(data stored in ACNUC7421 zone)

HOGENOMDNA: LEGLN_2

ID   LEGLN_2; SV 1; empty ; DNA; empty ; PRO; 71826 BP.
XX
AC   NC_014544;
XX
PR   Project: 46099;
XX
DE   Legionella longbeachae NSW150 plasmid pLLO, complete sequence.
XX
OS   Legionella longbeachae NSW150
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Legionellales;
OC   Legionellaceae; Legionella.
XX
RN   [1]
RX   PUBMED; 20174605.
RA   Cazalet,C., Gomez-Valero,L., Rusniok,C., Lomma,M., Dervins-Ravault,D.,
RA   Newton,H.J., Sansom,F.M., Jarraud,S., Zidane,N., Ma,L., Bouchier,C.,
RA   Etienne,J., Hartland,E.L. and Buchrieser,C.;
RT   "Analysis of the Legionella longbeachae genome and transcriptome uncovers
RT   unique strategies to cause Legionnaires' disease";
RL   PLoS Genet. 6 (2), E1000851 (2010)
XX
RN   [2]
RP   1-71826
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (30-SEP-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-71826
RA   Rusniok,C.;
RT   "Direct Submission";
RL   Submitted (06-JAN-2010) Rusniok C., Unite de Biologie des Bacteries
RL   Intracellulaires, Institut Pasteur, 25, 28 rue du Docteur Roux, 75015,
RL   FRANCE
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to FN650141.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..71826
FT                   /strain="NSW150"
FT                   /mol_type="genomic DNA"
FT                   /organism="Legionella longbeachae NSW150"
FT                   /plasmid="pLLO"
FT                   /db_xref="taxon:661367"
FT   gene            328..1275
FT                   /db_xref="GeneID:9772740"
FT                   /locus_tag="LLO_p0001"
FT   CDS_pept        328..1275
FT                   /locus_tag="LLO_p0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0001"
FT                   /codon_start="1"
FT                   /product="putative chromosome partitioning protein ParA"
FT                   /transl_table="11"
FT                   /note="equals pllo0001"
FT                   /db_xref="GI:308051506"
FT                   /db_xref="GeneID:9772740"
FT                   /translation="MKKKIPKILVVANNKGGVGKSLISQLISTYVAFKKNKKVLVLDFD
FT                   PQGNMSYRFLRDTRIRDMSNYKPPLHPDFDPNDPDDDGWDGRSSALDMWTENPVVPYPT
FT                   DLENLEILPSDAGLIKDIEAFEYSDSLESIVQRPYDFFEMDEFIDCGYDLILIDTPPAK
FT                   GPLTQSAIRAATHVLIPLELSNKSLQGLAGMVDLVNRQNVYRPANAQAKIIGLLKNKVD
FT                   YNKRTPQNRIVDTIKANPLLAKLLIEDIEVHDSPRAVDIDEDQAPITAPYTELKDNDRF
FT                   AIEAVALGEFVYNEVLGDKGNVTQKENNHEIDYI"
FT                   /protein_id="YP_003915080.1"
FT   gene            1232..2356
FT                   /db_xref="GeneID:9772666"
FT                   /locus_tag="LLO_p0002"
FT   CDS_pept        1232..2356
FT                   /locus_tag="LLO_p0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0002"
FT                   /codon_start="1"
FT                   /product="putative chromosome partitioning protein ParB"
FT                   /transl_table="11"
FT                   /note="equals pllo0002"
FT                   /db_xref="GI:308051507"
FT                   /db_xref="GeneID:9772666"
FT                   /translation="MSLKKKIITKSITSNKINKPDTVTRAGITANLKFTRGKQLVEQDP
FT                   FSLIPDPFNPRPGEVIDENWLRQHLFIGSEKSLCKYSDETGEFNIPEFSQLIIEPNEGI
FT                   EESYSFLRELAFSIRTDGLIEPIEIFLTDRQNDPDYFQNTNLDYGYVILEGHQRRLAAM
FT                   MAGVSTVTCIEITDESMLVKLKVKHRKLRRQLSENNLRKGLTVSQNFLIFQQLLSDTSV
