDDLKIISEQKLDVSNARPS
FT                   NIKQEVINVESLLDEGVENFQGGALSLSSIGAAGHGNTGPQFEWTAEVYHRLHNVFKLP
FT                   GFRPNQLEAINASLEGKDVFVLMPTGGGKSLCYQLPAVVRSGKTSGTTVVISPLISLMQ
FT                   DQVEHLLAKNIKACMFSSKGTADQKRQTFNLFINGLLDLIYISPEMISASEQCKKAIGK
FT                   LYRDKKLARIVVDEAHCVSNWGHDFRPDYKELKYFKREYPDIPMIALTATASEQVRLDI
FT                   VHNLQLNNPVFLKQSFNRTNLYYEVLKKSKNVVFDICNAVKTRFKNQTGIIYCHSKNSC
FT                   EQTASLLQRNGINSAYYHAGMEPDERLEVQQAWQANRIRIICATVAFGMGIDKPDVRFV
FT                   YHLTIPRTLEGYYQETGRAGRDGKFSFCIMYYTFRDVRTMQTMIQKDKNLDRENKEKHL
FT                   TKLQQVMQYCENLADCRRQLVLSYFNENFDSALCRRNCDNCKNSINTTTEERDVTHEAL
FT                   NIVKLVSSVQGDKVTLIHCQDIYKGSRNSKIVQAGHDQLEYHGMGKALPKSDIERVFFR
FT                   LVTTQILQEYTVMNGRGFASNYLKVGPKATQLLNGNLKIVMQFAAAGESGSRQSSVPPA
FT                   PATRAASTEFRKGHTNARQTTSSGSLARKTSSLIPDLGGFVYDDNGAGASSAPKKVSRP
FT                   IVLGDKTNLLSHQEQLSVTSAYQELKERAISTARELRFNGFMSVISETALRKAAVVLPS
FT                   TEQQFRQLPGLTSTQAQHYHFFKDLFVRLNVLRKSLPKDSSQRLSQTQTTSPFFHGPGA
FT                   SENNEERERDEEILRQIRDSQAPSRTSAVGKAPGTKPAGSQSKARRGRKSKWHSKSWSK
FT                   R"
FT   gene            complement(<242682..>244436)
FT                   /locus_tag="KLTH0H02728g"
FT                   /old_locus_tag="KLTH-ORF1929"
FT   CDS_pept        complement(242682..244436)
FT                   /locus_tag="KLTH0H02728g"
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1929"
FT                   /product="KLTH0H02728p"
FT                   /note="similar to uniprot|P39709 Saccharomyces cerevisiae
FT                   YAL067C SEO1 Putative permease member of the allantoate
FT                   transporter subfamily of the major facilitator superfamily
FT                   mutation confers resistance to ethionine sulfoxide"
FT                   /db_xref="GOA:C5E276"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniProtKB/TrEMBL:C5E276"
FT                   /protein_id="CAR30137.1"
FT                   /translation="MEVVKTSLTNFSKEWVVEPYARLKWGFIPVRRIVDENEVESEEEH
FT                   SEQVVEEAFSDKQVSDDRKTELEVEQKSSVSNSGGAGEMEYRDEANRKWWSFFNEQEYR
FT                   MPQKRANSAKWWQWFGSDVPAQEKKLLLKLDILLAFYSCMAYWVKYLDTANLNNAYVSG
FT                   LKEELNFKGNELVETQAMYTVGNIVFQLPFIFFLDKVPLNYVLPALDLCWSILTIGASQ
FT                   VDSVPHLKAIRFFIGVFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYAGILSASGI
FT                   QSAIYAAMDGKHGLSGWRWNFIVDGLISVVVGLIGFYSLPGDPHNCYSIFLTDDEIRLA
FT                   RKRLRENNTDKSDFSSKVLDKAVWKRIFTNWRIYVLTLWNIFCWNNNNGTSGAYLLWVK
FT                   SLKKYSVAKVNQLGMITPALGMVYLFGTGVFADKLHSRWGAIIVTQIFNFIGNVILAVW
FT                   AVPESAKWFAFMLQYFGWAMAPVLYSWQNDICRRDSQARAITLVVMNMLAQTTTAFMSV
FT                   LVWKTTEAPRYLKGYTWTAVCAFCLSAWTILVLWLYKRDEKQHAEENGIIIYNSKTGEN
FT                   YPPEKQNA"
FT   gene            complement(<245136..>248195)
FT                   /locus_tag="KLTH0H02750g"
FT                   /old_locus_tag="KLTH-ORF1923"
FT   CDS_pept        complement(245136..248195)
FT                   /locus_tag="KLTH0H02750g"
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1923"
FT                   /product="KLTH0H02750p"
FT                   /note="highly similar to uniprot|P49095 Saccharomyces
FT                   cerevisiae YMR189W GCV2 P subunit of the mitochondrial
FT                   glycine decarboxylase complex required for the catabolism
FT                   of glycine to 5 10-methylene-THF expression is regulated by
FT                   levels of levels of 5 10-methylene-THF in the cytoplasm"
FT                   /db_xref="GOA:C5E277"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:C5E277"
FT                   /protein_id="CAR30138.1"
FT                   /translation="MLRSRLLTSTKFIARSLHSGRPSLYAASVANVSSNQYAKIYKPAA
FT                   RSLEPLDTFQRRHLGPNPDNVQDMLKTMGYEDLDKFIETLVPPQVLERRPLQLEAPQKG
FT                   FSEQEMLQHLQEIANKNKFQARNFIGKGYYGTVLPPVIQRNLLECPEWYTSYTPYQPEI
FT                   SQGRLESLLNFQTVVSDLTGLPVANASLLDEGTAAGEAMLLSFNTAKRKKSKFIVDKRL
FT                   HPQTKSVLKTRATPFNIELVEVDPLEVEANKTILADKAVFGGLIQYPATDGTIIPGEIV
FT                   KSIAESLHANKALLSVASDLMALTLLKPPSEFGADIALGSSQRFGVPFGYGGPHAAFFA
FT                   VTEKLNRKIPGRIVGVSKDRLGSPALRLALQTREQHIKRDKATSNICTAQALLANIAAN
FT                   YCVYHGPQGLKDIAGRIYGFTTVLANKISAETPHTVVNNTWFDTLTIKLAEGTSSERLL
FT                   KAAYEKYSINLFGVDENTVSVSLDETVTRKDLLNLLQVFGASEELPELLPEFPEELSRT
FT                   DSILSNEVFNQHHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKLNSTVEMMPVTWPQ
FT                   FANMHPFQPVEQAEGYLELIKSLEADLADITGFDNVSLQPNSGASGEYAGLRVIKSYLE
FT                   AQGQSHRNVCLIPISAHGTNPASAAMCGMKVVPVNCLSDGALDLQDLEAKAEKHKDDLA
FT                   AMMITYPSTYGLFGPGIRAAIDAVHKHGGQVYLDGANMNAQVGLTSPGDLGADVCHLNL
FT                   HKTFAIPHGGGGPGVGPICVKSHLGPFLPGHDLVNIATGAPSDLRISAVASAPYGSASI
FT                   LPISYAYIKMMGSTGLPFSSVVAILNANYMMSRLKPHYSILFAGDNSTTKHCGHEFIVD
FT                   LREFKAAGVEAIDVAKRLQDYGFHAPTLAFPVPGTLMVEPTESENLQELDRFVDALIAI
FT                   RREIDLYAAGDPKGAVLKNAPHSLTDLVCSTDWDARGYSREFAAFPLPFLKHNKFWPPV
FT                   ARLDDTYGDLNLICTCPSVEDVANDNAEHD"
FT   gene            complement(<248747..>250009)
FT                   /locus_tag="KLTH0H02772g"
FT                   /old_locus_tag="KLTH-ORF1917"
FT   CDS_pept        complement(248747..250009)
FT                   /locus_tag="KLTH0H02772g"
FT                   /gene_family="HOG000260968" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1917"
FT                   /product="KLTH0H02772p"
FT                   /note="similar to uniprot|Q12523 Saccharomyces cerevisiae
FT                   YPL247C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniProtKB/TrEMBL:C5E278"
FT                   /protein_id="CAR30139.1"
FT                   /translation="MDTYKAGKRSSISFGSYQRPVVSFNQNELPYYAPRQLYSAQQSAQ
FT                   QPDVVYPCRYEAHFPLYAMDWSNEDYVAVGSYKEDTFNKLQILHSSDLVSWEKAGEENC
FT                   VFPISRVQWCPNGNSQQLATCSDSLRLWDYSDFVLQERLNLSFCRYNKSGGQGTVAALG
FT                   QLPPVSSFHWNAVDPNLIISSSIDTTCTVWDLQATNYVKTQLIAHDSEVFDVKFLTQST
FT                   QLFASCGGDGSVRVFDLRSLAHSTIIYEPSSQPTAGSSGDSSAASGGSGSGSNSASSGS
FT                   NALLRLEPSPFDPNVVATFAHDSNSVLILDMRYPGAAILTLEGHVGAVNQIQWHPSRHN
FT                   VLLTCGDDCQALLWDLNTHLSTPASNTVSSKWNSSKVARCIDTPQEAYSDANYEINNIV
FT                   WRPQGNWFGCNLGRHFQSVRV"
FT   gene            <250363..>251052
FT                   /locus_tag="KLTH0H02794g"
FT                   /old_locus_tag="KLTH-ORF1912"
FT   CDS_pept        250363..251052
FT                   /locus_tag="KLTH0H02794g"
FT                   /gene_family="HOG000248070" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1912"
FT                   /product="KLTH0H02794p"
FT                   /note="similar to uniprot|Q03246 Saccharomyces cerevisiae
FT                   YMR188C MRPS17 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="GOA:C5E279"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C5E279"
FT                   /protein_id="CAR30140.1"
FT                   /translation="MARQNFVGLVVSQGKMQKTVKVRVETKVFNKRINKELFHRKDYLV
FT                   HDEQGVSREGDLVRIEATRPLSRRKFFSVAEILKNKGQQFALFESQAKTQVMQEEAQKT
FT                   RDFLDRRRAHEADESVLLADVRTIQQALAQGQDAEELSEIKARYGIEHFTPDTLKQLLQ
FT                   LDVLALEQSVVAQKSKIDTVQARVSELLQNEQDGDLLLRQYGVEDPQMLKSNIKKNLLR
FT                   KYVMQEL"
FT   gene            complement(<251152..>252086)
FT                   /locus_tag="KLTH0H02816g"
FT                   /old_locus_tag="KLTH.mRNA.272AT.m"
FT   CDS_pept        complement(join(251152..251795,251876..252086))
FT                   /locus_tag="KLTH0H02816g"
FT                   /gene_family="HOG000111157" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH.mRNA.272AT.m"
FT                   /product="KLTH0H02816p"
FT                   /note="similar to uniprot|Q12270 Saccharomyces cerevisiae
FT                   YPL246C RBD2 Possible rhomboid protease, has similarity to
FT                   eukaryotic rhomboid proteases including Pcp1p"
FT                   /db_xref="GOA:C5E280"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="UniProtKB/TrEMBL:C5E280"
FT                   /protein_id="CAR30141.1"
FT                   /translation="MNFRKFIIDKFTKAAMSTMNSLNLSLPDGKPPAALTTGLVIFMSL
FT                   IYLLSLVVDINGHISLKPNALFKLDLNRLSLYPLGHLSLTHLVLNSLSLFGPLTMFERS
FT                   HGTVHTGVVLNLLAVFTAIVYCLMGSLFFSKTEVLGSSGWCFSLFAYFSFKEATIRPQQ
FT                   RIFHSFSAPTKYMPVLILVLVTIFFPGSSFWGHFIGMGMGYVLAWKENFVGKLVPPSSL
FT                   IQKIESKLDSAIAMIPLGVKFYKEEAANREESYKSLFGDESVLPLHNQTSTNFQGEGRP
FT                   LGN"
FT   gene            <253022..>254389
FT                   /locus_tag="KLTH0H02838g"
FT                   /old_locus_tag="KLTH-ORF1908"
FT   CDS_pept        253022..254389
FT                   /locus_tag="KLTH0H02838g"
FT                   /gene_family="HOG000288797" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1908"
FT                   /product="KLTH0H02838p"
FT                   /note="similar to uniprot|Q12179 Saccharomyces cerevisiae
FT                   YPL245W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR018647"
FT                   /db_xref="UniProtKB/TrEMBL:C5E281"
FT                   /protein_id="CAR30142.1"
FT                   /translation="MNLKGCLRRTVFDEALANMTRTYKKPKVNDNRTQLEHDAIDKLSH
FT                   VKLSSEQAQLKTEVLQFVRDQLKRWESSKDGPAMLVIQGDAGTGKSVVLNSLFNELQRL
FT                   ACPSDAARDELTGTKNYLVVNHPEMLKLYHRISKNFPYIAKSSLERPTSLINKLEKSKS
FT                   IADVIVVDEAHLLSTSKDAFKRFYGENHLQSLMALGKVLVVVYDDKQSLRMGSYWEEST
FT                   NDGSSLAHFYEQLPEGHKQWRYLKQQFRVVAEPDVLEWIEQLSTKGKILPFPKSTTNGT
FT                   STFDLKIWEDCGAMYSKLKELNEEYGQCRMLATYDFPYRLDGKDYFVTCGDNFKLRWDR
FT                   YMPKSILPWSERPSSIDEVGSVYTVQGFDLNYAGVILGRSVGYDASNDCIKLMPEFYDD
FT                   HAGFTKKKNIKNADQVKLKIIMNSINVLMTRGVKGLYLYAYDPELRQRLLRCSGSA"
FT   gene            complement(<254461..>255453)
FT                   /locus_tag="KLTH0H02860g"
FT                   /old_locus_tag="KLTH-ORF1907"
FT   CDS_pept        complement(254461..255453)
FT                   /locus_tag="KLTH0H02860g"
FT                   /gene_family="HOG000091197" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1907"
FT                   /product="KLTH0H02860p"
FT                   /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
FT                   YPL244C HUT1 Protein with a role in UDP- galactose
FT                   transport to the Golgi lumen"
FT                   /db_xref="GOA:C5E282"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:C5E282"
FT                   /protein_id="CAR30143.1"
FT                   /translation="MGSQILLAVCVLGIYATFLTWSLVYEPLTTKVWPNSAEKFHVPCV
FT                   VSLVQASVAAFTGYAYLRREKTGYRTKEFMKDNYKDLLLISFTQSTSSPLATYSLQYVD
FT                   FLTYMLAKSCKLIPILAVHLLLYHTKITNNKKAVAIAVTFGVTLFNLGSAKRSSSTRGQ
FT                   NVSYVNGFAPLVLSLLLDGFTNATQDTLLKRNRTSNKKPITGGHLMLGLNMCIVFWNFF
FT                   YLLLIDPEQALKAKNMITEDPEIAYYLLTYAACGALGQICIFYTLQEYGSLVLVMVTVT
FT                   RKMFSMILSILVYGHHVTRMQWLGISIVFGGITAEALLKRRGASKLKTQ"
FT   gene            <255761..>257518
FT                   /locus_tag="KLTH0H02882g"
FT                   /old_locus_tag="KLTH-ORF1904"
FT   CDS_pept        255761..257518
FT                   /locus_tag="KLTH0H02882g"
FT                   /gene_family="HOG000141896" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1904"
FT                   /product="KLTH0H02882p"
FT                   /note="similar to uniprot|P38687 Saccharomyces cerevisiae
FT                   YPL243W SRP68 Component of the signal recognition particle
FT                   (SRP) ribonucleoprotein (RNP) complex that functions in
FT                   protein targeting to the endoplasmic reticulum (ER)
FT                   membrane"
FT                   /db_xref="UniProtKB/TrEMBL:C5E283"
FT                   /protein_id="CAR30144.1"
FT                   /translation="MSYYSPLGATFGVRIDRFLETAEDFDKYHQKLNRKLQKLRHHCRL
FT                   TTKDTKRYSTKEKYSKITSDDYDKNKLFGTLMLLHAERDLALVESLKLKARLRGAMKKS
FT                   EKKVVMTRLRKACKTSEQLTVLTQNEGDDFTRAEYAIYHKLCIVSYFSMCKPSKTRYTN
FT                   KIAKELSLAIASLHYLQSKEKVSDEVASSIISQFEYLLRQHADAEVFTTSEVRNFIAKQ
FT                   VRQSSDDVLVQLITRSGYEAPIEDSVMGSEKSNLKEVQWRRFSAKVRDSKVAELISEAT
FT                   QIEPTDLAQFSNKLAKWQEAADAHSVFIAQKERDDEDEDVGEDDQILLTYIKYNSHFTT
FT                   IQRDDIVFQKLWAQWSKSANKSKNLKLTKFKEIERIVHNLATYLQEVMDLPGVYSDDAL
FT                   MANLKLATTYYQLHLTAGCLASFYQSKQKYLEALALYIDGHKTLEVAAGEAVLQEPLPG
FT                   NILTPEKVAALEDFIKVSWRGVISLAEYEKIASPGGKPSLEPSLIEKLGNPIVPRDVSL
FT                   TNLFPTRPIVRPVGSKPTLFDLAFNYIGSDSQTPQNEPLIPEESRSVPKSNDAQEAPKK
FT                   KGLFGLFGL"
FT   gene            <257821..>259587
FT                   /locus_tag="KLTH0H02904g"
FT                   /old_locus_tag="KLTH-ORF1901"
FT   CDS_pept        257821..259587
FT                   /locus_tag="KLTH0H02904g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1901"
FT                   /product="KLTH0H02904p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:C5E284"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniProtKB/TrEMBL:C5E284"
FT                   /protein_id="CAR30145.1"
FT                   /translation="MAEEQNKCWICLCSGDEYPPMGNSKDAHDWVHPCQCSLTAHRKCL
FT                   LEWVSRTNLDYRNEALNEFNGRRTNIGFESLNIADTYSSLHGRAQFHPFAWLRARSSFT
FT                   NNSSSRAPFDPGDISRIFAAHAEEAVIRNVTQAMAAGARESQPMASVPSSSRKLVINTV
FT                   CPQCHAPILLKTSRGVTVSLSSSVSHLLDWSAKTLIQVTAIGTLGSSILFSFGGILASW
FT                   GLRIMTTVAPESTLLKLLDLNSASTLSQAFQKNQIGFKQILLLGFAPLYLISFRCGNAF
FT                   LGWLKWFYPLAFLRPEEKLQSSVKRFLILQYPLAMLNDFFRMCVYNPVYFRWVHRVKPY
FT                   FIGDRMTVEQLKIYEAEQEYLETRFDALSRGNQPRSLLTKFKSFFRSASPEPMIQSISA
FT                   RRLVMSTRYDYSQALIETSIWEKIASTLLWPLAGKLISDTVLSKSKWFKRFVAQETATP
FT                   DDGLYLSNLIGCCAAVLLKDLVHLFVTWRRVKQLESMEVMSYMTPEWEYAINKKIGQVL
FT                   NDLSSLREDEESYVILEEHANNMLTKPYHDQWTNVGSNIPTILGKVGYFRFLVIKMSIE