FT                   QSLKNKEISSIIGLGEGIVSALRTICSKPENYPPILFSKINDNTLTFKMIRALAPKSYE
FT                   EIELALSQSNSSQIPNKKKVVKSRGRQGGATKKYATFKIGDQKESDSLQRFLLSRFPEI
FT                   SNLELPDSSYKSLEIILNKIKELALEEEICPGAN"
FT                   /protein_id="YP_003915081.1"
FT   gene            2429..2902
FT                   /db_xref="GeneID:9772667"
FT                   /locus_tag="LLO_p0003"
FT   CDS_pept        2429..2902
FT                   /locus_tag="LLO_p0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0003"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0003"
FT                   /db_xref="GI:308051508"
FT                   /db_xref="GeneID:9772667"
FT                   /translation="MIEKRKSKKLFFQAPQKKEKWLVCIRFPKDIKEKLRKQAESDYKG
FT                   RGKQSLLIEDAVKYYLYTLSDIKWGDYEKDLDYAELIDDIFEGLNQAPLEGATQVFFTE
FT                   ETKNRILEIEKKIKLTKPLMKDVRTGLIRKAVSIRLSLGDKNFFDSIMNMENF"
FT                   /protein_id="YP_003915082.1"
FT   gene            3036..4490
FT                   /db_xref="GeneID:9772668"
FT                   /locus_tag="LLO_p0004"
FT   CDS_pept        3036..4490
FT                   /locus_tag="LLO_p0004"
FT                   /gene_family="HOG000064534" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0004"
FT                   /codon_start="1"
FT                   /EC_number="3.1.3.1"
FT                   /transl_table="11"
FT                   /note="equals pllo0004"
FT                   /db_xref="GI:308051509"
FT                   /db_xref="GeneID:9772668"
FT                   /translation="MHAVRGQQKGVVYLHWLNAITTFSFAILFSSLSLYLTKNIALTQM
FT                   QSNGVVGFFLASNFILHFVAGYIGDRFLSNRLLFAISTIIQTLGLIVLNFYDSFVYLGL
FT                   SLFLIGCGLGSTCINCLITQQFTSNENELREKAFFYNYSAMNIGFLSGYVMSGFIDIND
FT                   RYDHLFEVSNLINLITVFFIIKSWRYFAKDKVNIREEMKRGKVGLVLIILIIPILLAGF
FT                   YYSWLANSLILFIGTAALLYITLLGRSLSTYNERKKMYSFVFLTGSSIVFWMLYFVGPM
FT                   GVTQFLKYNVNIYLGSYYIPPQWIMNLNSIFVIIGSPIAIALFDKLRKKHITISISKQF
FT                   MCSLQFIALSFLALTVGIVNCGTDGLTSMSWIIAHYLFQAIGELLIAPVGYAMIGSLAP
FT                   EKLQGLMMGIWMMASGIAATISNYFSNLMTQSESLNPLISNEHYLKAFSQLGFYAILGG
FT                   LILWFCSKTIENSIQKSSTEAIKGMA"
FT                   /product="putative proton-dependent oligopeptide
FT                   transporter, POT family"
FT                   /protein_id="YP_003915083.1"
FT   gene            complement(4492..5514)
FT                   /db_xref="GeneID:9772669"
FT                   /locus_tag="LLO_p0005"
FT   CDS_pept        complement(4492..5514)
FT                   /locus_tag="LLO_p0005"
FT                   /gene_family="HOG000140131" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0005"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0005"
FT                   /db_xref="GI:308051510"
FT                   /db_xref="GeneID:9772669"
FT                   /translation="MNNSIYYFGFNKLLTLTKCPKAALLLDKIIFHHQGTLLKRDNRLW
FT                   FTRKIPDLAAELGFSESRIYIYLKNLEDDGLIIRKRFKYYGVPRSFIAITDRLENQLQL
FT                   ITEERENTIEIKEKEPTINTHINERMDYLVSTDSINKEKNSVINNITLSTLAAKLPLTE
FT                   LNIAKGMLLNVQKQHGVKLSSPQKVFDEVVFSLNNNAQFQNIGTFQHKINIISQLLRSN
FT                   RWKTPKGFEKYSPEGKRYKEKSDQENAARLQLKIEECNYSGLDETATTSRLSNVYELAH
FT                   HPSTSKELQKSLQIQQSLINGIKKDIKAIKNPNILDNFLKILVQEEAKLSNLQAELSLQ
FT                   "