FT                   RSLAYTKKAEHL"
FT   gene            complement(<259800..>264359)
FT                   /locus_tag="KLTH0H02926g"
FT                   /old_locus_tag="KLTH-ORF1900"
FT   CDS_pept        complement(259800..264359)
FT                   /locus_tag="KLTH0H02926g"
FT                   /gene_family="HOG000113100" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1900"
FT                   /product="KLTH0H02926p"
FT                   /note="similar to uniprot|Q12280 Saccharomyces cerevisiae
FT                   YPL242C IQG1 Essential protein required for determination
FT                   of budding pattern promotes localization of axial markers
FT                   Bud4p and Cdc12p"
FT                   /db_xref="GOA:C5E285"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000593"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniProtKB/TrEMBL:C5E285"
FT                   /protein_id="CAR30146.1"
FT                   /translation="MTSVNGSPSRGKNPFIERYMASLGEGTEAASKSVSPTKHYPPVGS
FT                   PARSKVVDKENVVDRKSKKSSLLRAAAESPLKPIPPSKQNSGTLAHSFNPKGTETPIKK
FT                   STAATIVSTTFDVTSLSKKDAKYYEFLCRVKEAKEWIEAIIEEKLPSELDLATGNSLRD
FT                   GVYLAKLTQKIEPGLARKIVPSGNTLQFTHTQNINSFFRLVESVGVPDLFRFELTDLYE
FT                   KKNIPQVFETLHALANVINSKWPGKAPEIQNLSGLCSFSNDDLKTCQRRLPMIHNFRSF
FT                   KSTKPSTASGTSELPSGLLAAPTISSVEDTPVKIPKLSVPSEEPKTPEKQCEISKTPSP
FT                   ASHKSEQQDHKTPSLANTLTDTAPLLKFDMRSSPAKSLSYYSPRIYRHLSYRTASPDIY
FT                   SSRLSTDPYDPDYYNTLKYTTPEYSPIRRKRMTELEFLDSVSSLQAICRGVNTRFGLTL
FT                   MQRKVDMVVKNLTLLQARARAGLVRSPFKQKLQSEASPGSKSSIGCLQATIRANQVREK
FT                   IFRLRVRLLRVEEEVTSIQSLARAAIVFRRAKATLERHSMITEPLIELQAYAKGLRQRD
FT                   ILRQTKESLSSHLPQIVFLQGLLRSRHLRKHRKLIYFSLNEQLNTIHTLQALARGTTKR
FT                   RAMQRLDNELELHSGSISKVTALLKGSFKRCSIKSLATAVRDSKDPVVSLQALSKGVLA
FT                   RFALELVADVVEANNLMEFQSLAKGSIIRRANRRLDAYYKGKLPEVVKVQSFIRSHQLR
FT                   VAYIEFMSSANPSLWAVRKFVHLLNKIYTSHKSQNKLEWLKSQIDQANKSRDKLQGNLN
FT                   LLQRKSEILEDYNIFVGNLNGKASVLQNSVSSSFPGYEKLIYLLQADPFYWKTVARLDQ
FT                   SFASKYLVKTFSSANGIMTQRENVFFVKLVADLMITDIENFNNVQDFLSAKPQGFWQDL
FT                   LVSYIHRQIPDLMKELFQPVLDFVSSDQVDFESIPAVIYRKIHPHGADLSSSQSIEDDT
FT                   TKRVFVQNLTSLWNAVEIVSDALTRNVDRISEDVKFLCTAAYKAVADRSPYESDALLAI
FT                   SKILIEVIVASFLKEPAKFGSRKVSIQAEKKISVLLDVLMTVYSFTEFQGYLTPLNQYA
FT                   DQIRTDLALSLKSMLTSPSFENFCDKLIYGDMCQETRASLSISKQYLVDIGDKLKSTLS
FT                   SFPHDDPIVQLYKDMSKSQERQALRASTNNIVDLRLNPSAYQLSSSDDRLMSVYNEIKR
FT                   GLVYMMQVEDVETNLYDLMTSSILMSDEPIFQELVHRTEAIKSDPLLKNLESLSYFNLK
FT                   QHVLERAYELKQMDSLTIEDGLQSILNDIANTIKSREYVAESTKNEAQTAQHTLKRIQD
FT                   STFQLQEAIRSLETAQKRALKSKQSSNTYAPSKKHGLGNKLKDVYKKVNHKSYGEKNCL
FT                   SLEWTTRHLHEIGVLNEVAGENLGKVALSFFGSNGPKFPDILFKISTSDGEVYAVEMND
FT                   ERKGDKTKRSGTDSFAFSKLVDTLAKDKAAKLELFSKKVEFNVPNLLNLVATSFLGRQ"
FT   gene            complement(<264580..>265505)
FT                   /locus_tag="KLTH0H02948g"
FT                   /old_locus_tag="Klth0H.mRNA.5607.m"
FT   CDS_pept        complement(join(264580..265364,265424..265505))
FT                   /locus_tag="KLTH0H02948g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.5607.m"
FT                   /product="KLTH0H02948p"
FT                   /note="weakly similar to uniprot|P46670 Saccharomyces
FT                   cerevisiae YPL241C CIN2 Tubulin folding factor C (putative)
FT                   involved in beta-tubulin (Tub2p) folding isolated as mutant
FT                   with increased chromosome loss and sensitivity to benomyl"
FT                   /db_xref="UniProtKB/TrEMBL:C5E286"
FT                   /protein_id="CAR30147.1"
FT                   /translation="MERLRPIDTFGWLNGPEKLSALQGACEELERELGACKNTNALKED
FT                   ISLFSSALNASSDQLPPYALEKFAKRLQALLKDLEARNRKGSLTRFKFRRKPTAPPTIG
FT                   TTPTKTPLSNRAKLSDSSGPTRDQTLVVTHAAASYENLVHCNISYNARDRQNDLNSLQS
FT                   GSSALSLRSLDSCIVKLLGVPFNRGSVYIENAIDSLVLIKIQSGADIQVRLFGLRNCKL
FT                   YIIQEGMRRQAVILENCQDCCFHTAMKEGADIQDFSNISKCLTDGGEHFHFEAFDTDDS
FT                   SIAALSN"
FT   gene            complement(<265781..>267895)
FT                   /locus_tag="KLTH0H02970g"
FT                   /old_locus_tag="KLTH-ORF1897"
FT   CDS_pept        complement(265781..267895)
FT                   /locus_tag="KLTH0H02970g"
FT                   /gene_family="HOG000031988" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1897"
FT                   /product="KLTH0H02970p"
FT                   /note="highly similar to uniprot|P15108 Saccharomyces
FT                   cerevisiae YMR186W HSC82 Cytoplasmic chaperone of the Hsp90
FT                   family"
FT                   /db_xref="GOA:C5E287"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR020576"
FT                   /db_xref="UniProtKB/TrEMBL:C5E287"
FT                   /protein_id="CAR30148.1"
FT                   /translation="MSNGETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALDK
FT                   IRYQALSDPKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKADLINNLGTIAKSGTKA
FT                   FMEALSAGADVSMIGQFGVGFYSLFLVADKVQVISKHNDDDQYIWESNAGGSFTVTLDE
FT                   QNERLGRGSVLRLFLKDDQLEYLEEKRIKEVVKRHSEFVAYPIQLVVTKEIEKDVPVAE
FT                   EEKTEEKSEDDKKPKLEEVDEDEEGEKKSDTKKVKETVKELEELNKTKPLWTRNPSEVT
FT                   QEEYNAFYKSISNDWEDPLAVKHFSVEGQLEFRAILFVPKRAPMDLFESKKKKNNIKLY
FT                   VRRVFITDEAEELIPEWLSFVRGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIET
FT                   FNEIAEDSEQFDKFYSAFSKNLKLGIHEDTQNRTALAKLLRYNSTKSVDEMTSLTDYIT
FT                   RMPEHQKNIYFITGESLKAVEKSPFLDALKAKNFEVLFLVDPIDEYAFTQLKEFEGKPL
FT                   VDITKDFELEETEEEKAEREKEAKEFEKLAEALKEVLGERVEKVVVSHKLVDAPAAIRT
FT                   GQFGWSANMERIMKAQALRDSSMSSYMSSKKIFEISPKSPIIKELKKRVEDNGAQDRTV
FT                   KDLTNLLYETALLTSGFTLEEPASFATRINRLISLGLNIDEDEEEAAPEASTSAPVEEV
FT                   PAETEMEEVD"
FT   gene            complement(<268190..>271054)
FT                   /locus_tag="KLTH0H02992g"
FT                   /old_locus_tag="KLTH-ORF1894"
FT   CDS_pept        complement(268190..271054)
FT                   /locus_tag="KLTH0H02992g"
FT                   /gene_family="HOG000141917" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1894"
FT                   /product="KLTH0H02992p"
FT                   /note="similar to uniprot|Q12751 Saccharomyces cerevisiae
FT                   YMR185W Protein required for cell viability"
FT                   /db_xref="GOA:C5E288"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019414"
FT                   /db_xref="UniProtKB/TrEMBL:C5E288"
FT                   /protein_id="CAR30149.1"
FT                   /translation="MSENPKTKSIESVLSKRPEFTNDTPLDRFFESLGEYFSRIKDDSG
FT                   SPLYEELGCASNAEFVAFLLGQLEVLKSILKENSSGKATNTLVPISLHDMKYFDLLVNL
FT                   IVVHGICANLPPGIGIPLDQRRIENFRQVDKRFEIHSRHTVSFDTLARVSDVLYGVLTF
FT                   APLKENTIGSLLLKGTGFADLITALIVLYHEVQSSRNKVSSMFERIENLQETYQLFSVY
FT                   TLLVHTTSKAEYRQFVLTKLSTLPIRRQNGVISLVDFVVGVREDEEIDVTKFKRVAEIL
FT                   VSKPKNMTSVTYFTELFSQIYEGLALINKPILVSCLNNVVTEFYFKNKRIVYDFLFKKI
FT                   AAVLYNTSLQEFSTKTLNDTMNVLISLSKNPSIEVTQELSTYGGEKFYLTLWIYCLFLK
FT                   KHQKLQPNDGSQQPSVAYYNVVLGMLKTYIIINSDYQALDDIVLNLVNFDHETWGYSID
FT                   LETQLPYVRLIGEKNIGDELTSIGSVNTDQKIKRVQEVFLDIDCAVLLFVELLKLLNEP
FT                   EVVKEIFLSVMNRWVVSTNKANKDNSQLPGDVQNSLLILVDLKLLEKMDESFKSDIIKK
FT                   PRDVLKLINDLLEFPSPDEEERDDQPDSDDEDEDGEEEADEEEAFQIEQAPSPNTYVTL
FT                   LKLLSAIIDTTPRKELHKSSDILESISKTLHGHGDDAQAQSIMGRIRDLQENNAGAGQP
FT                   LGDFSELDADNEFLQKAMANVNDALVPVRAHGLYELRQLIERRSPVIDLNYVLEVHARQ
FT                   LRDKEPFVYLNAIKGLTSLCEIEPERTLNYLLNLFRNRGSKNSLDNTLKVGEVLLNYIT
FT                   LQNELFGGESAGTLVAICLEKIQQHENLDNRLRMSAMSILGICLQTNPRGVRAQIPDIL
FT                   DCAFNILKLENGTQSSSSNLVRRSAIHLLHSLVSSSDLTLFPSQYGGSRLVSLLNYVKE
FT                   KDDDYLVCEQASALLTVVKVLQVS"
FT   gene            <271566..>272159
FT                   /locus_tag="KLTH0H03014g"
FT                   /old_locus_tag="KLTH-ORF1890"
FT   CDS_pept        271566..272159
FT                   /locus_tag="KLTH0H03014g"
FT                   /gene_family="HOG000111159" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1890"
FT                   /product="KLTH0H03014p"
FT                   /note="similar to uniprot|P46683 Saccharomyces cerevisiae
FT                   YPL239W YAR1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniProtKB/TrEMBL:C5E289"
FT                   /protein_id="CAR30150.1"
FT                   /translation="MSLHSDPLDQEDQDAIILDARCGDLESLKDIFTNLVDPKLIVTCR
FT                   DAVTQSTPLHMAAANGHKEVMQYLASLVTDGAELKKWVNSQNETGNTALHWASLNGSLE
FT                   CVKFLCEELGADPFIRNNFDHDAIFEAERGNKEEVENFYPQKYDVEPENDETAQAESVE
FT                   IKEGTEIEQVTKEATEALRLETDKLSLSEDRGQS"
FT   gene            <272447..>273298
FT                   /locus_tag="KLTH0H03036g"
FT                   /old_locus_tag="KLTH-ORF1886"
FT   CDS_pept        272447..273298
FT                   /locus_tag="KLTH0H03036g"
FT                   /gene_family="HOG000107197" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1886"
FT                   /product="KLTH0H03036p"
FT                   /note="similar to uniprot|P09064 Saccharomyces cerevisiae
FT                   YPL237W SUI3 Beta subunit of the translation initiation
FT                   factor eIF2 involved in the identification of the start
FT                   codon"
FT                   /db_xref="GOA:C5E290"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:C5E290"
FT                   /protein_id="CAR30151.1"
FT                   /translation="MSDLANELGFDPNLKKKKKSKKVAPEDVETTVEGSNGDDLFAGLK
FT                   KKKKKSKEAKGTNDIDSVVDEVGEALGELKLKKKKKKSKEPSFDDFEKELEKAGVAPAT
FT                   QDNSRESSLVPGEDSAIQQNVGLPYTDLLSRFFQTLRTNNPELAGDRSGPKFRIPPPVC
FT                   QRDGKKTIFCNIQEISEKLQRNPEHLIQYLFAELGTSGSVDGQRRLVMKGKFMPKQMEN
FT                   VLRRYILEYVTCKTCKSINTDLRKEQSNRLFFLVCKSCGSTRSVSSIKTGFQAIVGKRR
FT                   RM"
FT   gene            complement(<273404..>273898)
FT                   /locus_tag="KLTH0H03058g"
FT                   /old_locus_tag="KLTH-ORF1882"
FT   CDS_pept        complement(273404..273898)
FT                   /locus_tag="KLTH0H03058g"
FT                   /gene_family="HOG000033805" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1882"
FT                   /product="KLTH0H03058p"
FT                   /note="weakly similar to uniprot|Q03233 Saccharomyces
FT                   cerevisiae YMR184W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5E291"
FT                   /protein_id="CAR30152.1"
FT                   /translation="MLNRTQSFQNCRETDVPGYNDCPNFIYPSKGASGARKARFSVEDT
FT                   CGNTKPAVAPPPPVRRVKSQQETATPLKGKSELLEELDRLFARNSNLPPAEFQYHKNKV
FT                   LTNIDQSLSHDHGCQVMSRAMTCIGEKEQLKKVIMEWMMSDTSTSKWCPSFLKIAGNVA
FT                   L"
FT   gene            complement(<274038..>275078)
FT                   /locus_tag="KLTH0H03080g"
FT                   /old_locus_tag="KLTH-ORF1881"
FT   CDS_pept        complement(274038..275078)
FT                   /locus_tag="KLTH0H03080g"
FT                   /gene_family="HOG000157694" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1881"
FT                   /product="KLTH0H03080p"
FT                   /note="similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
FT                   YPL236C Hypothetical ORF"
FT                   /db_xref="GOA:C5E292"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5E292"
FT                   /protein_id="CAR30153.1"
FT                   /translation="MTFIGTLCGCCGSSQPSYVSVNGHRYHIKRLLGEGGFSFVYLVES
FT                   RENGLMALKKIRCPFGSIGSISPAMKEVDNYQKFKSPYIAQIIDSQVVQERDGSKTVYI
FT                   LLPYFSKGSLQDEINRHLLDCTQVPELEVVRLALGVARGLLCIHDAAPADESDVTYSIV
FT                   SAPYAEDSSLLNDLELDTFGESHQAYAHHDIKPSNIMISSEGMPVISDLGSCSRACVEI
FT                   NSRQALLQFQEWRSEHCTLTFMAPEILDVKLNSVITEKCDVWSFGCTIYTMCFGISPFE
FT                   REEQISGASVTYSLTTGKYSIPSGTNYSSGLIDVVKKCLNVDPDGRPSVDELISLLMDL
FT                   QSQLVS"
FT   gene            <275767..>277179
FT                   /locus_tag="KLTH0H03102g"
FT                   /old_locus_tag="KLTH-ORF1880"
FT   CDS_pept        275767..277179
FT                   /locus_tag="KLTH0H03102g"
FT                   /gene_family="HOG000190885" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1880"
FT                   /product="KLTH0H03102p"
FT                   /note="highly similar to uniprot|Q12464 Saccharomyces
FT                   cerevisiae YPL235W RVB2 RUVB-like protein TIP49b Homologue"
FT                   /db_xref="GOA:C5E293"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010339"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniProtKB/TrEMBL:C5E293"
FT                   /protein_id="CAR30154.1"
FT                   /translation="MSIQTSDSSSNDYGKALSLIAAHSHISGLGLDENLQPKATSQGMV
FT                   GQSQARRAAGVILKMVQSGTIAGRAVLIAGPPSTGKTALAMGLSQSLGQDVPFTAIAGS
FT                   EIFSLELSKTEALTQAFRKSIGVKIKEETELIEGEVVEIQIDKSITGGHKQGKLTIKTT
FT                   DMETIYELGSKMIEGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFV
FT                   QCPEGELQKRKSVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWK
FT                   EEGKADIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVVMATNRGISRTRGTNYKSP
FT                   HGLPLDLLDRSIIITTHNYNEQEIKTILSIRAQEEEVEVAPDALDLMTKIGLESSLRYA
FT                   SNLISVSQQIALKRKSNTVEIADIKRAYLLFLDSSRSVKFLQEYQPQYIDDEGKVQIAS
FT                   NMTGTDAMDTTA"
FT   gene            complement(<277395..>277889)
FT                   /locus_tag="KLTH0H03124g"
FT                   /old_locus_tag="KLTH-ORF1877"
FT   CDS_pept        complement(277395..277889)
FT                   /locus_tag="KLTH0H03124g"
FT                   /gene_family="HOG000056520" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1877"
FT                   /product="KLTH0H03124p"
FT                   /note="highly similar to uniprot|P32842 Saccharomyces
FT                   cerevisiae YPL234C TFP3 vacuolar ATPase V0 domain subunit
FT                   c'"
FT                   /db_xref="GOA:C5E294"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR011555"
FT                   /db_xref="UniProtKB/TrEMBL:C5E294"
FT                   /protein_id="CAR30155.1"
FT                   /translation="MSEILPVDEYSPFFAPFFGFAGCAFAMVLSCLGAAIGTAKSGIGI
FT                   AGIGTFKPELIMKSLIPVVMSGILAVYGLVVAVLIAGGLSPTEDYTLFNGFMHMSCGLC
FT                   VGFACLSSGYAIGIVGDVGVRKFMHQPRLFVGIVLVLIFAEVLGLYGMIIALILNTRSS
FT                   G"
FT   gene            <278598..>279245
FT                   /locus_tag="KLTH0H03146g"
FT                   /old_locus_tag="KLTH-ORF1875"
FT   CDS_pept        278598..279245
FT                   /locus_tag="KLTH0H03146g"
FT                   /gene_family="HOG000000975" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1875"
FT                   /product="KLTH0H03146p"
FT                   /note="similar to uniprot|Q6B152 Saccharomyces cerevisiae
FT                   YPL233W NSL1 Essential component of the MIND kinetochore
FT                   complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
FT                   kinetochore subunits contacting DNA to those contacting
FT                   microtubules required for accurate chromosome segregation"
FT                   /db_xref="InterPro:IPR013950"
FT                   /db_xref="UniProtKB/TrEMBL:C5E295"
FT                   /protein_id="CAR30156.1"
FT                   /translation="MSTQPSKLDVRVEQVRSIYGQFQSILDEKVALHLPQEQDSIKGEV
FT                   LLQLQKFLAEAMDMASDSLNVVNANERASLTELLAQSRQQFVDPFDLDLNEQVRKKYQE
FT                   WEDQTVKVAQLRREAPRKLRESYENEAQLALQEADTLINSFSQETPAEQNGAGQAKEEP
FT                   IELPNLPRLGEDYQEALKNLSAAKTQTPQNRAQIQKLEQLVAFLESELLAGS"
FT   gene            <279697..>280563
FT                   /locus_tag="KLTH0H03168g"
FT                   /old_locus_tag="KLTH-ORF1871"
FT   CDS_pept        279697..280563
FT                   /locus_tag="KLTH0H03168g"
FT                   /gene_family="HOG000246774" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1871"
FT                   /product="KLTH0H03168p"
FT                   /note="highly similar to uniprot|P32867 Saccharomyces
FT                   cerevisiae YPL232W SSO1 encode syntaxin homolog act in late
FT                   stages of secretion post-Golgi t-SNARE"
FT                   /db_xref="GOA:C5E296"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006011"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/TrEMBL:C5E296"
FT                   /protein_id="CAR30157.1"
FT                   /translation="MSYNNPYQNDNPYTENYAMQDSVGHAQSGGDFVTFMNGINQINVE
FT                   LDDYANLINQIDSSQRRLLTEVNEDQELAMRQHLDGLVSRASDLQYQLRNKIKSAQQQG
FT                   ASDPSKQAQAENSRQRFLKLIQDYRITEANYKEQNKDQAKRQYRIIQPEATDDEVEAAI
FT                   SDVGGQQIFSQALLNANRRGEAKTALAEVQARHQELLKLEKTMAELTQLFNDMEQLVIE
FT                   QQENIEVIDKNVEDAQQDVEQGVGHTNKAVKSARRARKNKIRCILILVVIVIVIVLAIA
FT                   LPLGLRK"
FT   gene            <281852..>287524
FT                   /locus_tag="KLTH0H03190g"
FT                   /old_locus_tag="KLTH-ORF1868"
FT   CDS_pept        281852..287524
FT                   /locus_tag="KLTH0H03190g"
FT                   /gene_family="HOG000177974" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1868"
FT                   /product="KLTH0H03190p"
FT                   /note="highly similar to uniprot|P19097 Saccharomyces
FT                   cerevisiae YPL231W FAS2 Alpha subunit of fatty acid
FT                   synthetase which catalyzes the synthesis of long-chain
FT                   saturated fatty acids contains beta-ketoacyl reductase and
FT                   beta-ketoacyl synthase activities"
FT                   /db_xref="GOA:C5E297"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR021186"
FT                   /db_xref="UniProtKB/TrEMBL:C5E297"
FT                   /protein_id="CAR30158.1"
FT                   /translation="MTMKPEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKDFNTER
FT                   VVEIGPSPTLAGMAQRTIKNKYESYDAALSLQRQVLCYSKDAKEIYYTPDPADLAPKEE
FT                   AAPEPAASAAATPAAAPASAAAPAAAPAAPAAAGPAAEIPDEPVNAALLLHVLVAQKLK
FT                   KTLDQVPMAKTIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEETPLEELAESFQDTFNG
FT                   QLGKQSSSLISRLMSSKMPGGFTITSARKYLQTRWGLGAGRQDSVLLIALTQEPASRLG
FT                   SEADAKQFMDAIAQKYASVSGVDLSVATSAASSGAAAGSGGATIDAAAFDELNKDQKIL
FT                   ARQQLEVLARYLKMDLSSGEKKFLQEKNTTEQLQAQLDFLTNELGEYFVQGISTSFSRK
FT                   KARVFDSSWNWAKQSLLSLYFEIIHGVLKNVDRELVAEAINIMNRSNETLIKFMEYHIS
FT                   QTKVDEGENYQLAKSLGQQLIENCKQALELDPVYKDITKPTAPQTIVDKNGNINYKEVP
FT                   RPSVRKLSQYVEEMALGGPLTKVEQPTLQEDLTRVYKAINAQAAEHNISDSTKIEFEKL
FT                   YGELLKFLEASNEIDTSASSRYAGEVDDALDKDSTKEVASLPTKSEISNTVSSTIPRET
FT                   VPFLHLKKKLPSGDWIYDRQLSSLFLNGLERAAINGVTFKDKYVMITGAGQGSIGAEVL
FT                   QGLIQGGAKVIVTTSRFSKKVTDYYQSIYAKYGAKGSTLVVVPFNQGSKQDVEALVSYV
FT                   YDDEKNGGLGWDLDAIIPFAAIPENGIELENIDSKSEFAHRIMLTNILRMLGNVKKQKS
FT                   AQGIETRPAQVILPLSPNHGTFGGDGMYAESKLSLETLFNRWHSESWSNQLTICGAIIG
FT                   WTRGTGLMSANNIIAEGIEKLGVRTFSQREMAFNLLGLLIPEVVQLCQTSPVMADLNGG
FT                   FQFLPDLKEFTAKLRQDLTNTSEIRKAVSIETALEHKAVNGDNADAAYAKAEVQPRANI
FT                   QLNFPTLKPYESLKKIAPSELQGMLDLERVIVVTGFSEVGPWGSSRTRWEMEAKGEFSL
FT                   EGCVEMAWIMGLIKYHNGNLKGRPYTGWVDAKSNEPVDDKDIKAKYESHILDHAGIRLI
FT                   EPELFNGYDPKKKQMIQEVVIGEDLEPFEASKETAEQFKHEHGDKVDIFEIPDSGEYTI
FT                   RLLKGATLYIPKALRFDRLVAGQVPTGWDARTYGIPEDTISQVDPITLFVLVSVVEAFI
FT                   SSGITDPYEMYQYVHVSEVGNCSGSGMGGVSALRGMFKDRYKDMPVQNDILQESFINTM
FT                   SAWVNMLLISSSGPIKTPVGACATAVESLDVGVETILSGKAKICIVGGYDDFQEEGSYE
FT                   FGNMGATSNSYDEFDHGRTPAEMSRPTTTTRNGFMEAQGAGMQVIMNADLAIKMGVPIY
FT                   GILALTATATDKIGRSVPAPGKGILTTAREHQSDLKFPSPLLNIKYRKRQLDSRVSQIK
FT                   LWVENELEMLQYETEEIPEEDHAAFYAERTEEIHREAERQLKTAQNQWGNEFYKNDPRI
FT                   APLRGALATFGLTIDDLGVASFHGTSTKANDKNESATINEMMKHLGRSEGNPVLGVFQK
FT                   YLTGHPKGPAGAWMLNGGLQILNSGVVPGNRNADNVDKVLEQFEYILYPSRSIKTDGVK
FT                   AVSVTSFGFGQKGAQAIAVHPDYLYAALDESAYRAYAAKVSAREQAAHKYFHNGMIYNS
FT                   LFVAKEHPPYADELEQPVYLDPLARVSADKKTGAFVFDKKALTASTTYVSDANLKTSEV
FT                   VSKLAKQAAGDNKGASVGVDVELIKSINVDNDTFIERNFTAAEVAYCKSQPCVQSSFAG
FT                   TWSAKEAVFKSLGVKSQGGGASLKDIEITRKDGSAPQVELHGDAASAASAAGVKGVTVS
FT                   ISHDDFQSVAVAYSQK"
FT   gene            <288203..>288628
FT                   /locus_tag="KLTH0H03212g"
FT                   /old_locus_tag="KLTH-ORF1855"
FT   CDS_pept        288203..288628
FT                   /locus_tag="KLTH0H03212g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1855"
FT                   /product="KLTH0H03212p"
FT                   /note="some similarities with uniprot|Q99395 Saccharomyces
FT                   cerevisiae YPL229W Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5E298"
FT                   /protein_id="CAR30159.1"
FT                   /translation="MPFLTPPLSMAGLNQIAAPHNFVLETPNSQVGQPMHMVNGFESPE
FT                   MSLKTKNNICKSFEDDLFFCPRGLLSSQELSTCQQMDLLLLDQMRDISGLHAAQVTDVE
FT                   APDHAHSQPKFNPYTSQSFSPAPPPLESRPHLRESTL"
FT   gene            <288945..>290384
FT                   /locus_tag="KLTH0H03234g"
FT                   /old_locus_tag="KLTH-ORF1853"
FT   CDS_pept        288945..290384
FT                   /locus_tag="KLTH0H03234g"
FT                   /gene_family="HOG000111552" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1853"
FT                   /product="KLTH0H03234p"
FT                   /note="highly similar to uniprot|O13297 Saccharomyces
FT                   cerevisiae YPL228W CET1 Interacts with Ceg1p the mRNA
FT                   capping enzyme alpha subunit removes gamma-phosphate from
FT                   triphosphate-terminated RNA mRNA capping enzyme beta
FT                   subunit RNA 5'-triphosphatase"
FT                   /db_xref="GOA:C5E299"
FT                   /db_xref="InterPro:IPR004206"
FT                   /db_xref="UniProtKB/TrEMBL:C5E299"
FT                   /protein_id="CAR30160.1"
FT                   /translation="MSSSKPNFSRGLSLEDLVNHDERSDAKAGQKSNPLPPAEVKHRMS
FT                   VDGLGSEQNGSASSSRVPREQRGPRRNADGDEETDTDEEVGGPGDIVFETGDFKFDYEK
FT                   QEGAGKNRDARAGREDTSSSSPSSKAKGGQDVKDIFQERASSQSKRNAIKKDLNVLSEI
FT                   AATAKPTRYNTAPIWAQKWKPTVKALQSIDTKDLNIDASFTNIIPDDDLTKSVQDWVYA
FT                   TLVSIPPDQRQYVEMEMKFGIIVEGSDSNRVSPPVSSQTVYTDMDAHLTPDVDERVFTE
FT                   INRYVKGISELSEYTGKFNIIESHTKDLLYRVGMSTQRPRFLRMSRDVKTGRVGEFIEK
FT                   RHVSQLLLFSPKDSYDVKISINLELPVPDNDPPEKYKDNTPVNTRTKQRISYIHNDSCT
FT                   RMDITKVANHNQGVKQRHTESTHEIELEVNTAALLTAFEHIGNNSKEYASILRTFLNNG
FT                   TIIRRKLTSLSYEIFEGQKKV"
FT   gene            complement(<290490..>291488)
FT                   /locus_tag="KLTH0H03256g"
FT                   /old_locus_tag="KLTH-ORF1849"
FT   CDS_pept        complement(290490..291488)
FT                   /locus_tag="KLTH0H03256g"
FT                   /gene_family="HOG000283250" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1849"
FT                   /product="KLTH0H03256p"
FT                   /note="similar to uniprot|P40350 Saccharomyces cerevisiae
FT                   YPL227C ALG5 UDP-glucose:dolichyl-phosphate
FT                   glucosyltransferase involved in asparagine-linked
FT                   glycosylation in the endoplasmic reticulum"
FT                   /db_xref="GOA:C5E2A0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A0"
FT                   /protein_id="CAR30161.1"
FT                   /translation="MWDTFWSRVRELSVSTVLVTFAVAIACSLYLIVLLLSHSPRKPFD
FT                   EELIFKTNGPRGHIVSGKLDPVTKGSSNKDGIELSVVVPSYNEIGRILVGLTDAVTFLQ
FT                   EHLEDKWEILVVDDGSSDGTSKYCLDLAANHFKLKPGQLRVVKLTQNRGKGGAVRHGLL
FT                   HMRGKYGLFADADGASRFSDVAKLLDSIKKHEEKGHAAMAIGSRAHMVNTDAVVKRSFI
FT                   RNLLMYGLHTLVFIFGIRSIKDTQCGFKLFNRSATVQIFPYLHTEGWIFDVEILILALR
FT                   KKVPVEEVAISWHEVDGSKMDLARDSINMAKDLVIIRMAYLLGIYSDKVEC"
FT   gene            complement(<292114..>294105)
FT                   /locus_tag="KLTH0H03278g"
FT                   /old_locus_tag="KLTH-ORF1848"
FT   CDS_pept        complement(292114..294105)
FT                   /locus_tag="KLTH0H03278g"
FT                   /gene_family="HOG000141958" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1848"
FT                   /product="KLTH0H03278p"
FT                   /note="weakly similar to uniprot|P35209 Saccharomyces
FT                   cerevisiae YMR179W SPT21 Protein required for normal
FT                   transcription at several loci including HTA2-HTB2 and HHF2-
FT                   HHT2 but not required at the other histone loci
FT                   functionally related to Spt10p"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A1"
FT                   /protein_id="CAR30162.1"
FT                   /translation="MTTRMSLKVLYTVDKETNSYLTRSKAPVEARIESIPSPSNDGTQL
FT                   RVGIVLLNDVLEQVCASSPELFSYGMDNSVDYNVYCRDICELDEPLVSFGLLSKLRGAA
FT                   QQQSKNDVDDWPLVMGRVCSSFSAILRFQNIANTPPTQQTLEIKIRFSKVATANSSRRS
FT                   SVSGNNVHTLAKKAPTTTTSMLGSRGTSKAAGEMAKPEAVTKRQTNPMPAPKAARTQSL
FT                   PIWNQSKNNQFALPANSIAHKIYLADRAAKDTASSVKAREEKKPVVYQINSLQQDNTIQ
FT                   KTKVDDSVSKRFDFITKKKGKMAKPSIKKPVAKPKSSVKKVRRDSVVQASTPLPREAQT
FT                   SSMINKNDALEEFKLLNDDVLVQQLLDRQKLKPTDFFELDQEKGDDSENKENIPPRPVP
FT                   LSSRFEDLIGMDIPSFKTPSDSEKTGSVPRSDDTLEWFNDLFGSPIGNQKTVTPTKDPL
FT                   TCNTLPIEDDEQDPSKALTSDIDRTSPMDTLSMPLYELEHKKESKGSEPVPSCKEQLRR
FT                   LPILTKNSHSGHQDDVRDADSTTPVVLGYSTSPKSNNNELAAGQKRPAPVPSSPADDED
FT                   YMDEYMQERRRKRKTMPSSPTSMFPYREQDGEDEHSMTNDEFSIHERPCRDDANSTPAT
FT                   QYRSSDVENMKHGEESSAETKQNEFLHI"
FT   gene            <295271..>298801
FT                   /locus_tag="KLTH0H03300g"
FT                   /old_locus_tag="KLTH-ORF1839"
FT   CDS_pept        295271..298801
FT                   /locus_tag="KLTH0H03300g"
FT                   /gene_family="HOG000180957" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1839"
FT                   /product="KLTH0H03300p"
FT                   /note="similar to uniprot|Q7LHP2 Saccharomyces cerevisiae
FT                   YPL226W NEW1 This gene encodes a protein with an Q/N-rich
FT                   amino terminal domain that acts as a prion termed [NU]"
FT                   /db_xref="GOA:C5E2A2"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015688"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A2"
FT                   /protein_id="CAR30163.1"
FT                   /translation="MPPKKFKSLDDFIGDQAPPKNQFQTPLENYYQNMSSGQSHPKTKG
FT                   SSYQAQRNWNDGSQYGNNSYNQNRGYQNYQGGYQNYQGGYQNNQSPQHSGRSTPSGSAT
FT                   PTPSTSTTSLTSLATSLANLGVTSISGILSTLPQCASLAECRQKIQLAVAEFNNEGRSA
FT                   QDIEDWDVPSIISKLIKPKNPALVQESAMLLISQLSINFSGKSPQEAFLLPLLPIALDT
FT                   VASKDSSVKRAAQHAIDSLFGLYPIEAQTSVLLPKVLEYLNSGVKWQCKLAALKLVDRI
FT                   REESPNDLLELTFKDTVPVLTDVATDFKPELAKQGHKTLLDFVSILDNLDLSPRFQLIV
FT                   DTLQDPSKVPNSVKSLSSVTFVAEVTEPALSILVPILNRSLNLSSSSQEQLRQTVIVIE
FT                   NLTRLVNNRSEIQHFIPQLMPGVQKVLDTASLPEVRELAGKAMKVLKDDSEDDGKFPGK
FT                   ITYEFGLQFVKEKIQLLAKNPLPELCKDNNTTALVYLSKIVTSDANVNDWKRLREYLLL
FT                   VFGEENAEAIDTHFIQELRNIFHQETATYDENEGIEIVNTDFSLAYGSRMLLNKTTLRL
FT                   LKGHRYGLCGRNGAGKSTLMRSIANGQLEGFPDKDTLRTCFVEHKLQGEEGDLDLVSFI
FT                   ALDPILKEVSRAEISAALESVGFDDERRSQTVGSLSGGWKMKLELARAMLQKADVLLLD
FT                   EPTNHLDVSNVKWLQDYLLENTEITSLIVSHDSGFLDAVCTDIIHYENKKLAYYKGNLA
FT                   DFVDQKPEAKAYYTLTDSNAQMRFPPPGILTGVKSNTRAVAKMTGVTFAYAGASKPQLT