FT                   /protein_id="YP_003915084.1"
FT   gene            complement(5536..5730)
FT                   /db_xref="GeneID:9772670"
FT                   /locus_tag="LLO_p4097"
FT   CDS_pept        complement(5536..5730)
FT                   /locus_tag="LLO_p4097"
FT                   /gene_family="HOG000140155" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /old_locus_tag="pLEGLO_0006"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pLEGLO_0006; Evidence 4 : Homologs of
FT                   previously reported genes of unknown function"
FT                   /db_xref="GI:308051511"
FT                   /db_xref="GeneID:9772670"
FT                   /translation="MTIDHVDNQIIKMIVNGCHVNDIAEDTNKSKRYILYRLSDLKTSF
FT                   NCKTTPQLIYMLATSGLIK"
FT                   /protein_id="YP_003915085.1"
FT   gene            5915..7177
FT                   /db_xref="GeneID:9772728"
FT                   /locus_tag="LLO_p0006"
FT   CDS_pept        5915..7177
FT                   /locus_tag="LLO_p0006"
FT                   /gene_family="HOG000140130" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0006"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0006"
FT                   /db_xref="GI:308051512"
FT                   /db_xref="GeneID:9772728"
FT                   /translation="MSELSWDKVKTDIARINKRLYEVLETIDGIQNMLFTVLEYQYGQI
FT                   IADEHYFYLPDTGGKLSSVPFSMVMEKNLEMFIEFKGKSSTHQIYKEGDFLSVSSLYNS
FT                   SNTHHPTDILQISSGARNTFLLCPVADARPHASLGKYFKADIPVPDDLGNHYLTFKKIC
FT                   DAANCKWRSKLLVFPSEIVTLIKENKLPTLLSLVMEFDSNQTGYYANLPFYNYLMAYVR
FT                   ANNPEISQNEFTNNTISQLITIGTGQVPGYGLAVDDNLLPLDFIVEVYRDIYKSKYTPF
FT                   VMEPVHFDKNKNHPVFYSILKEEMAFKPTSFSNKPQRCELIYDTYLQYADHIKKLGHFE
FT                   STPFFESATNLDLTLFHEKNNQVTNNLFKLPRETIFSYDPRFLEVSNKLGYSVDQFPSK
FT                   TTFLVGCFGIKYNENKDAFMH"
FT                   /protein_id="YP_003915086.1"
FT   gene            7134..8312
FT                   /db_xref="GeneID:9772671"
FT                   /locus_tag="LLO_p0007"
FT   CDS_pept        7134..8312
FT                   /locus_tag="LLO_p0007"
FT                   /gene_family="HOG000140129" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0007"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0007; similar to unknown protein"
FT                   /db_xref="GI:308051513"
FT                   /db_xref="GeneID:9772671"
FT                   /translation="MVLSTMKIKTLLCIDPLQDYELIDCDLLRQLGVSPFFLIKDELKF
FT                   VKDRENLLVSSFSFEELLAICDSFRPDYIVCFSEDMFVDIAKIREKLNIAGMSLNTAML
FT                   LSHKDLMYQKLEGLFSYPKTTSLIHSPNLKLIKEKLSVEEIFIKPINSSGSYETYHIKT
FT                   EEEFCNFITNKKESDDKYIVQAYVGDDLYHSELAVFDRSILFVEARKYTHPNHLMVSKN
FT                   LPIFSLNVLDAHQRKLILDASVNVCQLLEFNNGVLHTEFFMSEDGYIQFIETNARPPGI
FT                   GLNKLYQKKYSISLETILCCIVCEVEPPRLVKNKSHYVCGYFPRKNGVIKKINKPELSV
FT                   QNEWTLFVRPDDTSEQMAHMSKSAMVICWDDSITKINQTGNFLAEQDIVEIY"
FT                   /protein_id="YP_003915087.1"
FT   gene            8455..8706
FT                   /db_xref="GeneID:9772672"
FT                   /locus_tag="LLO_p0008"
FT   CDS_pept        8455..8706
FT                   /locus_tag="LLO_p0008"
FT                   /gene_family="HOG000140128" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0008"
FT                   /codon_start="1"
FT                   /product="putative molybdopterin converting factor 2
FT                   (subunit 1)"
FT                   /transl_table="11"
FT                   /note="equals pllo0008"
FT                   /db_xref="GI:308051514"
FT                   /db_xref="GeneID:9772672"
FT                   /translation="MHEYQLIEFNSDRKQIQLVSSKSNLQQVLAEFYKENFEKMFDDCG
FT                   CSKGYISVFVNSEQISSIKDIILNPNDEVCIVTSISGG"
FT                   /protein_id="YP_003915088.1"
FT   gene            8711..9733
FT                   /db_xref="GeneID:9772673"
FT                   /locus_tag="LLO_p0009"
FT   CDS_pept        8711..9733
FT                   /locus_tag="LLO_p0009"
FT                   /gene_family="HOG000281219" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0009"
FT                   /codon_start="1"
FT                   /product="putative molybdenum cofactor synthesis protein 3"
FT                   /transl_table="11"
FT                   /note="equals pllo0009"
FT                   /db_xref="GI:308051515"
FT                   /db_xref="GeneID:9772673"
FT                   /translation="MDRYKRQISVIGEQGQKIINNATIMIVGLGGIGSPVAKYLAAAGV
FT                   GKLILVDDDKVDLSNLHRQILFNECDIGFYKAEKARDILSKTNKNIVIEAHTKRFDVDL
FT                   GYSLVSDIDLIIDGTDNFETRYLLNDICVLKNKVFISCSILVNIIQLALFDTKHLCYRC
FT                   LYPNPPPIGVMPNCSEAGVLGTVTGMAGTMAANLALNYLLKIENEKVPQIRIIDAKNFN
FT                   ISSMPIKKNNNCFACKQRKISLSYLQNQGADYGISLGQLDRTKHFLVDIRQKEEREITK
FT                   LEDDLFFPIKENTDYSFFLSYKDKKLVFYCASGYRSKLFVSELRNLGVDAYYLNERFSK
FT                   "
FT                   /protein_id="YP_003915089.1"
FT   gene            9730..10791
FT                   /db_xref="GeneID:9772674"
FT                   /locus_tag="LLO_p0010"
FT   CDS_pept        9730..10791
FT                   /locus_tag="LLO_p0010"
FT                   /gene_family="HOG000140127" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0010"
FT                   /codon_start="1"
FT                   /product="putative conserved hypothetical proteins"
FT                   /transl_table="11"
FT                   /note="equals pllo0010"
FT                   /db_xref="GI:308051516"
FT                   /db_xref="GeneID:9772674"
FT                   /translation="MIFEHQETSLRARNYRETLGVLTSFKKLAGITRLADLTHLDYTAL
FT                   PVYTAIRPRAKSLSTSQGKGLTKEAAQCSALMESIEVYFAEELVPQVINKSELELAQNK
FT                   AIFIPLNDLSKSVHFSDSSRPMNWVQAELVFAGKSILVPFAEFSLNSYLPEVLIYSPDT
FT                   TGLAGGNNFKEALLHGILEVIERQNALKISQIDFVNSETVKNITEKFDCHIYFHENIYE
FT                   IPSFEVWIKSKNPFENQILFKGGGCHLDKQIALNRALTEAIQSRVTTIAGSRDDLIHTK
FT                   YDFQTSEFPVVKDKKDFSKLPNYSVTTIEDALSALFKKIKGNNQDILVYKYYDKEICIL
FT                   KVKLISMDLISHA"
FT                   /protein_id="YP_003915090.1"
FT   gene            10784..11818
FT                   /db_xref="GeneID:9772675"
FT                   /locus_tag="LLO_p0011"
FT   CDS_pept        10784..11818
FT                   /locus_tag="LLO_p0011"
FT                   /gene_family="HOG000140125" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0011"
FT                   /codon_start="1"
FT                   /product="TfuA-like protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0011"
FT                   /db_xref="GI:308051517"
FT                   /db_xref="GeneID:9772675"
FT                   /translation="MHKTVVFLETSLTHQEAMHLLPHAAYLPSIKKGDVLKAIQAGYKR