FT                   DASCALSLSSRVAILGPNGAGKSTLIKLLTGELVPQEGKVEKHPNLRIGYIAQHALQHV
FT                   NLHKEKTANQYLQWRYQFGDDREVLLKESRKISEQEKEMMEKEIDIGDGRGKRAIEAIV
FT                   GRQKLRKSFQYEVKWKFWLPKYNSWVPKEVLLENGFDKLVQKFDDHEASREGLGYRELT
FT                   PTVITKHFEDVGLDSEIANHTPLGSLSGGQLVKVVIAGAMWNNPHLLVLDEPTNYLDRD
FT                   SLGALAVAIRDWSGGVVMISHNNEFVGALCPEQWIVENGKMVQKGVSQIDQSRFEDGGK
FT                   AGSASAAKAASPSVDDDDSPANIKVKQRKKRLTRNEKKVQVERRRLRYIEWLSSPKGTP
FT                   KPVDTDDEEE"
FT   gene            complement(<298885..>299754)
FT                   /locus_tag="KLTH0H03322g"
FT                   /old_locus_tag="KLTH-ORF1836"
FT   CDS_pept        complement(298885..299754)
FT                   /locus_tag="KLTH0H03322g"
FT                   /gene_family="HOG000262181" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1836"
FT                   /product="KLTH0H03322p"
FT                   /note="similar to uniprot|Q03219 Saccharomyces cerevisiae
FT                   YMR178W Hypothetical ORF"
FT                   /db_xref="GOA:C5E2A3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A3"
FT                   /protein_id="CAR30164.1"
FT                   /translation="MLPRFLATQTPKIARMPSVKGACVIIGDEVLNGKITDTNSRFFAK
FT                   YCYRLGIQLREIVTIGDQKEQIVQTIKRLSAENDFIVTSGGIGPTHDDITYESVASSFG
FT                   LPCELNYECQDRMRKISHPEKRHDPETLKDFYRMATLPAGPEVHSYYVLKEFWVPIVSI
FT                   QQKVYILPGIPQLFEKLLLAFEPSVKEIYSISEREPHNYERFFVKTPKSESQISSYLRE
FT                   LQTRCLQVSDEIKIGSYPHYGMGFNTVSILGLKKHEVFLKELVKEAIEKLDGTAITAEM
FT                   EEKYSDSR"
FT   repeat_region   300646..302622
FT                   /locus_tag="KLTH0H03344t"
FT                   /old_locus_tag="dnatranposon.4"
FT                   /note="DNA transposon of KLTH part of the newly discovered
FT                   ROVER DNA transposon family of the Kluyveromyces:degenerate
FT                   copy"
FT   gene            <303157..>303603
FT                   /locus_tag="KLTH0H03366g"
FT                   /old_locus_tag="KLTH-ORF1832"
FT   CDS_pept        303157..303603
FT                   /locus_tag="KLTH0H03366g"
FT                   /gene_family="HOG000189636" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1832"
FT                   /product="KLTH0H03366p"
FT                   /note="similar to uniprot|Q08971 Saccharomyces cerevisiae
FT                   YPL225W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR008476"
FT                   /db_xref="InterPro:IPR021148"
FT                   /db_xref="InterPro:IPR023139"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A4"
FT                   /protein_id="CAR30165.1"
FT                   /translation="MSAPNTFNAETAENLEDMEKQFAVLAVEQAETYWNLISKVPGSKL
FT                   RLTKFDDEIYEKFQEHFPEYKDLSRLAKFTEEELKTKEAKERWRKFIKLFEKKVDDFNF
FT                   GTLLRTDASAEYGQFTTCFVVRLQFYAFEIARNKSKLNDWAAGQ"
FT   gene            complement(<303810..>305315)
FT                   /locus_tag="KLTH0H03388g"
FT                   /old_locus_tag="KLTH-ORF1831"
FT   CDS_pept        complement(303810..305315)
FT                   /locus_tag="KLTH0H03388g"
FT                   /gene_family="HOG000174851" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1831"
FT                   /product="KLTH0H03388p"
FT                   /note="similar to uniprot|Q03218 Saccharomyces cerevisiae
FT                   YMR177W MMT1 Putative metal transporter involved in
FT                   mitochondrial iron accumulation closely related to Mmt2p"
FT                   /db_xref="GOA:C5E2A5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A5"
FT                   /protein_id="CAR30166.1"
FT                   /translation="MIKPSAYPVGLQFYHNIGKSRCRQLVWNLCFHQRSIHNSSRRLIN
FT                   EGKKGGIGKTDAERRLEKQAKFQDLSDAFEESRHIHMKESETEQNDTLHLGSMLYREAG
FT                   HTHSHASSQSNPLLKMSRKEFKKNPGVRITWIGLWINVGLALGKFAGAIMFHSQALIAD
FT                   SVHALSDLVSDFLTLASVKLSSKQPTAEYPGGYGKIETLGSLSVSAILAFAGLSIGWSS
FT                   LCAIAAPLLPHAVLDVVSTFSHSHSHGGPTDVANINAAWIAGGSIIIKEWIFNATKKVA
FT                   IETNSNVLLANAWHHRVDSLTSLVALVTISSGYFFNIQSLDAVGGLLVSALVVKTGADG
FT                   MIGAMKELVDRAVAGDDPRYVTVKDNTQEILRKLISNNNAKKPYGLKNLTVLSSGPEMH
FT                   AKMTLEVPLQRWENVLTIKEFEIVTDHLRKTLRENIPTLRNIDIDYVEERPPLSPEQLK
FT                   EIENQKKLGQFPTPQNESASDGPLPSGHTHSHFGLGSGHTHKH"
FT   gene            complement(<305531..>309943)
FT                   /locus_tag="KLTH0H03410g"
FT                   /old_locus_tag="KLTH-ORF1829"
FT   CDS_pept        complement(305531..309943)
FT                   /locus_tag="KLTH0H03410g"
FT                   /gene_family="HOG000144390" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1829"
FT                   /product="KLTH0H03410p"
FT                   /note="similar to uniprot|Q03214 Saccharomyces cerevisiae
FT                   YMR176W ECM5 Non-essential protein of unknown function
FT                   contains ATP/GTP-binding site motif A null mutant exhibits
FT                   cellular volume up to four times greater than wild-type
FT                   also large drooping buds with elongated necks"
FT                   /db_xref="GOA:C5E2A6"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="InterPro:IPR013637"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A6"
FT                   /protein_id="CAR30167.1"
FT                   /translation="MTLEPLPHMPPVGKWQPSTGSNAPLAAALPLAAGKTLPTTSRFKS
FT                   SLEATPSPLSLDQHSPHLYTQHRIRPNAPFDIAHIKSKRLVQTPEPACQTLKTDSGWSY
FT                   TLESGSVPCFRIPRSEIPDPITFYHQIEDVGRQYGAVKLQIIQSSPAPVTPFALNTELF
FT                   WFKARRQSLCSFQEETRRKLDLHRRLYKYHSSRKSDTGRQLFSKIPSIDKRPLDLYRLR
FT                   ECVQLRGGFQEVCHKKLWAQIGRELGYSGRIMSSLSTSLRSAYLKVFSEFDKEEERQRA
FT                   SASAATTTVPTKIHIILPSSTEDNHRDPSSKKRSLNEASISLENAVKKHKASKVQAYQV
FT                   AGSAAEFSRLRDILRYKGFFTNFENLTEPRKGLTKPSPSTLPGYQFTFWKSSSEIYDRS
FT                   AHETRNAPIYNLRQYYEKAQKHFDSVAALYQQRSSLVLEKSDSVNLRDFEKLFFDILSD
FT                   ESACCNVDTGINLPSSVHGSGFPTVSKSTTNGLDTTSAWNLNNIPLSSDSVLQFMDADF
FT                   GSHLDTRLDLGMLFSVKGWSIEDNFLPNIDYHHAGSSKLWYVVPPEDMKRFESLVETSK
FT                   KNQQSPGPEVSNDPVDKSFLNSEVYQCYLDTCPQHQVSTLPPRINTHTIGQFREVTACT
FT                   LPDDWQFHPEKLKANSIKVLRIVQDPGCYILKFPRTYSTSISCGFSISENALFAPASWL
FT                   ESALESEKWLSRNGLLPAIQTFQLLFNIVKESGDKKLASKARLLLTGLASEELAAREEL
FT                   ARRLSDRFTIESNVFDFISDQTLEPTGASKVLLTSAKDCFTLSLRQFLDNLTCKEEKLL
FT                   IFGRDLQQDGISISLHEFYSNEELEALLQEDHACTAAAAIFSEKDASQGQVEKPDRDVL
FT                   VSYDSLVNEELKGQRVPLAKINLFCEALSQESNSQAHQLRRSLKNARSTASRCNQMLAK
FT                   INKEKRGMKFQGFGRGFALKELAAAPFHYTVAELHNLYLELEGSSIAFPEMSKVFELCH
FT                   CVESFQLDAQNAIKINDLSRMKETYLQGWSLGIRSKYHDLLARKICEEMWLSTYEKTII
FT                   EHEIIKEDELGYYTPSYLLPYLKYGIKFVSDALHREKLEQVRNTILLSQETGYELGQLF
FT                   KKKSSKIPVDRLSSILDTLRQYPFLVEPRLRETLEAIMDTFGKHREGMSSSFDKLDVNH
FT                   EHYRLIAGSVNARPLFELNLIGKFDGSCDDKRLTLSEVPNRSIFSKHIKDCRLWLQKVN
FT                   KLVLRKPLWAKIHSSTQLCFANNGDKLTTKSQPDEEPVYCFCRQGDSGSKMVACEVCGE
FT                   WYHATCINKGKWSLVSNENTVFVCPICCPSNFPDFGLVDFSQIESMAMASLKLKVIPDR
FT                   RFFGQFFEIFKMSASFKHTMSCDLLKKDGALRGDLSMAQIKFYLRKLVGAGVRMPREIS
FT                   ALQRACQEHDANVMLKFAQRNIKVVTGYEATGSREASEAQPDQVVIKSEGAMVISPEIK
FT                   PEGNSDMMQ"
FT   gene            complement(<310426..>310851)
FT                   /locus_tag="KLTH0H03432g"
FT                   /old_locus_tag="KLTH-ORF1820"
FT   CDS_pept        complement(310426..310851)
FT                   /locus_tag="KLTH0H03432g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1820"
FT                   /product="KLTH0H03432p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A7"
FT                   /protein_id="CAR30168.1"
FT                   /translation="MSNIIHKMSEKITGHDHHDDERDERGNTLSSEQRQQREQGMPFTE
FT                   HNDPEQRAIPSQRVGGGMQSERSKLGGYQQQQHDLGGSGGDFGQTRSMPEEQMPGAVRG
FT                   GSDLNAEDWDDEDEADDEGRGTRRGGDYSDEFQKRYW"
FT   gene            <311863..>312234
FT                   /locus_tag="KLTH0H03454g"
FT                   /old_locus_tag="KLTH-ORF1814"
FT   CDS_pept        311863..312234
FT                   /locus_tag="KLTH0H03454g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1814"
FT                   /product="KLTH0H03454p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A8"
FT                   /protein_id="CAR30169.1"
FT                   /translation="MSDLFERARQRLSGSSSAVPEKLRDLYMSHGPRDASGGSGSMSRR
FT                   MTGADDGAGPGSSALSSGGDSSGDDSPGASSSDLASNGSRDLAHSHMVSHARGGSDNAA
FT                   ADAGAETGSGADPAANATN"
FT   gene            complement(<312577..>314055)
FT                   /locus_tag="KLTH0H03476g"
FT                   /old_locus_tag="KLTH-ORF1809"
FT   CDS_pept        complement(312577..314055)
FT                   /locus_tag="KLTH0H03476g"
FT                   /gene_family="HOG000000764" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1809"
FT                   /product="KLTH0H03476p"
FT                   /note="weakly similar to uniprot|P18899 Saccharomyces
FT                   cerevisiae YMR173W DDR48 DNA damage-responsive protein
FT                   expression is increased in response to heat-shock stress or
FT                   treatments that produce DNA lesions"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2A9"
FT                   /protein_id="CAR30170.1"
FT                   /translation="MGFLDKVKDFAGNNNDDNGNSGSNDNNLFSKAERAIGQDNVDKIR
FT                   NKVGGDNYDKFEKTVRDKFSNTSINDDNNSSSYGNSNNDDSYGNNNNSSSYGNNNNDDS
FT                   YGNNNNDDSYGNNNNNNNNNSSSYGNSNDDDSYGNNNNSSSYGNNNNDDSYGNNNSSSY
FT                   GNGNNNSSSFGNKSSYGSNSYGDDNNDSYGSKKDKNDKKDNKSSYGSSSYGDDSNDTYG
FT                   SKKDNNTSSYGNSSYGDDNNDSYGSKKDNNSSSYGNSSYGDDNNDSYRSKKDKKDNKSS
FT                   YGSSSYGDDNTDTYGSKKENNSSSYGNSSYGDDSNDTYGSKKDKKDNNTSSYGNSSYGD
FT                   DSNDSYGSKKDKKDKKSSSYGNSSYGNDNSTSSYGNDNKSSSYGNDNSTSSYGNDNNTS
FT                   SYGKKSSYGNDNNTSSYGNSSYGNDNNTSSYGNDNKSSSYGNDSYGNNNSNNNNSNNNN
FT                   NSSYGNNTSSYGDDSYGGNSDSYGNNSNSYNNDY"
FT   gene            complement(<315060..>317054)
FT                   /locus_tag="KLTH0H03498g"
FT                   /old_locus_tag="KLTH-ORF1805"
FT   CDS_pept        complement(315060..317054)
FT                   /locus_tag="KLTH0H03498g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1805"
FT                   /product="KLTH0H03498p"
FT                   /note="weakly similar to uniprot|Q03213 Saccharomyces
FT                   cerevisiae YMR172W"
FT                   /db_xref="InterPro:IPR022210"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B0"
FT                   /protein_id="CAR30171.1"
FT                   /translation="MGSSAPAMANGNQASEVRGSLSNDALNLGLNLALPADTHDTAKTV
FT                   GTVSGSSLADILGSNATPQAGGENGHASGTSNATPASALNEPTHAQIHSASPAQNAGIG
FT                   PQRYGIIQQVSGSSELGTGNSTTTSVQICQRMDEVSARMIAMEEMFNKLYFKINEQEAT
FT                   IQHLRLQSEAFLTSILSEVRQVNHNMPILDNPDDNEKDGFVTDLLNSITNVSSNYLKKV
FT                   NTKHSQKYKRQRQSMGGAGAASTDKPSKDAFGEAATSSSTRAINGTAGVAPNNGASAGQ
FT                   ANLAAQSSKRAAPDSEHSKTHNSSFAESGGQTGQQLVQESHSYPVSEASQLPLPHYLTQ
FT                   QSFTLNPNGIKRRRANTATKPSFSQSHQDISSLNGIGSMSLPNLTLENLTRKNQPHSLG
FT                   FNVNSDHNVSAGARLRHRNIEIQVGSDNVDSHELDLDSSEDEEGYQEDDEDRNSDRSAE
FT                   AADAGRSYGARGNVINAAEEAEDETESYGGLFEPRNRSPGQQIHQRREDRRNFDRGRPV
FT                   RAPGPTEQPLKATQVNAETKTAAAPRSGGPAADEHHTRLRERDLNYTLLKAPANVRAIW
FT                   QEYIEGIDGQPAVKFLEEVYGNKWRLKKNVKTFARRKRLYKFIINGIKHGRSADDMIKI
FT                   LEDKRIYKNEHGEVKKRTIGWLQQSLSGI"
FT   gene            <317431..>319425
FT                   /locus_tag="KLTH0H03520g"
FT                   /old_locus_tag="KLTH-ORF1802"
FT   CDS_pept        317431..319425
FT                   /locus_tag="KLTH0H03520g"
FT                   /gene_family="HOG000008335" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1802"
FT                   /product="KLTH0H03520p"
FT                   /note="similar to uniprot|Q08968 Saccharomyces cerevisiae
FT                   YPL222W FMP40 The authentic non-tagged protein was
FT                   localized to the mitochondria"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B1"
FT                   /protein_id="CAR30172.1"
FT                   /translation="MPEARTVLVALKESGTSRFVQKLLSDQLVPSVGKAIEIEERQDEE
FT                   EHRKVFHTPRLVSQRAHFAYTVPEKRPHYKPLLTSKKALDDLQLEMSQDLVAILTGQRI
FT                   YCDESEGIFPYSMAYAGFQFGQFAGQLGDGRVTNLFDLPDKHGSMQTLQLKGSGLTPFS
FT                   RFADGKAVLRSSLREFIISEALHHIGVPSTRALQLTALPQTKARRAMYEPCAMYCRYAP
FT                   SWIRLGNFDLCRWRQDHGSLVKLADFCINDVFEGGKEFPAHLDPESFKHDFFPDKEDEI
FT                   GTEPKEQERLESNTKYELFFRHVVNLNAESVAYWQTYGFLNGVLNTDNTSIMGLAMDFG
FT                   PFSIMDKFQPQYTPNHDDVESRYSYANQPTAIWWNLTKFAQSMTTLIGAGPAHVEKIVA
FT                   EGLAAVDEAMEKDIVSRANSVIASASNEYKFRFTVKYTDLMAKRLGIELNIPKVFTSAN
FT                   LGSIAEKVREFNNAILEPLLQVLYVTQVDYNNFFVKLQGYSGPFKTERGGGFELIEPDL
FT                   LEVFFSNAQIQKLEKHLAGRPDSDSGETRQLVECAEKLNTWIDDFVSLVPSESNSRSEI
FT                   AKKVNPLFTPRAYILEQVVDDLTENQKERLNDPQAEVDTSLLQKLYSMSVNPYDSDKWE
FT                   DNLRPEVVQDWTTHGDDDDKFMKQLTCSS"
FT   gene            <320024..>322993
FT                   /locus_tag="KLTH0H03542g"
FT                   /old_locus_tag="KLTH-ORF1795"
FT   CDS_pept        320024..322993
FT                   /locus_tag="KLTH0H03542g"
FT                   /gene_family="HOG000248236" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1795"
FT                   /product="KLTH0H03542p"
FT                   /note="weakly similar to uniprot|P36775 Saccharomyces
FT                   cerevisiae YBL022C PIM1 Mitochondrial ATP-dependent
FT                   protease involved in intramitochondrial proteolysis
FT                   involved in degradation of misfolded proteins in
FT                   mitochondria required for bigenesis and maintenance of
FT                   mitochondria"