FT                   IVIIDGNFSWVPSVWHKEILTALDYGIEVWGAASMGALRAAELDSFGMRGHGRIYEMYK
FT                   NEEVDGDDEVAIAYSKFNHVQTIPLINIRLTLERLNSINDETVLNLIRSIFYAERSWDK
FT                   IAQLVPENLYHLIKSNYIDAKKEDAKSLLLSLSQQHTSSRVSDLNRKKREFTLFEKKLI
FT                   ESTLSPAWLLAPLHEQTESLASLQRAENILKLLSIPKTEKNGLHYQYLLSLLDQQTYTI
FT                   TEYELMYQVEQFREEHNLLKGEDFFNWLKGLGLHESNLEQLFTDYVKLMKYLIITYDFN
FT                   SYFN"
FT                   /protein_id="YP_003915091.1"
FT   gene            11932..12117
FT                   /db_xref="GeneID:9772676"
FT                   /locus_tag="LLO_p0012"
FT   CDS_pept        11932..12117
FT                   /locus_tag="LLO_p0012"
FT                   /gene_family="HOG000140124" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0012"
FT                   /codon_start="1"
FT                   /product="hypothetical protein of unknown function"
FT                   /transl_table="11"
FT                   /note="equals pllo0012"
FT                   /db_xref="GI:308051518"
FT                   /db_xref="GeneID:9772676"
FT                   /translation="MNVEQEVFDILESCISCLQQAALNIGGFDFDKHAQAAIYAYSLLR
FT                   RQQLFLMYPIENETVH"
FT                   /protein_id="YP_003915092.1"
FT   gene            12373..12696
FT                   /db_xref="GeneID:9772677"
FT                   /locus_tag="LLO_p0013"
FT   CDS_pept        12373..12696
FT                   /locus_tag="LLO_p0013"
FT                   /gene_family="HOG000140154" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0013"
FT                   /codon_start="1"
FT                   /product="putative fimbrial protein precursor (Pilin)"
FT                   /transl_table="11"
FT                   /note="equals pllo0013"
FT                   /db_xref="GI:308051519"
FT                   /db_xref="GeneID:9772677"
FT                   /translation="MNKVAVIRKSSYKLYEFIQWSVPLLVLSWVVVLCLTNIGHAAGQN
FT                   YLSPMKADVSATFGQNSDLPGYLYMGETLGAGVIWWQKKSPWVFVGLPLLMIFTHWGLS
FT                   YVA"
FT                   /protein_id="YP_003915093.1"
FT   gene            12686..12976
FT                   /db_xref="GeneID:9772678"
FT                   /locus_tag="LLO_p0014"
FT   CDS_pept        12686..12976
FT                   /locus_tag="LLO_p0014"
FT                   /gene_family="HOG000140153" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0014"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraL"
FT                   /transl_table="11"
FT                   /note="equals pllo0014"
FT                   /db_xref="GI:308051520"
FT                   /db_xref="GeneID:9772678"
FT                   /translation="MSHNYSTFMLSEEPRIAGIPLTTGLPVYLLTGIGLLIGLGPQLFV
FT                   IGAVLSLIMHVQYGGLPLRALLGIIYWSLPHAMTTLIFRSFPNSAHRIYVG"
FT                   /protein_id="YP_003915094.1"
FT   gene            12981..13538
FT                   /db_xref="GeneID:9772679"
FT                   /locus_tag="LLO_p0015"
FT   CDS_pept        12981..13538
FT                   /locus_tag="LLO_p0015"
FT                   /gene_family="HOG000140152" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0015"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraE"
FT                   /transl_table="11"
FT                   /note="equals pllo0015"
FT                   /db_xref="GI:308051521"
FT                   /db_xref="GeneID:9772679"