FT                   /db_xref="GOA:C5E2B2"
FT                   /db_xref="InterPro:IPR001984"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B2"
FT                   /protein_id="CAR30173.1"
FT                   /translation="MQFLSKRKEQTANYLELPCLLPQVTPSVVPLPGVRYRISIPKDKA
FT                   AAMLQDLQEFVDISSYELSKGKELLRGPKKNKQTSKSEVRSSFQCIDEKLKVSNRSQIY
FT                   ICLLPTVQTNYTRGCVSILEEILAEGELVTFCLKGVRRAIIKDPEINLQNRLWISKLLV
FT                   LDDGPYLTSLSPESCGKLVKQLQNNFTNITSAFDSFRATYRNAVRLQSGNSERFFLLSP
FT                   LSNTLFILLSKGSFSKSWKLLFELYQSLEVHKPGNQKDAIFSLIDMTVAVLPVTNKQRL
FT                   RCLELEDPLERAKELDATIHDLVALLASLRDGFKFFEAKVQDFSPGDKAAFVALQLSAL
FT                   RGFIEEPKKGSRFIRNPKSGPPSGARVGADKVEKENGDEDEDLKTIGAFIDNLEISEVH
FT                   PDGLKMLKKDFRRLERLTPQSSEYNVLRGYFDTIMDIPFKAKDVSKSNIDLEECKKKLD
FT                   NDHYGLLDVKKRLIEYLSVLKLNVDFKNEGSKAKPPIMLLVGPPGVGKTSIAKSIAGVL
FT                   NRRFHRISLGGIHNEAEIRGHRRTYVGSMCGLIINALRKSGSMAPFILLDEIDKVLSVQ
FT                   AGGNRGAGLNGDPGAALLEVLDPEQNSTFTDHYVGFPVDLSNVLFFCTANNLTGISAPL
FT                   LNRMEVIEIPGYTPKEKLNIGLKFLLPKQIQLNGLDKASIKVELTKEAWDDLVLEYTRE
FT                   PGVRGLERQIASIVRGKVVEYVQSHESEHKIVTSQELLKYIGFPLHPISRELVKKIKFA
FT                   DKCGVVNGLAYGSDGTGNVLVFEMVKMGKLQGNSSGPRIRTTGNLGKVLNESIEIATTL
FT                   VKSLSERKIIHGLPSQAFNDFLNSEWHIHVPMGAVSKDGPSAGVAIALALISAALNKPV
FT                   SPKLCLTGEITLRGKVLPIGGVREKLLGAQLFGMERVLLPLSNRPDVIEAVMKPEEYES
FT                   CLASSSMPELRRVQQKWQLEAFYIDDFYDVMTKCWPREIQLTDARILISPSDNSIRALL
FT                   "
FT   gene            <323465..>325921
FT                   /locus_tag="KLTH0H03564g"
FT                   /old_locus_tag="KLTH-ORF1793"
FT   CDS_pept        323465..325921
FT                   /locus_tag="KLTH0H03564g"
FT                   /gene_family="HOG000168830" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1793"
FT                   /product="KLTH0H03564p"
FT                   /note="similar to uniprot|Q08967 Saccharomyces cerevisiae
FT                   YPL221W BOP1 Protein of unknown function overproduction
FT                   suppresses a pam1 slv3 double null mutation"
FT                   /db_xref="InterPro:IPR010308"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B3"
FT                   /protein_id="CAR30174.1"
FT                   /translation="MRIFSAILLALNIAHLVVAKRKLVASSLVACMQNSQLTASGFSVV
FT                   FDPDDRSLHYSLDMVTEINDYIYAEVDVYAYGFKIISRNIDLCSLSWKQFCPLRPGNVQ
FT                   VESIEYISESLAKQIPGIAYQVPDIDAFVRMNIYKSTDKSQTLACIQAFFSNGKTVSQT
FT                   GVKWATAVIAGIGLLCSAVLSTFGNSNAASHISANTMSLFLYFQSVAVVSMEHVHRMPP
FT                   IAAAWSENIIWSMGLIRISFMQRIFRWFVQSTGGNPSLYLTSKTISVLVQRSLEGIQRG
FT                   LESIRAPPVFKRNADTIIGNSNVMILRGIKRLAYTSNIENTSVVCTGFTFFVLCGYFLA
FT                   GFIIASKYAIDLCIKAGWIRNTRFWAFRHNWRVILKGSLLRYIYIGFTQLTLLSFWEFT
FT                   QNDSPALIVIAVLFLIQSLGLMLWAAYRTISFARLSVEQRKNPAAILYGDQRVLDKYGF
FT                   FYTMFSAKRYWWNCVILVYILLKSIFISFCQASGKTQALAIFIIDLAYFVVLIKFQPYF
FT                   DRPTNIVNILITTVTLVNSFLFLFFSDLFGQPGRVSSIMGWVFFIMNAAFSLILLILIL
FT                   IFVCMVIFSKNPDLRFKPAKDDRTSFQRVSDSHGKINKSVAAELMALGNTAKNHDENWE
FT                   EELYNQQKLQKEQSVSGLDYSDEKLTGSRSNSDDQEDATRLTLAEKLKRKLSFKRTKST
FT                   KSTSSRARKLANTDDAPVTSLSREPSTSSAPVVKRDYPGVHSRQQSESKNGLIGSNAVE
FT                   NSKLETLAQEDDAPLVDTDNYQAPHSGSVEFGRDESMDSVNVAATANATSSTDLFTNDG
FT                   SYYNRL"
FT   gene            complement(<326294..>327442)
FT                   /locus_tag="KLTH0H03586g"
FT                   /old_locus_tag="KLTH-ORF1789"
FT   CDS_pept        complement(326294..327442)
FT                   /locus_tag="KLTH0H03586g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1789"
FT                   /product="KLTH0H03586p"
FT                   /note="weakly similar to uniprot|P53122 Saccharomyces
FT                   cerevisiae YGL138C Hypothetical ORF"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B4"
FT                   /protein_id="CAR30175.1"
FT                   /translation="MLAITNVTNDSITLPSPLRRRFSLFVCIQLFILLLSVVKPVGGLV
FT                   VSSRLKKLELALATQDRICSMDHVETKTSYRELIGTLTDISFGATGHSSKIYTGFKVHR
FT                   IYHFGKMLSKAKPSLQLSFCEHGKVKWQTELEYRSDIDWDLPFCVYSQDIEGVGDQGHS
FT                   RIWGALKKGNRNQDTVKGPSLKELARQDTANFHCFKMARREKYTKRSTSIYLPNEWVGG
FT                   LFYCDLTPDGKSRLLDQMGDDLHIDATKSHGVCNRANAIPLQPLISDSYRRHWTSLKPG
FT                   TRIPFLRRITRTNMDKVIPFLHTPNSDSDFGNFTTKNDITVSKSSTKLRSNWLSAVNWL
FT                   FASKVEEHLWFNEVEVEESYGVMSAQNNLTNASYIDILKIKH"
FT   gene            <327747..>330550
FT                   /locus_tag="KLTH0H03608g"
FT                   /old_locus_tag="Klth0H.mRNA.461.p"
FT   CDS_pept        join(327747..327764,327941..330550)
FT                   /locus_tag="KLTH0H03608g"
FT                   /gene_family="HOG000163444" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.461.p"
FT                   /product="KLTH0H03608p"
FT                   /note="similar to uniprot|P41811 Saccharomyces cerevisiae
FT                   YGL137W SEC27 Involved in beta'-subunit of yeast coatomer"
FT                   /db_xref="GOA:C5E2B5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006692"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016453"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B5"
FT                   /protein_id="CAR30176.1"
FT                   /translation="MKLDIKKAFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNFETQ
FT                   TEVKSITVTETPVRAGKFIARKNWIVVGSDDFKIRVFNYNTGEKIADFEAHPDYIRSIA
FT                   VHPTRPYVLSASDDLTMKFWNWEKNWSLEQTFEGHEHFVMGVAFNPKDPSTFASACLDH
FT                   TVKIWSLGQPTANFTLHAHETRGVNYVDYYPLQDKPYLITSSDDRTVKIWDYQTKSCVA
FT                   TLEGHMANVSFAVFHPALPIIISGSEDGTLKVWNSNTYKLEKTLNLGLERSWCIATHPT
FT                   GKRNYVASGFDNGFTVLSFGNDDPKLSLDPVGKLVWCGGKNASATDVFTAAIRGTEGAD
FT                   DGEPLPLQTKELGNVDVFPQSLKHSPNGRFVTVVGDGEYIVYTALAWRNKAFGKCHDFV
FT                   WGPDSNSYALIDESGHVKFHKNFKELTSWSIPLEFGVEKLYAGALLGVKADGFVYFFDW
FT                   DSGSLVRRIDVDANDVVWSENGELLMIINNVDENNTEERAAYVLGFNREAYESFLASEE
FT                   EPSEDGIDEAFDVLYEVSDPIGSGKWVGDVFIFTTKTNRLNYFVGGKSYNLAHFDKEMY
FT                   MLGYLPRDNKVYLADRDIHIYSYEISIEVLEFQTLVLRGELEQAKTSVLPNIEGKENLL
FT                   KISRFLEGQEYHEDALEISPDNDQKFDLALKLSKLSLAHDIVAGDDNEFKWRKLGDKAL
FT                   EGFDFQLAIEAYDNAADLESLFLLYSSFKDQAGLVDVGDRAQRLGKYNLAFNAYWSAGD
FT                   VDRARDLLVSSGRYSEAAVLSKAYGGKLEDTNAIVAQWKESLIEVGKAGVASRIHELSK
FT                   ADQVSAEEPLIDIETEAGQGEKQPVGEPLEEAATDETPTDGTPTDETPPETHAEDEAAQ
FT                   NLQE"
FT   gene            complement(<330705..>331637)
FT                   /locus_tag="KLTH0H03630g"
FT                   /old_locus_tag="KLTH-ORF1785"
FT   CDS_pept        complement(330705..331637)
FT                   /locus_tag="KLTH0H03630g"
FT                   /gene_family="HOG000162366" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1785"
FT                   /product="KLTH0H03630p"
FT                   /note="similar to uniprot|P53123 Saccharomyces cerevisiae
FT                   YGL136C MRM2 Mitochondrial 21S rRNA methyltransferase,
FT                   required for methylation of U(2791) in 21S rRNA; MRM2
FT                   deletion confers thermosensitive respiration and loss of
FT                   mitochondrial DNA; has similarity to Spb1p and Trm7p, and
FT                   to E. coli FtsJ/RrmJ"
FT                   /db_xref="GOA:C5E2B6"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B6"
FT                   /protein_id="CAR30177.1"
FT                   /translation="MTSPMLCALPKFLCQGQCLRWRVAVRFNSSAKSRWLDRQKGDSFT
FT                   REAKVQGLRSRAAFKLMHLDDKYHLFRKGSSQKVLDLGYAPGAWSQVALDRTGPNGVIL
FT                   GVDILPCAPPRGVSAIQGNILSKKTHELIRLFFSKHFQLYQEDQLHKDNGYFQHMLEQE
FT                   LEGLIPDGSKTGLQIDRSKVEKTPIDVIVSDMYEPWPQTTGFWNNITNSAYDRMANTTG
FT                   VAIKDHYMSMDLCDAALVTAIDLMKPGGSFVCKLYTGKEDKLLESRLKKAFENVHRFKP
FT                   SASRNESKELYFIGLKKKHKVDKLKVFSE"
FT   gene            <332634..>333287
FT                   /locus_tag="KLTH0H03652g"
FT                   /old_locus_tag="KLTH-ORF1781"
FT   CDS_pept        332634..333287
FT                   /locus_tag="KLTH0H03652g"
FT                   /gene_family="HOG000207014" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1781"
FT                   /product="KLTH0H03652p"
FT                   /note="highly similar to uniprot|P53030 Saccharomyces
FT                   cerevisiae YPL220W RPL1A and to uniprot|P53030
FT                   Saccharomyces cerevisiae YPL220W RPL1B N-terminally
FT                   acetylated protein component of the large (60S) ribosomal
FT                   subunit"
FT                   /db_xref="GOA:C5E2B7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B7"
FT                   /protein_id="CAR30178.1"
FT                   /translation="MSKITSTQIRDNVKEVLKYSNETKKRNFLETVELQVGLKNYDPQR
FT                   DKRFSGALKLPQCPRPNLSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLA
FT                   KKYSAFVASEVLIKQVPRLLGPQLSKAGKFPTPVSHNEDLYAKVTDVKSTIKFQLKKVL
FT                   CLAVAVGNIEMDEDTLVNQILMAVNFLVSLLKKNWQNVGSLVIKSTMGPPFRLY"
FT   gene            <333755..>335209
FT                   /locus_tag="KLTH0H03674g"
FT                   /old_locus_tag="KLTH-ORF1779"
FT   CDS_pept        333755..335209
FT                   /locus_tag="KLTH0H03674g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1779"
FT                   /product="KLTH0H03674p"
FT                   /note="weakly similar to uniprot|P53124 Saccharomyces
FT                   cerevisiae YGL134W PCL10 Pho85p cyclin recruits activates
FT                   and targets Pho85p cyclin-dependent protein kinase to its
FT                   substrate"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013922"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B8"
FT                   /protein_id="CAR30179.1"
FT                   /translation="MSGLPSILDESLDRIARGETELDISESMNEDSLDLDDPVDDDTFE
FT                   LPLKPRRRVLHASNFADLEAEPALDKRVRFEAAGPPWSPLSVEKIAVPEKGIMNSKPPK
FT                   LNPASSAGARKPHIEDLIQHAHSLNRYLDQNLDRINTFQSHLFEQGLEAPQNTGQILAS
FT                   NVATAPTTPSGSASNFQLSEIGDSSESLDYEQDIHDESISAAALQADSERDDRKIKQIL
FT                   SRHQTSTYPLSENQSSVNLAGDDSRSEVSALDHFRDLAASTRTSVATSSEDLFNMPHSP
FT                   VIHDLKFIIPKIAAQRPSAISSLGAGDDAEPPDMDCEAALALYTTTITLLLMMSKQSED
FT                   PKQEALPSFATFVMESVPTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDEEL
FT                   HCKHHLDPRQVHRLVIASIRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECLN
FT                   FEGLKITNQSLLDAAQVQQELSALAA"
FT   gene            <335581..>336233
FT                   /locus_tag="KLTH0H03696g"
FT                   /old_locus_tag="Klth0H.mRNA.at.275.p"
FT   CDS_pept        join(335581..335602,335689..336233)
FT                   /locus_tag="KLTH0H03696g"
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.at.275.p"
FT                   /product="KLTH0H03696p"
FT                   /note="highly similar to uniprot|P20606 Saccharomyces
FT                   cerevisiae YPL218W SAR1 GTPase GTP-binding protein of the
FT                   ARF family component of COPII coat of vesicles required for
FT                   transport vesicle formation during ER to Golgi protein
FT                   transport"
FT                   /db_xref="GOA:C5E2B9"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2B9"
FT                   /protein_id="CAR30180.1"
FT                   /translation="MWDLFGWFRDILSSLGLWNKHGKLLFLGLDNAGKTTLLHMLKNDR
FT                   LATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERL
FT                   NEARVELDALFNIAELKDVPFVILGNKIDSPNAVSETELRSALGLLNTTGGARIEGQRP
FT                   VEVFMCSVVMKNGYLEAFQWLSQYI"
FT   gene            complement(<336334..>339840)
FT                   /locus_tag="KLTH0H03718g"
FT                   /old_locus_tag="KLTH-ORF1774"
FT   CDS_pept        complement(336334..339840)
FT                   /locus_tag="KLTH0H03718g"
FT                   /gene_family="HOG000166882" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1774"
FT                   /product="KLTH0H03718p"
FT                   /note="similar to uniprot|Q08965 Saccharomyces cerevisiae
FT                   YPL217C BMS1 Essential conserved nucleolar GTP-binding
FT                   protein required for synthesis of 40S ribosomal subunits
FT                   and for processing of the 35S pre-rRNA at sites A0, A1, and
FT                   A2; interacts with Rcl1p, has similarity to Tsr1p"
FT                   /db_xref="GOA:C5E2C0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR007034"
FT                   /db_xref="InterPro:IPR012948"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C0"
FT                   /protein_id="CAR30181.1"
FT                   /translation="MDQSNKEHRKKSEKATAKKKLHTQGHNAKAFAVAAPGRMARNMMR
FT                   SSDVNERKLHVPMVDRTPEDDPPPVIVTVVGPPGTGKTTLIKSLVRRMTKSTLSEVNGP
FT                   ITVVSGKRRRLTFIECPADDLNSMIDIAKVADLVLLMIDGNFGFEMETMEFLNLAQHHG
FT                   MPRVLGVATHLDLFKSQSTLRATKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDREILN
FT                   LSRFISVMKFRPLKWRNEHPYLLADRITDITHPELLETQGKQIDRKVAIYGYLHGTPLP
FT                   STAGARVHLAGVGDYSISHVEKLPDPCPTPYFQQKLDEYERERVKEQGAGTTGAPRRRK
FT                   RLDDRQKLIYAPMSDVGGVLMDKDAVFIDVGGKKPGDGPSFVPGQEKGEGERLVTSLQS
FT                   VEKSISENFDGVGLQLFSNGQELHEADSDGENSVSEDEGDSNKDGGRKSLRKPKIYGKS
FT                   IQEEDEEIDNLESDEEMEAGASDDDRPRQRRLVEVDFDAGNDASVNAHTDSEFELSDHE
FT                   EELWNRSTASKLQGSKIRPRKWDIGKLIYMENIEPFDCIKRWKGELEDENEESGEQSEE
FT                   EDFFKQADKPENKNTEAEDDLEKFKPHFETFKKLAAKWSSFDSLKGRFAGRPNLEQSSA
FT                   DNDEDDEELYGDFEDLENGDQEAASEQDSHSSNEDGDDGSDGAGSDNSFADFEKEEKKD
FT                   LTTDQERERNAAKKESLRLQFEMEEGDNFKEDDPENEFDTWYELQKAKMAKQQEINNAE
FT                   LESMTPEQRQKIEGFKAGSYVRIVFDALPMEFVENFDARYPIIMGGLLPTELKFGILKA
FT                   RMRRHRWHKKILKTNDPLVLSLGWRRFQTLPIYTTTDSRTRNRMLKYTPEHSYCFASFY