FT                   /translation="MNSIFRDNVLSKNKVLLHLTLAWAVTATLAVFIFGGICVHVVNNK
FT                   ETHWLPICTEDGYFLSNSSFSPSYIKDMTKKVIQLRLTYNPDTVAARFASLVHLIPASH
FT                   QEAFKTILDSESTVAKEKNISSVFYEKNIHIDESTLQAKVDGTLNRTSHGLEVKPQKKV
FT                   YLVQFAHSKGMMWPKAIKEIRQ"
FT                   /protein_id="YP_003915095.1"
FT   gene            13535..14254
FT                   /db_xref="GeneID:9772680"
FT                   /locus_tag="LLO_p0016"
FT   CDS_pept        13535..14254
FT                   /locus_tag="LLO_p0016"
FT                   /gene_family="HOG000140151" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0016"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraK"
FT                   /transl_table="11"
FT                   /note="equals pllo0016"
FT                   /db_xref="GI:308051522"
FT                   /db_xref="GeneID:9772680"
FT                   /translation="MNALQLFVLSSVFATSLHAGNTAATLKFEEGERFVLSLSSLNFNR
FT                   IDVEGERIVKVSFPEHSFIVEQSKESEDDLDGAVVLKPLAHIPLTVYFTTNLNHHFSAT
FT                   VSPTEDLGKTIKLVSKKLKGFDYAKAQEQSQYQQSDLMTALMEGTTPSGFQEVGIKPTT
FT                   FRLHKQLNVTLVKQVRGKESSGYVYRIENQSNKPIELTASLFEHPKLMTMELSEKMLQP
FT                   SQTAYFYGIYREQSNIG"
FT                   /protein_id="YP_003915096.1"
FT   gene            14269..15723
FT                   /db_xref="GeneID:9772681"
FT                   /locus_tag="LLO_p0017"
FT   CDS_pept        14269..15723
FT                   /locus_tag="LLO_p0017"
FT                   /gene_family="HOG000140150" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0017"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraB"
FT                   /transl_table="11"
FT                   /note="equals pllo0017"
FT                   /db_xref="GI:308051523"
FT                   /db_xref="GeneID:9772681"
FT                   /translation="MMKLFKKLMNKNKKANPNQSAKIEQLRNGLAFLLLGGLCYGFYLY
FT                   SSKPQSTLPTNKKPVFDGVLDSAFSRLSDEAVLEKQQRQIDALKALVEKNKKSTSNKAD
FT                   DLVSENQALLSAMQKQLEKLALENKEINGKLQVALLKNSQTSLAAVAARPPTREEIEAR
FT                   HKQRILDEKAYYGKAGLETVHFNYRRQQKEERTPDNYVWAGTHAEGILLSGAKGDAGIN
FT                   GAKNMGTALIRLDSNGIMPNNRHSRLNGCLAIVSTYGDLSDDAVVMHLETLSCAKPNLS
FT                   FEQKVYGSVYDLDAMQDLRGTSILKTKPLLEYSAAAGILAGFGDGLKNLNTAQTINPGA
FT                   GTITTYGQASTLMQSAAGGAVSNPANKISDYIMKIADIYHPLVVARAGRRVSIMFTKGF
FT                   WIDRAHQSFESGKSIDNQSAQNEAAITTTISRAGGEAGESSSGEPSVPQSTFQSDTQTA
FT                   QQFLNQNGMSNQPLFSTVNPTGDVHG"
FT                   /protein_id="YP_003915097.1"
FT   gene            15716..15940
FT                   /db_xref="GeneID:9772682"
FT                   /locus_tag="LLO_p0018"
FT   CDS_pept        15716..15940
FT                   /locus_tag="LLO_p0018"
FT                   /gene_family="HOG000140149" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0018"
FT                   /codon_start="1"
FT                   /product="putative hypothetical gene"
FT                   /transl_table="11"
FT                   /note="equals pllo0018; hypothetical gene"
FT                   /db_xref="GI:308051524"
FT                   /db_xref="GeneID:9772682"
FT                   /translation="MVKAWLILFCCSAVALTGCSRSIFDHQDVRCPFVERGGCQSMEQV
FT                   NRMVDARRFTPDGQYVQQEQCVGCSAYSK"
FT                   /protein_id="YP_003915098.1"
FT   gene            15970..18546
FT                   /db_xref="GeneID:9772683"
FT                   /locus_tag="LLO_p0019"
FT   CDS_pept        15970..18546
FT                   /locus_tag="LLO_p0019"
FT                   /gene_family="HOG000140147" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0019"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraC"
FT                   /transl_table="11"
FT                   /note="equals pllo0019"
FT                   /db_xref="GI:308051525"
FT                   /db_xref="GeneID:9772683"
FT                   /translation="MFAALKKYVQVFRNSIDDYLVDGEESSSQNTLNVGDHQYPLFCKE
FT                   LPYQYYDEESHLFINRWNTGLLYRITPLTGANEKIAEQLDSILRTKVSDEFTLQLILVK
FT                   HNQVGHELDAFSKQFMNRDFEQLSVMGKSLRSFYGEAAVHGFKTNTNVNPRITQTECYV
FT                   VVDKIKGKNEEEVKACFAQFRIAFEASLMSAKIGFRTCNAEELLRLLHFYLAHEPDNIY
FT                   PKIASYDPKKLIQHQVVGRDFDVEVAKEGLLFKGVNNQGKAFETVASVMTIDGLPGEYH
FT                   LWDNINNSANIFNPEQSIPCNHIISVTYLVDEQNKAQGRANRKTSDLDKKAKGDYALHV
FT                   AGTEKKAREWRHFRDDLASGKTRSCKMLYNVVLFSRRAEYARDVEAARTCFSYNGIKLA
FT                   LSRRMQTPYFLATLPFLFTNHLQKGFQLPTMMWPISSWNATQYMPLLSDWSGTGSGILL
FT                   PTLRNQFSCIDPFSGKLGTNYNISVTGTSGGGKSFFIQMLMLNVLFNGGDLFIVDVGGS
FT                   YKKLCHALGGVYLEYSNLAMNPFTHVTNIGKEIQHILSLFQLLACAKDGASDDDRGTLR
FT                   EAILQAFSEHQQTTLIDHVQSKLLELHQNDREKYPTGKILAKNLDPYCTHSEHGTVFNA
FT                   PSKLAPDARIIVVDLKEIEDDEHIRAPVLLSILSQFQGRMFNSDRSRQKMCIIDEAWSL
FT                   FSGDQIAVHFINRGFRTGRRHNASFVTITQGIDDYYAFPEARAAWENSAIKLIFLQDGD
FT                   SLVKHQQEHNTFSDFEFKLLSGFPKAKDAGFSQVLLRADGISSFHRLFVDPFTKVLLSS
FT                   DGRDYQAVMNYIEQGYSYIHAAMLVANKYYDLSKNVLVEGGLADAA"
FT                   /protein_id="YP_003915099.1"
FT   gene            18536..18871
FT                   /db_xref="GeneID:9772684"
FT                   /locus_tag="LLO_p0020"
FT   CDS_pept        18536..18871
FT                   /locus_tag="LLO_p0020"
FT                   /gene_family="HOG000140146" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0020"
FT                   /codon_start="1"
FT                   /product="putative TrbI protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0020"
FT                   /db_xref="GI:308051526"
FT                   /db_xref="GeneID:9772684"
FT                   /translation="MLRNYKAQLLILAVLILSSMVLWGLHKPTPIAVVDMQRLLNQPAV
FT                   LLSQSNLSEQEQKKVLKQYSSLLPQVLSQYGTSHHVTLITATVISSGRFDVTDEVIAAT
FT                   LEQLGAL"
FT                   /protein_id="YP_003915100.1"
FT   gene            18868..19494
FT                   /db_xref="GeneID:9772685"
FT                   /locus_tag="LLO_p0021"
FT   CDS_pept        18868..19494
FT                   /locus_tag="LLO_p0021"
FT                   /gene_family="HOG000222133" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0021"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraW"
FT                   /transl_table="11"
FT                   /note="equals pllo0021"
FT                   /db_xref="GI:308051527"
FT                   /db_xref="GeneID:9772685"
FT                   /translation="MKNLAGLVAALLMNITPVYAKNLGNYGQLFPVVEKDIREVIMAKL
FT                   HRLEQSGALKQHQQKIVARVEDHLRRPKPLHLPTTTTPKTHELDPSIVVNQTLYAHDGT
FT                   LIAKKGAHLNPFERVSFSKTLFFFDADDRKQLAWVKTHYTHFDQVKFILTGGDVKAASD
FT                   VLGSVYFDLEGRLSRYFHLKHVPSVISQEGLVWRIQEIGQHELRK"