FT                   GPLCSPNTTFCGVQVVANSDTTGNFRISATGIIEEIDASVEIVKKLKLVGYPYKIFRNT
FT                   AFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHFRATFEDKILLSDIIILR
FT                   SWYPVHIKKFYNPVTSLLLKNKSEWKGLRLTGQIRASQGLETPTNADSAYKKVERVERR
FT                   FNGLKVPSSVQKTLPFKSQIHQMKPQKKKTYMAKRAVVLGGEEKKARSFMQKVFTISNA
FT                   KDEKKKAKKQDERKERLKKLAKIEETKTEKEKERKKKFFSEHGKKRQFDSSADGASSKK
FT                   RR"
FT   gene            <340497..>343829
FT                   /locus_tag="KLTH0H03740g"
FT                   /old_locus_tag="KLTH-ORF1768"
FT   CDS_pept        340497..343829
FT                   /locus_tag="KLTH0H03740g"
FT                   /gene_family="HOG000065973" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1768"
FT                   /product="KLTH0H03740p"
FT                   /note="similar to uniprot|P53125 Saccharomyces cerevisiae
FT                   YGL133W ITC1 Component of the ATP-dependent Isw2p-Itc1p
FT                   chromatin remodeling complex required for repression of a-
FT                   specific genes repression of early meiotic genes during
FT                   mitotic growth and repression of INO1"
FT                   /db_xref="InterPro:IPR004022"
FT                   /db_xref="InterPro:IPR013136"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C1"
FT                   /protein_id="CAR30182.1"
FT                   /translation="MVLYKRKPIILPPPRPLPSNINVRVWHINESGEWFTKYTEYLERM
FT                   DFYMRRQFTCEITGTSCLTFFEALNSEEMQFRAVEEKFPLKLREPVAKFLHFNETRRVD
FT                   LLVEQVYSRFKKDFYPGERVYLRKKIAAPHTPSPTGQAVEENDKHTPMPLQNLQRPYLV
FT                   KEKASFNAVVDFATKEEIRSAYSKYMITEEFGSKSLMVDEDEIFRDRCTFTKHLIKCFC
FT                   KITLRRASTKIGAPLCVKDEYLSMYGLTLDWPPSMLQYKVDTPAEPVVPSDALSSPSAY
FT                   HGYSYQEEKSGKRPNDQIEGELPGIKRSKSPSVFPTPYDVNEFRETKATYNGPNRALQH
FT                   AFCYSQNLNRVPLNKPGSRFGKMNKLLEVYQFFQTFSKVLYVSPFCLDAFVFSLKYTDV
FT                   REMEGVKIQAITNIPGVRENTPEIADTPISEMSEIEKWAEEQIPGICEFLESQKTPLVS
FT                   YVLRKSRDLNDNFLNDIYSNGTALIIECFVALERLFIDENGEWRCLVMDQWYDSEEEEQ
FT                   PSDSTKSAHDDAHKIDDEGKSIVEKEDEISNPEVDDLLEKCLNYRNVNWSERLSKRQFK
FT                   NGSWLIILLGIFQDCIHLPMYTEFIQKFVKAIVPPEPTTPNLNKVLWQNFCENLRLEDK
FT                   LEALWVLVDVASNFSQDIKVFIEDTMEVCVQIRSERLKISKRLKTETANLVDLNVKLKE
FT                   LESSSEKILEITNDEVQAHISAQQEKIDNINKDRETLNQKLIENDIRRLNSLGMDRNGN
FT                   KYYWQELCGVQRTRGGKDADFGSGRLWVQGTALGDAKRLLHLPSKGASLWKKLLCNSTA
FT                   GQVVDQLFPGEGPAGNELVPVEYQEDGMVQPNLKHLVEGFSTLSPIQRKILDESIQGLL
FT                   LGEHAWAYIETPIEINVLITWLTEGGSVDQTLSRQARSIKPALLDTLDQKEKVYKTEQI
FT                   PENQEALLKRFEESKINETDAQACQGRTVSDHIPDDEKELEAIAEEIMALDDTASKTRT
FT                   ALNRIKELEERRDFLLNKRTFESHATRVQSRAQHQKISQEIEKKLDAQEAALNECWQLP
FT                   LSSSRAEAMNWKNELALSAWGLSLYAGATGKVKNGNQLSVKQRMADIFSSLLSYGQNDH
FT                   DNA"
FT   gene            <344164..>345174
FT                   /locus_tag="KLTH0H03762g"
FT                   /old_locus_tag="KLTH-ORF1765"
FT   CDS_pept        344164..345174
FT                   /locus_tag="KLTH0H03762g"
FT                   /gene_family="HOG000248113" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1765"
FT                   /product="KLTH0H03762p"
FT                   /note="similar to uniprot|P21560 Saccharomyces cerevisiae
FT                   YPL215W CBP3 protein required for assembly of ubiquinol
FT                   cytochrome-c reductase complex"
FT                   /db_xref="InterPro:IPR007129"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C2"
FT                   /protein_id="CAR30183.1"
FT                   /translation="MFRTLFVANKASSCSASTPLKAFRCLARAGYSVKANREEAKELES
FT                   PEELAQKSKLKAKPIDYSNNAPVNPKKKRPFLSGSKYESRVYQLPKWKEALGEIVIRSF
FT                   NLDMDKVRAGPVAGSYYYALCKEQGLQFENEPLSTTARFFYEDLKLPRTFSQWFQITIL
FT                   HEWILFVRMRAMPFKYGRNYQQKLVDRTFSDIELRLFDEMNVNSGRIADQYLKDFNSQL
FT                   RGAVFAYDEGLFTDDSTLAAAIWRNLFGGRKNVDMVHLEATVRYVRAQIYVLSKMSDRE
FT                   FAMGKFKFVSPDETVYRLTAQQEAEMKENVKRKYEEMDRNPDLLPSERSKLSYDN"
FT   gene            complement(<345221..>346837)
FT                   /locus_tag="KLTH0H03784g"
FT                   /old_locus_tag="KLTH-ORF1764"
FT   CDS_pept        complement(345221..346837)
FT                   /locus_tag="KLTH0H03784g"
FT                   /gene_family="HOG000214306" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1764"
FT                   /product="KLTH0H03784p"
FT                   /note="similar to uniprot|P41835 Saccharomyces cerevisiae
FT                   YPL214C THI6 bifunctional enzyme with thiamine-phosphate
FT                   pyrophosphorylase and 4-methyl-5-beta-hydroxyethylthiazole
FT                   kinase activities"
FT                   /db_xref="GOA:C5E2C3"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR003733"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C3"
FT                   /protein_id="CAR30184.1"
FT                   /translation="MFDKNKVDYSLYLVTDSTMLPPGTTLESQVEAALKNGVTLVQLRE
FT                   KETETKVFIEQALKVQKLCHKFQVPLIINDRVDVALAIDADGVHVGQDDMPIKMVRQLL
FT                   GPSKIIGWSVGYEHEVEQLAAMGPGAVDYIGLGMVYPTLTKKNPKKAPMGPRGVSKLLD
FT                   KLQSTNAEWCRTVAIGGLHPDNIPRVLYQIASSDGKRSLDGISVVSDIMASPEAGNAAQ
FT                   TLRALIDQSSFHYAQGLSPCRKDFSSELAKECVQQMTEASPLVQHITNKVHQNFGANVT
FT                   LALGSSPIMSEVEPEFEELSQISHATLLLNTGTVAPFNTLLQAMCAYNAAKRPIVFDPV
FT                   GYSATSTRLELNNQLLAYGQFACIKGNVGEILSLADLNKGKMRGVDAGSVGSDISLCVE
FT                   ATKIVAYRYRTIAVCTGQQDIVVDGTCGGTFELSEGSAARASDLPALIVEAGEIPVMGK
FT                   ITASGCSLGSTIACLVGGISDKQHLFHAVTTAVCLYKSAGKIASERCNGSGSFQVELID
FT                   ALDQLFTKNQPESWVAKVSRI"
FT   gene            <347049..>347747
FT                   /locus_tag="KLTH0H03806g"
FT                   /old_locus_tag="KLTH-ORF1763"
FT   CDS_pept        347049..347747
FT                   /locus_tag="KLTH0H03806g"
FT                   /gene_family="HOG000000976" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1763"
FT                   /product="KLTH0H03806p"
FT                   /note="weakly similar to uniprot|Q08963 Saccharomyces
FT                   cerevisiae YPL213W LEA1 Component of U2 snRNP disruption
FT                   causes reduced U2 snRNP levels physically interacts with
FT                   Msl1p putative homolog of human U2A' snRNP protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C4"
FT                   /protein_id="CAR30185.1"
FT                   /translation="MKITPSVVLDAPTYYVSHFNGVYDTEKCVVIRDLGIECDDEAMPA
FT                   VLAKLPKPTHVLDLTNNELNQIPDLSAHDEITTLLLGRNRISKIDGRRLPRRLRRLVLS
FT                   NNGVEQLAALEGLRDAPKTLENLSLRGNSVCHLEDYRVFALSRAPQLKTLDFTKISDQE
FT                   RNAGCKFRSSPGKDIAPSRQKFKDKNEEIMDVIVGKMSDEVRNRLKDELAAASTLDEIE
FT                   RIESLLSGGV"
FT   gene            complement(<348388..>352851)
FT                   /locus_tag="KLTH0H03828g"
FT                   /old_locus_tag="KLTH-ORF1760"
FT   CDS_pept        complement(348388..352851)
FT                   /locus_tag="KLTH0H03828g"
FT                   /gene_family="HOG000065972" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1760"
FT                   /product="KLTH0H03828p"
FT                   /note="similar to uniprot|P53127 Saccharomyces cerevisiae
FT                   YGL131C SNT2 22% sequence identity with S. pombe Snt2"
FT                   /db_xref="GOA:C5E2C5"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C5"
FT                   /protein_id="CAR30186.1"
FT                   /translation="MASESDASSRRRAVRKINYNEKDADADLVKRIQLMEKTRESVTSL
FT                   NKTKVSKNKYQSYLSSKSVTWNFIPSLPPSFRKHSRFSNILDLEDALIDVTTDTLSQDG
FT                   SALLKRNDHIYMVSEPPGEPYYIGRIVKFVAKPEFRSYIEESLEYVNTFPAKYFQVKMN
FT                   WYYRPRDVQDKIQNLNPRLLYASLHMDVCPIHSYRGKCNVVHRSALNISEESQNEQVWK
FT                   PNTFYFEQLFDRYTLKFYDIWSSRKQLLSLDPNSVYLISLANMYPFVFTEESFPIQKII
FT                   DKYVLGKETPDRETWDYKCGECGGWCEKTQRIKCDECQVYVHLFCLDPPLERKPIKGVI
FT                   WICSRCLHHDKESESLTEPHCQTLEFQTLQSRSGKKCALQSIPSNPENLWFHYLGSKVV
FT                   DFMDDILIPELVLPFPLKNSRIGPRYQWTGYEKEVEKGEPHNGPKNERGGDETSELLWK
FT                   FDSSRIGDKELNEYTHKCQKTFPPQLDVLPQTSNFLDMILKLLMSCNYNANEAFALCQK
FT                   LLSRETLQEPTFTTEEIKKFEEGVAEYGSELHPVCKHVGTQPMSMIVRFYYYWKKTPNG
FT                   RRIWGNYKGRRKNQKHANSASEHAVSSFGKKSRIRKPSKTLREDLSSSSKEWKHIDDSS
FT                   FDSEKISNVKTCFKCMFCEIDYSPLWYRVTGGCDDENIKTRMLTGVDEKTSTSHKLPHQ
FT                   SLKSKKSNENPSLEALCIRCARLWRRYAVKWISPLDVIRRLNGKYASSIRNALDELLAD
FT                   PADTTIKVAPNQLMEKCVEWELAQDAELILKQRFHMLDDTERYLKMKRNCISMHTQLNK
FT                   AVKKLVDKDPQADSKMQDELKEYVQSIMQEVRKKEKKAKAVKNKVKTSKAKENHKMIQT
FT                   SGEQRSFKNNLDTAAFKSSTTTLIDSNGEKNVEVKQERVLTSLNHTLPAGDHKLQVFVE
FT                   SGKKKIGEITVDSNFENLRLSEELYNYLLDLSSENASLQEKDSRTCDIVNVAKAESHIT
FT                   EESKKHYDPTCLQITNGSNVPILPGNDFSRVLETYHCHNPLHYEWSQGALPKVTNDFIQ
FT                   SVIRGVRPITQNNIGRKARNPAIAVEEPNCEGSLTPRNFCCVCLENFSHDYNEEITCSN
FT                   CGLNAHYFCYGFKPRVCRKSSKDEIKLKNLQWLCDTCSNDLNPICSTNYQCSLCNAKES
FT                   DYDGGKKRLSRSIPDALKITSNNTWCHVSCSLFNPDLSYNSLARLQIAGNIKSTLIKCG
FT                   GKACVICGVSGGGIVNCEECDFSCHVTCAQDYQKCSILFKKLYVDDDAQFYSVINDKGQ
FT                   KFQIKPIILCPKHQSYTKDTTALNYRNEKGTSFLEIYCNNNKCFEEMRSGTVKFRAMDN
FT                   RGGMALSQKFGSLFLGSQTSNPFGKVACKNCNKTSSIFWYNNVCHACHHHLSNSRSNLL
FT                   LNEASVVDEKATVNTVLTDYLLKGLESTKPSLPLGKKGIKRQNGSTALKGKKKFKSVEA
FT                   ETPSSGKPPLTMPVVVQNLSGKNMRV"
FT   gene            <352972..>354378
FT                   /locus_tag="KLTH0H03850g"
FT                   /old_locus_tag="KLTH-ORF1759"
FT   CDS_pept        352972..354378
FT                   /locus_tag="KLTH0H03850g"
FT                   /gene_family="HOG000162728" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1759"
FT                   /product="KLTH0H03850p"
FT                   /note="similar to uniprot|Q01159 Saccharomyces cerevisiae
FT                   YGL130W CEG1 mRNA guanylyltransferase (mRNA capping
FT                   enzyme), alpha subunit"
FT                   /db_xref="GOA:C5E2C6"
FT                   /db_xref="InterPro:IPR001339"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013846"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR017075"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C6"
FT                   /protein_id="CAR30187.1"
FT                   /translation="MDNRAAPEIPGIRQPANVTQDIRLLVCKLLNSPKPAKTFPGSQPI
FT                   SFHHSDIEEKLLQQDYYVCEKTDGLRGLMLIVINPVTKEQGCFIIDRENNYYQVNGFRF
FT                   PRLPKQSRKELLETFQDGTLIDGELVLQTNPVTKVKELRYLMFDCLAINGRCIVQSPTS
FT                   SRLAHLGKEFFKPYYDLRSLYPAQCATFPFKISMKHMSFSVDLVKVANSLDKLPHVSDG
FT                   LIFTPVTTPYVVGGKDSLLLKWKPETENTVDFKMILDIPKAEDTSLSKNDPNRFFYNYG
FT                   VKPSFHLYIWQGGADVNARLHDFEQPFSKKELEVLDRTYKKFADLDVSDSQWTELKSLG
FT                   EPLNGRIVECAKDQETGVWRMLRFRDDKLNGNYVSVVQKVLESISDSVKIEDLEEATAQ
FT                   MKSNWEKRQIEKKRGFQEVQDARRVTQPAPPTQPAPQNTEQPKYIDDDDEELWSDDDDE
FT                   SDTEAKRQKL"
FT   gene            complement(<354482..>355798)
FT                   /locus_tag="KLTH0H03872g"
FT                   /old_locus_tag="KLTH-ORF1757"
FT   CDS_pept        complement(354482..355798)
FT                   /locus_tag="KLTH0H03872g"
FT                   /gene_family="HOG000142042" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1757"
FT                   /product="KLTH0H03872p"
FT                   /note="similar to uniprot|Q01163 Saccharomyces cerevisiae
FT                   YGL129C RSM23 Mitochondrial ribosomal protein of the small
FT                   subunit"
FT                   /db_xref="InterPro:IPR017082"
FT                   /db_xref="InterPro:IPR019368"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C7"
FT                   /protein_id="CAR30188.1"
FT                   /translation="MSLIGVRNFSSSSLRAAAPTRGKAQGFAKKVSGAKTTGKKVSAGS
FT                   LYKPWQQTIATSNLNKNAFPVEVPTFKPSEISQCVDQVMSFSNAHYKYLYTLGSFKQNQ
FT                   FNELFPRPISMVRRNTTQKLFELLKNSPDRKFILTGESGIGKSVLLSQVHSLAFEENAL
FT                   VINISYPELFLNGTNDFFYDGASYVQPMYLKRLLNKILKANNKNLLSSIPISGNYKFAN
FT                   ADPKDSASRKFVQITGGKSTLLDLISVKTSPRNRGDLFQAVIQELSKQAKVPVVFTVDN
FT                   FSRITSEPKSAYKNSNNENIHVLELQLGKTIMEIVSGKVLFPHKLSAVVLATSGCDRTN
FT                   RTLPVGLQKQPHDPYVSRKHYDHDLACLLSKGNVREFPVNKLSKQELQNLLEFYYKAEI
FT                   ILSKDNNEKTIEQLVDEKYLLSGNGNPRELLKSLVLQFS"
FT   gene            complement(<356036..>357744)
FT                   /locus_tag="KLTH0H03894g"
FT                   /old_locus_tag="Klth0H.mRNA.cn.5.m"
FT   CDS_pept        complement(join(356036..357524,357593..357744))
FT                   /locus_tag="KLTH0H03894g"
FT                   /gene_family="HOG000213984" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="Klth0H.mRNA.cn.5.m"
FT                   /product="KLTH0H03894p"
FT                   /note="similar to uniprot|Q12211 Saccharomyces cerevisiae
FT                   YPL212C PUS1 Involved in tRNA biogenesis; intranuclear
FT                   protein which exhibits a nucleotide-specific intron-
FT                   dependent tRNA pseudouridine synthase activity"
FT                   /db_xref="GOA:C5E2C8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C8"
FT                   /protein_id="CAR30189.1"
FT                   /translation="MSETNNLRPAYDDDQPGEEAYKRGNQYKWTKARKADYEETGDDTE
FT                   SSNKKAKIDPTAEVKISGNEEVKEKRLPKRKVAVMIGYCGTGYHGMQYNPPTPTIEAEL
FT                   FRAFVEAGAISQANSKDLKKSGFMRAARTDKGVHAGGNVVSLKLIIEDPDIIAKINSKL
FT                   PEGIRVWDIERVNKAFDCRKLCGSRWYEYLLPTYSLVGPKPGSALYNDIEASKKEIPGV
FT                   MPDDEESAKFWASFFEEIEQKFTPEELELIKSYTPPPRDEFDDDDPTYQLVKNYKLIEN
FT                   AHRRAYRISESRLEAFRAAMKQYLGPHNFFNFTLGKEFKDPSAIRFMKEIKVSDPFVIG
FT                   ERNTEWVSIKIHGQSFMLHQIRKMISMATLVTRCSCPVDRITDAYKPQKINIPKAPALG
FT                   LLLECPVYEGYNKRLKEFGYNPIDFSKYQDKMDEFKMKHIYDKIYQEEVSENVFNAFFS
FT                   YIDNFSQVTGAQSVDDGTANPASAQKSVFDFLTARGIVPSTEESPKKEAEEAPQTAAPG
FT                   AISTSPSEGEMEASTNNPSKPSSNEPNVV"
FT   gene            <359019..>359564
FT                   /locus_tag="KLTH0H03916g"
FT                   /old_locus_tag="KLTH-ORF1751"
FT   CDS_pept        359019..359564
FT                   /locus_tag="KLTH0H03916g"
FT                   /gene_family="HOG000168475" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1751"
FT                   /product="KLTH0H03916p"
FT                   /note="highly similar to uniprot|Q08962 Saccharomyces
FT                   cerevisiae YPL211W NIP7 Nucleolar protein required for 60S
FT                   ribosome subunit biogenesis"
FT                   /db_xref="GOA:C5E2C9"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2C9"
FT                   /protein_id="CAR30190.1"
FT                   /translation="MRQLTEDETKVVFEKLAGYIGRNIKFLVDNKDQPFVFRLQKDRVY
FT                   YVPEHIAKLATSVARPNLMSVGLCLGKFTKTGKFRLHITALTILAQHAKYKIWIKPNGE
FT                   MPFLYGNHVLKAHVGKMSEDIPEHAGVIVFSMHDVPLGFGVSSKSTSESRDVQPTGIVA
FT                   FRQADIGEYLRDEDTLFT"
FT   gene            complement(<359677..>361488)
FT                   /locus_tag="KLTH0H03938g"
FT                   /old_locus_tag="KLTH-ORF1750"
FT   CDS_pept        complement(359677..361488)
FT                   /locus_tag="KLTH0H03938g"
FT                   /gene_family="HOG000000979" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1750"
FT                   /product="KLTH0H03938p"
FT                   /note="similar to uniprot|P38688 Saccharomyces cerevisiae
FT                   YPL210C SRP72 Component of the signal recognition particle
FT                   (SRP) ribonucleoprotein (RNP) complex that functions in
FT                   protein targeting to the endoplasmic reticulum (ER)
FT                   membrane"
FT                   /db_xref="GOA:C5E2D0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013699"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D0"
FT                   /protein_id="CAR30191.1"
FT                   /translation="MKDLTSLLSDLNVQYNSNKHFEAAKVCKELIEAGVEDKISVLGQW
FT                   LVSLIKSDCYKQGWDLLNQYDQELKGLYHLERLYIFYKLGYTKSFEKLYDELKDIEQAN
FT                   SFENRGLLHVRAQFCFKNGKFEEAVKIYQLLATHNEQQLDNETELACNERAAVGSTYQS
FT                   GYESLLVTSLNEDSYDLLFNESLIALRRGDLDLSLKYLNQASSLAAQEGSDDDQNAIEL
FT                   QKAYVLQASGEKSEAKDILNDLVSKTMAGSTMHLLAQNNLKSFHDFSKYTTNVSLLLRE
FT                   LDVAKLSGKVSSLGHEQQQIILNNVLFLNLFNGCGIQSKKSLVSKTLANYRKTIANVVL
FT                   EPYSTQAKKMFNRTMSAMSCGTGGSVFGSIVLTVQLQVLEKNFDGAIVLCESYLNKNSD
FT                   SVNYEHRVVCYILLQLYRESGRSSSSNRLLEHLFAIVKDNNVKEDPEFWRFVAFNLLAQ
FT                   GFGSKAEDMFAKLQRISPELQLFNSSSEQHDVLSSDLDSLVSSVDVESLKKLGAAPFEG
FT                   QRTRMRDTSLGKVAKKRRVHKNRKFPKDFDAEREPNPERWLPLKDRSDFRPKKKLAAKQ
FT                   TQGSAISRKSEQSLDISKKNRTKKGKK"
FT   gene            <361653..>363323
FT                   /locus_tag="KLTH0H03960g"
FT                   /old_locus_tag="KLTH-ORF1749"
FT   CDS_pept        361653..363323
FT                   /locus_tag="KLTH0H03960g"
FT                   /gene_family="HOG000065970" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1749"
FT                   /product="KLTH0H03960p"
FT                   /note="similar to uniprot|P53166 Saccharomyces cerevisiae
FT                   YGL064C MRH4 Mitochondrial RNA helicase plays an essential
FT                   role in mitochondrial function"
FT                   /db_xref="GOA:C5E2D1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D1"
FT                   /protein_id="CAR30192.1"
FT                   /translation="MNPLLRSMSHPVIRSLGSFRCSSTYARGAARIGGKNKSSRHSLVS
FT                   TIKKSPANRNKKDEPSSQIFHYGAFGGLKEINAQDSQKTAGILSKVTDFDQLKILPEVR
FT                   TAVKKVISRETIAKSPDLTEASEKDIKPSPVQVAVIQKLSKTLTNRQLQVHMVAAETGS
FT                   GKTMAYLTPLLDYLKRGEQDDPEGWDQIKDKAIVRSVILVPTHELVEQVYKTVKLNADL
FT                   LGLHAFRWNMDTSYNDFIEAVKARIDLLVTTPGKVLNMFKVRIINRPERLLSGVRFAVL
FT                   DEADTLMDRSWLEETHSAIKSFPNANHLIFCSATIPSEFSKTMDRLFPTSEAITTPKLH
FT                   KISQKIDFKLIDASLNPYKGSKLKALAQALYAIMKDGTEEGFEKRCLIFVNEKKDAKKV
FT                   AEQLTERYGHNCVSLTGEDAISERLDKISAFVNPPKRLNEAPSKLSDDSSKTVKREPTM
FT                   LPNSNIKLTTSSSNLHGKKNTSLKVLVTTDLMARGLNFQGVRNVILFDVPKTSIDLVHR
FT                   AGRTGRMMQGGRVFMIIDKKTKSWAKAVPKIVRNNKTLS"
FT   gene            complement(<363432..>364628)
FT                   /locus_tag="KLTH0H03982g"
FT                   /old_locus_tag="KLTH-ORF1747"
FT   CDS_pept        complement(363432..364628)
FT                   /locus_tag="KLTH0H03982g"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1747"
FT                   /product="KLTH0H03982p"
FT                   /note="similar to uniprot|P38991 Saccharomyces cerevisiae
FT                   YPL209C IPL1 Aurora kinase involved in regulating
FT                   kinetochore-microtubule attachments associates with Sli5p
FT                   which stimulates Ipl1p kinase activity and promotes its
FT                   association with the mitotic spindle potential Cdc28p
FT                   substrate"
FT                   /db_xref="GOA:C5E2D2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020663"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D2"
FT                   /protein_id="CAR30193.1"
FT                   /translation="MTTDTRGTIFGKLLGVMNGKSTAGSEMRRNSLHQRNLLLSMRLNS
FT                   GPGRKSLGTSSRGTTSHRLTKENWRASFSSGSSRLGVAPTFSGQKSLQDSRSRVSSPVK
FT                   VGADDGRSSPAKVPLLSGTKADSSPARYKDFTLDDFEIGKKLGKGKFGKVYCVKHKQTG
FT                   FICALKAMKKKEIIQYNVEKQFRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVN
FT                   GELYKHLRSHGPFNDIVASHFVYQMADALDYMHSKHIIHRDIKPENILLGFQNTLKLTD
FT                   FGWSVTNLNNSRRRTLCGTMDYLSPELIKSREYDNKVDVWALGVLTYELLVGTPPFLED
FT                   SKEMTYKRIKRRDLKFPDHISSQARDIISKLLEYEPNARIALRDVKKHPWILKNRPFW"
FT   gene            <365097..>366854
FT                   /locus_tag="KLTH0H04004g"
FT   CDS_pept        365097..366854
FT                   /locus_tag="KLTH0H04004g"
FT                   /gene_family="HOG000142041" [ FAMILY / ALN / TREE ]
FT                   /product="KLTH0H04004p"
FT                   /note="similar to uniprot|Q08961 Saccharomyces cerevisiae
FT                   YPL208W Hypothetical ORF"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D3"
FT                   /protein_id="CAR30194.1"
FT                   /translation="MQAEKLKVLLDWGLDNGVKCPDDVEFVNVGGKGFACIAKSDITEA
FT                   EFIIPESLIIKSSLAVSFFKVNSNQTSWLKLLIAKLKFDKSSTTVDDENLKAKFAPYID
FT                   ALPDEIDSPLVWNPSELDLLGNTNLRSSLRIKLYSIFNEWKLIMETLKKHRNEVQAEIL
FT                   NIEETLGQSEDHVYRNITSKVFQHSSETDWWSFPAFLWSHMMFLSRAFPEYVINPSTDP
FT                   SNVVLLPIIDLLNHDYRSKVEWNQRDGAFGVRKLETVLRGEEIFNNYGGKGNEELLSGY
FT                   GFVLEENIFDTVALKIQLPLTTVSEITSTTHLFLPTLSDYTTSAFELSSGKETKQMLPK
FT                   KDSQYKDGVLYLLSKENDAPLRWLLDLFSFLEKSPDESCSSLRVRLQGLQNLRNAIETK
FT                   LSSTSSTSDRQAAGYDIKEYRARAARIYKSGQTKALKHAVNELKRTEKEWTSQHKGDLL
FT                   TAKRIMRFDPNFMESELPLLLRTNANSDITLDSYDTLIILWVACKAVFNTCPREAQWAM
FT                   DAFKAYSDCRENTMASSAEGQHLYQTFFPNGSSRLGQEQFINATEFLQHFSYTRLSNGE
FT                   VILVKDVNL"
FT   gene            <367008..>369362
FT                   /locus_tag="KLTH0H04026g"
FT                   /old_locus_tag="KLTH-ORF1743"
FT   CDS_pept        367008..369362
FT                   /locus_tag="KLTH0H04026g"
FT                   /gene_family="HOG000216584" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1743"
FT                   /product="KLTH0H04026p"
FT                   /note="similar to uniprot|Q08960 Saccharomyces cerevisiae
FT                   YPL207W Hypothetical ORF"
FT                   /db_xref="GOA:C5E2D4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D4"
FT                   /protein_id="CAR30195.1"
FT                   /translation="MELSTKLTDHLVVCAVVAVYLISGGRLSIGISVAVLYALAIHDSG
FT                   RKVEVSEAGIIQAKSGVAGKPEKKTCCGGKGGSSCCSSGSGGKKGGCCGGSCASKKRAE
FT                   EKPASTGPVFESSASEPIAIDFTHAFKPARSSKPKSGAKKMPRFISRTAGSAKKDTGFF
FT                   KKALTVSNEKLSNSQIYVFYSSLQGAAERSAKTVLETLSGMPELKYEPKLLNLDELSDF
FT                   DDYFVNVPCSYALYILVLPSYDSDSPLDFFLQSLQENASDFRIDKYVLRKLVGYAVLGI
FT                   GDSESWPEKFCYQARQADLLLAKQGGRRVFPVGEICMKFGGDPKVSEWSKLLAETLCDD
FT                   EPILYEYDETLDDEEPQDPEDELTKEPLIDLEDVGKSSELQDVSSVKKMIVKDSPTFKN
FT                   LTKQGYTVVGSHSGVKICRWTKNDLRGRGSCYKHSLFNIVSSRCMELTPSLACSSKCIF
FT                   CWRHGTNPVSKTWRWEVDDPEYILENALQGHYAKIKQMRGVPGVIAERFAKAFKVRHCA
FT                   LSLVGEPIMYPFISKFVSLLHQKEISSFLVCNAQHPEPLRDLGKVTQLYVSIDAPTKNE
FT                   LKKVDRPLYRDFWERLMECLDILRTTQSHQRTVFRMTLVKGFNMADVSAYADLVQRGLP
FT                   CFIEVKGATFCGTSDGNGNPLTMQNIPFYEECAKFVKSLAAELQRRGLGYDVAAEHAHS
FT                   NCILIASTKFKINNEWYTHIDFDRFFELLNSGKDFNHMEYLQKTPEWALFGNGGFAPGN
FT                   TRFYKKKRGQEAQAKEEQGLQENVSTQPINA"
FT   gene            complement(<369508..>370734)
FT                   /locus_tag="KLTH0H04048g"
FT                   /old_locus_tag="KLTH-ORF1739"
FT   CDS_pept        complement(369508..370734)
FT                   /locus_tag="KLTH0H04048g"
FT                   /gene_family="HOG000142040" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1739"
FT                   /product="KLTH0H04048p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D5"
FT                   /protein_id="CAR30196.1"
FT                   /translation="MIKRAFNTTVNRFENTQGDWGYLKQRLTQLKEEAAPDDNDALCGL
FT                   IKGVVKENPSIEKLYDELPRKEYEDRFRSQIQASKLKRFVNKESRETALSRPWTGEEHY
FT                   TDTSLRMIMDGVKNEGGSSGSSRNLGFSSTFQATKESNRYARRAVKTRLRLETAQDRII
FT                   DYKIDKDEHKSDDIEASEFRVLYAEKFTPIGSFEKLKSIADVRIEESMKKGEFDSVKKI
FT                   RGQKLSSTQPLPYVDRTEHHLNDILVRQNISPPWIEKQGSVNKDIMVFRDDLLRKFQSE
FT                   LIAALNLRGFFRTEVPSNSELNQHGKLNSVKESVFSDWKSTLKIGSRIKQLNDSLRSYN
FT                   LQAPLPAQKFYLQADRELQRVLKETDISRLYRDEFSRQKVLHNNAKAANESQATSNSQF
FT                   SWPKKWRIW"
FT   gene            <370823..>372388
FT                   /locus_tag="KLTH0H04070g"
FT                   /old_locus_tag="KLTH-ORF1738"
FT   CDS_pept        370823..372388
FT                   /locus_tag="KLTH0H04070g"
FT                   /gene_family="HOG000177048" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1738"
FT                   /product="KLTH0H04070p"
FT                   /note="similar to uniprot|P43636 Saccharomyces cerevisiae
FT                   YGL065C ALG2 Mannosyltransferase mannosylates Man2GlcNAc2-
FT                   PP-Dol to form Man3GlcNAc2-PP-Dol which is a precursor
FT                   required for asparagine-linked protein glycosylation"
FT                   /db_xref="GOA:C5E2D6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D6"
FT                   /protein_id="CAR30197.1"
FT                   /translation="MQGKQEAMKRGNNEGSLPKLNIAFVHPDLGIGGAERLVIDAAVGL
FT                   QQQGHEVVIYTSHCDKNHCFEEVKSGEIKVEVFGDFLPTNLAGKLFIMFANLRQLYLTT
FT                   KLMSKGKIHHHDLFIVDQLSTCVPLLSAFGNRSRVLFYCHFPDQLLAQRTNLIKSLYRI
FT                   PFDLLEQLTMNAADCIVVNSNFTKSVYKRTFRLFSQKPNVVHPCVGLETELVQDKDFAL
FT                   YKKLFPPSTRFYLSVNRYERKKNIELAIKSFALSTESKRSNVKLVIAGGYDDKVLENKE
FT                   YLKELQNISKNSNLPYFTLHYAHWDQQLSDSGISGATDAKVLFLTSISSSLKDQLLRET
FT                   DLLLYTPSFEHFGIVPLEAMKLGKPVLAVNNGGPLETIVSLIPNTNENNSTGWLRPSDP
FT                   KEWADAIEESRDFIKEVDNIFKNNGPERVKKLFSRTAMTNQFEKNIQDISWKTDKKSWL
FT                   GYIMFISSVLSVIFPAALLMGCNSLSFCVLNATLVILFHSVPTLMCIVSAVLLTRLFEV
FT                   LIQK"
FT   gene            complement(<372453..>374153)
FT                   /locus_tag="KLTH0H04092g"
FT                   /old_locus_tag="KLTH-ORF1736"
FT   CDS_pept        complement(372453..374153)
FT                   /locus_tag="KLTH0H04092g"
FT                   /gene_family="HOG000142039" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1736"
FT                   /product="KLTH0H04092p"
FT                   /note="some similarities with uniprot|P53165 Saccharomyces
FT                   cerevisiae YGL066W SGF73 SaGa associated Factor 73kDa
FT                   Probable 73KkDa Subunit of SAGA histone acetyltransferase
FT                   complex"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D7"
FT                   /protein_id="CAR30198.1"
FT                   /translation="MTDIHSEIKGLRKDIQKDLEPRTASSTPNWKELISIAKSERSKSE
FT                   KPPSHSDYFRDSASIIKNPLDKPLDYRICDGCGKPVSLSAIVEHLQTYCKGLPEHPLPN
FT                   SVKVEEQEQPVDMSSSSIKKKNNPSNSKRSTPFGHDPDPESSPAIKKQRKTTATPASSK
FT                   AKRRIKQRNPTEKHLIDFDKQCGVELPEGGYCGRSLTCKSHSVGTKRAVEGRSEPFDVL
FT                   LSHYQKKNQLKTGNNTKLRAKPGQQSNSTNQGHSVHSGDGSMSTLTPEEETTQVLNGVS
FT                   RSFPLPLETNVLASSRSRTKYFRMREMFASSFSVRPGFSAPGYGAIHSRVGCIDLDRTT
FT                   DYTFRIRTPQLINQMNPNNLTPQQKQKLQQQRMLQAQMLAQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQHQQQQQQQQQQQQQLQNQSRQGSQTQHFNPVPQQYQNHPQSQQLSNGLVQPKN
FT                   YTSLSQGDLETGLTPQGIQKQQQRLRQQQVQQQRFEAAAFHLATATKLMQSGPKPQNTG
FT                   MVNGTASSVGSPVNMASNSRSNSSPLNQTTGQQLNSRVSNAEYDSGGAS"
FT   gene            complement(<374596..>375561)
FT                   /locus_tag="KLTH0H04114g"
FT                   /old_locus_tag="KLTH-ORF1731"
FT   CDS_pept        complement(374596..375561)
FT                   /locus_tag="KLTH0H04114g"
FT                   /gene_family="HOG000000980" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1731"
FT                   /product="KLTH0H04114p"
FT                   /note="similar to uniprot|Q08959 Saccharomyces cerevisiae
FT                   YPL206C Endoplasmic reticulum protein of unknown function"
FT                   /db_xref="GOA:C5E2D8"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D8"
FT                   /protein_id="CAR30199.1"
FT                   /translation="MATAKIIGHRAYRGYYPENTILAFNKAKEANVDVIETDLQMSKDG
FT                   VVVINHDQDTQRCWDKNYVISETNWDALQSLNCKDARFQDQKMPSLKQVLRWIVDNPSM
FT                   KLMLDIKFTNDQEIMLKSVAEMLSTKEDLLFWRERVIWGLWTVDWFRYGMETGVIKDFQ
FT                   VACISLSLEVAKSFVEYSRELNSPHFRLSGVSMHFVSTWSKTFQKKWLHYFQQNNVEIF
FT                   VWTINHAVDFKYCNALPISGFVTDFPVEARGAIGQYERSKTTFKRPFFISREGFRFYGF
FT                   LVIYRLTIEFLFSPWAQYKVFGNFSFSLLFIKFMRIIHFL"
FT   gene            complement(<375792..>376874)
FT                   /locus_tag="KLTH0H04136g"
FT                   /old_locus_tag="KLTH-ORF1729"
FT   CDS_pept        complement(375792..376874)
FT                   /locus_tag="KLTH0H04136g"
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1729"
FT                   /product="KLTH0H04136p"
FT                   /note="similar to uniprot|P53164 Saccharomyces cerevisiae
FT                   YGL067W NPY1 NADH diphosphatase (pyrophosphatase)
FT                   hydrolyzes the pyrophosphate linkage in NADH and related
FT                   nucleotides localizes to peroxisomes"
FT                   /db_xref="GOA:C5E2D9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2D9"
FT                   /protein_id="CAR30200.1"
FT                   /translation="MSTLATRPLTHSLHYSQEVLNRVSFLRKDPQFLEDALAHNETQFV
FT                   PFDNYLPYVNERTGFILKLKKAEVANLTSQGSISSNLVFLGLLLSQKSDFVYKSKYRGT
FT                   PTFAIDVSIQRLSDSSLLDSSKPYKKVESFRDLNKLTVEDSSIVSQARMYLQWLDTHKF
FT                   CSLCGSKTKPVYAGTQLKCDNDDCKSNKSVSNSCFPRTDAVVISAITNKDYSKILLCRS
FT                   GMPRNKERKLYSCVSGFVEPSETLEVAVAREIWEETGLDTQEVEIIASQPWPFPNNLMI
FT                   GCVAIADDTQTPDLTHDCELDEVRWVPCSALERILKLEDSESGFIQDESTGLNLPNDRS
FT                   IAHMLMGFVVKKSAELRKGP"
FT   gene            <378344..>379798
FT                   /locus_tag="KLTH0H04158g"
FT                   /old_locus_tag="KLTH-ORF1726"
FT   CDS_pept        378344..379798
FT                   /locus_tag="KLTH0H04158g"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1726"
FT                   /product="KLTH0H04158p"
FT                   /note="similar to uniprot|P29295 Saccharomyces cerevisiae
FT                   YPL204W HRR25 Protein kinase involved in regulating diverse
FT                   events including vesicular trafficking gene expression DNA
FT                   repair and chromosome segregation binds the CTD of RNA pol
FT                   II homolog of mammalian casein kinase 1delta (CK1delta)"
FT                   /db_xref="GOA:C5E2E0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E0"
FT                   /protein_id="CAR30201.1"
FT                   /translation="MDLRVGRKYRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRSR
FT                   HPQLDYESRVYKYLSGGIGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSFKT
FT                   VIMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFSTHH
FT                   HIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKR
FT                   QKYDRIMEKKLCINVDQLCAGLPMEFVEYTRYCRNLRFDERPDYLYLARLFKDLGIKLD
FT                   YHNDHLFDWTMLRYTKAMIEKQRALGEQPQQPDEGKDEESKTESFNRVKQLAMKKFSTH
FT                   FHYCKPEDKHHPSPEEIKQQTAQNNNAASSIPQDLLSAIDKDMDSLKQNVVQAPEAVPQ
FT                   PSLQPQMQQQQYQPVQRQAPIAEPLLQRQQEQQQGQQERQLDALQSATNNASPYAPQQS
FT                   QARKPALNTTQYPPANAGPSGGDIWL"
FT   gene            <381111..>382172
FT                   /locus_tag="KLTH0H04180g"
FT                   /old_locus_tag="KLTH-ORF1721"
FT   CDS_pept        381111..382172
FT                   /locus_tag="KLTH0H04180g"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1721"
FT                   /product="KLTH0H04180p"
FT                   /note="highly similar to uniprot|P06245 Saccharomyces
FT                   cerevisiae YPL203W TPK2 Involved in nutrient control of
FT                   cell growth and division cAMP-dependent protein kinase
FT                   catalytic subunit"
FT                   /db_xref="GOA:C5E2E1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E1"
FT                   /protein_id="CAR30202.1"
FT                   /translation="MEYQNEGYGHSVVPDRPGMGERQRSLLPQRSAVSKGKYSLNDFQI
FT                   LRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTNDERRMLKLVDHPFLI
FT                   RMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHDII
FT                   YRDLKPENILLDRNGHIKITDFGFAKEVDTVTWTLCGTPDYIAPEVIATKPYNKSVDWW
FT                   SLGILIFEMLAGYTPFYDATPMKTYEKILQGKVAYPPFFHPDVVDLLSKLITADLTRRL
FT                   GNLQSGPQDVKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYPEEQLDYGS
FT                   QGDDPFMQYFIDF"
FT   gene            complement(<382391..>382903)
FT                   /locus_tag="KLTH0H04202g"
FT                   /old_locus_tag="KLTH-ORF1718"
FT   CDS_pept        complement(382391..382903)
FT                   /locus_tag="KLTH0H04202g"
FT                   /gene_family="HOG000248814" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1718"
FT                   /product="KLTH0H04202p"
FT                   /note="similar to uniprot|P53163 Saccharomyces cerevisiae
FT                   YGL068W MNP1 Protein associated with the mitochondrial
FT                   nucleoid"
FT                   /db_xref="GOA:C5E2E2"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR015607"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E2"
FT                   /protein_id="CAR30203.1"
FT                   /translation="MLVRGTRRSALKLARLPAVRARACVRLNSTQAAASVDPKIEKIVQ
FT                   DISKLTLLETSALISELKTQLNIPDIAMPVAGAAPAGAAAPAAEEAKEEEVKEEKTIFA
FT                   IKLESFDAKSKPKVIKEVKNLLGLSLVEAKKFVEAAPKILKDNVAKEDADKIKASLEAL
FT                   GAKVALE"
FT   gene            <383808..>384176
FT                   /locus_tag="KLTH0H04224g"
FT                   /old_locus_tag="KLTH-ORF1713"
FT   CDS_pept        383808..384176
FT                   /locus_tag="KLTH0H04224g"
FT                   /gene_family="HOG000228134" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1713"
FT                   /product="KLTH0H04224p"
FT                   /note="highly similar to uniprot|P27999 Saccharomyces
FT                   cerevisiae YGL070C RPB9 RNA polymerase II subunit B12.6
FT                   contacts DNA mutations affect transcription start site"
FT                   /db_xref="GOA:C5E2E3"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR019761"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E3"
FT                   /protein_id="CAR30204.1"
FT                   /translation="MTTFRFCRDCNNMLYPREDKDNQRLLFECRTCTYAEEAGTPMVYR
FT                   HELITNIGETAGVVQDIGSDPTLPRSDRECPRCHSHENVFFQSQQRRSDTSMVLFFVCL
FT                   GCSHIFTSDQKNKRTAFS"
FT   gene            complement(<384406..>385968)
FT                   /locus_tag="KLTH0H04246g"
FT                   /old_locus_tag="KLTH-ORF1711"
FT   CDS_pept        complement(384406..385968)
FT                   /locus_tag="KLTH0H04246g"
FT                   /gene_family="HOG000144389" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1711"
FT                   /product="KLTH0H04246p"
FT                   /note="similar to uniprot|P22149 Saccharomyces cerevisiae
FT                   YGL071W RCS1 Transcription factor involved in iron
FT                   utilization and homeostasis binds the consensus site
FT                   PyPuCACCCPu and activates the expression of target genes in
FT                   response to changes in iron availability"
FT                   /db_xref="InterPro:IPR014842"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E4"
FT                   /protein_id="CAR30205.1"
FT                   /translation="MDQSALDAFHGELIQTSPSLDFLLAEDSPLSTVDTVGTGTTSNTE
FT                   SSGPDFTNGTPSWNDTASLNNMLSENALESINRQRSQNKLIHLDPIPDFQDRNEIKPWL
FT                   QKIFYPQGIEIVIERSDNIKVVFKCKASKRGRASRKQAGCGSLPEEKENPESPLAVKRV
FT                   QQANKKKRSVSPYNTCPFRVRATYSLKRKKWNIVVMNNGHSHPLKFNADSDDYKKFKNY
FT                   LRENEDWDAVKKFDELECRTRFNLPTQPQPIPCDCGLTQEIESFNIVLPTSDSLANSTD
FT                   KTVSKPRHKSTRKGNKQMATALSRNSTPLGFLDKSPSQSARSGQEPQRIKQESTGAPQE
FT                   PHSGMTGLSPMQNFDTSMSGWDPNTLTSQSEEIDFTDLFLRPLPRTKQDPIFEKPQTLN
FT                   SPGRDQPWNASKNFMDDLQFQLAPVCEPSHTSNAHCILPSSTEAHMNCDAMDAGSQHEF
FT                   PHHRVQQQDPSMLHSSPANGMLSSDLGNMHLTGQQMQVPHPDPGLPWEPQHSNDPHGYS
FT                   NDF"
FT   gene            complement(<386347..>387456)
FT                   /locus_tag="KLTH0H04268g"
FT                   /old_locus_tag="KLTH-ORF1707"
FT   CDS_pept        complement(386347..387456)
FT                   /locus_tag="KLTH0H04268g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1707"
FT                   /product="KLTH0H04268p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E5"
FT                   /protein_id="CAR30206.1"
FT                   /translation="MGIPVTIFDGGLLWPNGGIKGFFESCQSEHVEHASRPGLAQRRSS
FT                   GWDLDSGPCWRLERAYTCEDTELTRLPSYKRVDGQFWCFWRPDGSKVGIVAADGNTVLS
FT                   NSMSLSLPSGISAMDIVNAHSVAFGTYDGVHGMYDLGTNRVVYANTSFSQPITHVWCRV
FT                   TADGGSVVTFSSHNTSISVVGLSGVRSETTFLRGGQPTLRPIESVDLNAAATKIAMCDA
FT                   RNVWVHELTSYTYQPVPGLFLQEGEFVVSLKFASTRDSLLVATSQRLLIYEPGTTYAVP
FT                   VCNMRHGAVFEFFEEDSRIMVEQQHLYGTHMACFALDEHTSQWSQVGYSDVRAQFGIRK
FT                   VHYFFALRSQLHVLSDSGNYSRFTSTEDY"
FT   gene            complement(<387890..>389599)
FT                   /locus_tag="KLTH0H04290g"
FT                   /old_locus_tag="KLTH-ORF1704"
FT   CDS_pept        complement(387890..389599)
FT                   /locus_tag="KLTH0H04290g"
FT                   /gene_family="HOG000184677" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1704"
FT                   /product="KLTH0H04290p"
FT                   /note="similar to uniprot|P10961 Saccharomyces cerevisiae
FT                   YGL073W HSF1 Trimeric heat shock transcription factor
FT                   activates multiple genes in response to hyperthermia
FT                   recognizes variable heat shock elements"
FT                   /db_xref="GOA:C5E2E6"
FT                   /db_xref="InterPro:IPR000232"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E6"
FT                   /protein_id="CAR30207.1"
FT                   /translation="MQANNAHHSAGPALNEDEIENIINPSDPIVGGTHGTGLGADDGSH
FT                   SVVEDIVNPSWDPAMTMSPGQLDHPSQNIAPFSPFMANSPLAAPPDHNNVIRRGTPVGL
FT                   YQQQGSPSQPPAADSLLSDSILMPYRNRLLKQSRPKTSSPQPPPRRKLTTTKTRPAFVN
FT                   KLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMYGWH
FT                   KVQDVRSGSIHGNSDERWQFENENFVRDCEDLLENIVRQKPSTNPSKDVLVGQNGEEMD
FT                   IGILLSELETVKFNQIAIAEDLKRMSKDNELLWKENMMARERHQAQQQALNKILHLLAS
FT                   LMGSNTQKLLGSDLVNELAQTNANLNDASNVAHGGWDLANMNGLTRPRLLLKNRTPATS
FT                   QHSSTGDLSSLHIGHSNSPIQEIDRSSIYPSNGSSSAGASTTPGGGRAPDTMLESNSPV
FT                   DTSFFNDLHSNIKKQGESIQELQDWITKMSPSQEELGSITPEGTVPQQLAQSPAKTQQP
FT                   NSKFDLQDYLSTSDPSALAPLLPEEPLVQEEKRSSDSDIEEISNPPKKQRTS"
FT   gene            <390454..>391614
FT                   /locus_tag="KLTH0H04312g"
FT                   /old_locus_tag="KLTH-ORF1700"
FT   CDS_pept        390454..391614
FT                   /locus_tag="KLTH0H04312g"
FT                   /gene_family="HOG000190872" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1700"
FT                   /product="KLTH0H04312p"
FT                   /note="weakly similar to uniprot|P53159 Saccharomyces
FT                   cerevisiae YGL075C MPS2 Essential membrane protein
FT                   localized at the nuclear envelope and spindle pole body
FT                   (SPB) required for insertion of the newly duplicated SPB
FT                   into the nuclear envelope potentially phosphorylated by
FT                   Cdc28p"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E7"
FT                   /protein_id="CAR30208.1"
FT                   /translation="MDTERHATLLLDLVWPEVDEKAQGFIYAKDFPLVVSRMEEILNRG
FT                   KLERDRAQLVSETGREILRKFGSDQEFFKVYKEDFRELFDGLVGTSFKSAVKSCAGDGV
FT                   LDRLQDSQAVDGIQDEKTSSHALQEEVMRLREQVRVLSSKNDEKDREITARDEIIADLQ
FT                   GKDASPAGSPRSLQRMRTLQARVTSLEDELSFRDEVIREKDRELLNLTKRVGEFKDKYQ
FT                   FLEREFQFYKGHREQKSPDSIKEATRHEFIISELRRKITEQSEIIGQMRMQVEAKPGAL
FT                   HPQGIGSTAGLPLNLPLRLVLRLIIGAILAYLAFDIGIRSLKAVGGLFGSSSPATLTPK
FT                   SELSWWEQNTLLSKLLWFFKDLFDTYNLDAGRDEVVSANYDKLFGV"
FT   gene            complement(<391678..>392478)
FT                   /locus_tag="KLTH0H04334g"
FT                   /old_locus_tag="KLTH-ORF1698"
FT   CDS_pept        complement(391678..392478)
FT                   /locus_tag="KLTH0H04334g"
FT                   /gene_family="HOG000205925" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1698"
FT                   /product="KLTH0H04334p"
FT                   /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
FT                   YPL199C Hypothetical ORF"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E8"
FT                   /protein_id="CAR30209.1"
FT                   /translation="MSAAAVASRGQPLSQERDYNHATDSEYKRLRDLADQAYKKRQQLS
FT                   QQSQNAYKNGDRSGAHTLSEQAKEQLQVAEKYNLQAAEFVFTQNNADSSSNEIDLHGLY
FT                   TKEAVWILQKRIAAAVSARESVLKVIVGKGLHSANGIAKIKPAVEDLCQQANLPNYVDS
FT                   KNAGVLVIELQNASVPASWSSTDYATYAHGVPSKPQASHQAQQHQYTGQQQPQYQQQQQ
FT                   SQYQQQQSNYQQQQQQQQSQSQAGNNDLLSTLLGLLCTCVRKNL"
FT   gene            <393543..>394142
FT                   /locus_tag="KLTH0H04356g"
FT                   /old_locus_tag="KLTH-ORF1692"
FT   CDS_pept        393543..394142
FT                   /locus_tag="KLTH0H04356g"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="KLTH-ORF1692"
FT                   /product="KLTH0H04356p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:C5E2E9"
FT                   /protein_id="CAR30210.1"
FT                   /translation="MLQDPVRSYPRTKFWSAVSESVHVSAGLTRNSRQCRDRFNLLFSR
FT                   ALLTDGQDVGAGVGLGTDATLDAKLAQCTARFRFGNGRSLELKQRRSHVQAPTRVPQRG
FT                   CAVHELIHPPEHTPGPMPEPGPLPSPAPGPTPADLSLIHTQLREVHRVLEALTAEVVGI
FT                   QHQVRHLQQAFRELQDARQNQKPPVACDEDSVNRDK"
FT   gene            <394987..>395091