FT                   /protein_id="YP_003915101.1"
FT   gene            19506..20501
FT                   /db_xref="GeneID:9772686"
FT                   /locus_tag="LLO_p0022"
FT   CDS_pept        19506..20501
FT                   /locus_tag="LLO_p0022"
FT                   /gene_family="HOG000222151" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0022"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraU"
FT                   /transl_table="11"
FT                   /note="equals pllo0022"
FT                   /db_xref="GI:308051528"
FT                   /db_xref="GeneID:9772686"
FT                   /translation="MNKKTLITRFIVLFLLSSLNFVYASQCKGHFVNPITDVCWNCLFP
FT                   LTIGSSEVVKSSYPDTNNPGNPLCLCPTPIGERLGVTIGYWEPAALVDVTPKPWCMVNL
FT                   GVQLNVAKKGLGGSQMPEVDGRGAFYYVHWYKYPLVYWLQVLTSLGCMETEDFDILYPS
FT                   ELDPTWNDSELAFVLNPEAVLFTSPPARASCAFDASKALAGTSVNSLFWCQGAQGSTYP
FT                   LTGFVAHQASPISTAALLAERVDFKLHRPPTPAIRDSIGQDWPAVCHTYASSIMPKDRY
FT                   RYQLVNTLPEARQCHPFGRSVISWEAGHTYPGDGDNFGFLIWKKRNCCFL"
FT                   /protein_id="YP_003915102.1"
FT   gene            20518..21180
FT                   /db_xref="GeneID:9772687"
FT                   /locus_tag="LLO_p0023"
FT   CDS_pept        20518..21180
FT                   /locus_tag="LLO_p0023"
FT                   /gene_family="HOG000140145" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0023"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TrbC"
FT                   /transl_table="11"
FT                   /note="equals pllo0023"
FT                   /db_xref="GI:308051529"
FT                   /db_xref="GeneID:9772687"
FT                   /translation="MNAFGIFLSSLFLVTSSHANVNDFLNEASAIGKTAHDSVSQDTLA
FT                   HWNAASNQSIAQNKTLIDQIIEQSRQGTPVAQKGQTVDGAVLFVSFSMPESLLFSLSDE
FT                   AASYKIPVVINGLIEGDFKKTITTFSKLHAKSKESKWAFKGVSVDPLWFEQFHITAVPA
FT                   LVVSKRPSSCGQQLLCPEQTYDVVYGNASIKKSLQLIAQKGDSAHEVAQAFLENAHA"
FT                   /protein_id="YP_003915103.1"
FT   gene            21173..22972
FT                   /db_xref="GeneID:9772688"
FT                   /locus_tag="LLO_p0024"
FT   CDS_pept        21173..22972
FT                   /locus_tag="LLO_p0024"
FT                   /gene_family="HOG000140144" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0024"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraN"
FT                   /transl_table="11"
FT                   /note="equals pllo0024"
FT                   /db_xref="GI:308051530"
FT                   /db_xref="GeneID:9772688"
FT                   /translation="MLKWGVLMALLSMGCFANQTGTDFNGFKKYAKSLNAQPKEAMRGF
FT                   EPQAIFEKYSEHPAQEGYYQGVLKEQTDLSSQANAAIKNDPGAQTVIDHFGTNKFELNQ
FT                   TNSVLAQSQLIQDESYAITHGQSNDRVQCSNQKPICTMKTHEEQCFSSRSLPDQTCSQN
FT                   LKVLVDSEKIVQRADFSFYVAKKWTGVITVNLVTGAITNAVGGSVPYPIRMKHPCDGMS
FT                   ATIRSIRNNGAHAYWVQVIGTPTCANNGLLTFYINKGWGRVYPIQVALTVTAHSKPYIS
FT                   QEYWDNHCTSFENKGSLCRIKKEKCTDTQSPKVIDGLPISRACWAKELTYSCSSAAADE
FT                   CLAQKSKGCFQTASECARFDEQTCALYKQTYSCQENVCEAPIECIKDLFCADGECTEHS
FT                   QTQNSDFGQSVSSLAVIGEAGHELSQQPNASFFGGQAVQCKIWPLDLIDCCHDKGWGKD
FT                   IDLLHCRDEDKALGQAKLNYVAHYLGEYCSEKVAGVCLEHKRSYCVFPSKMARIIQEAR
FT                   LTQVNGRGLGDAEHPTCAGMSVAELQKMDLGRIDFVTPIYPFGHGTPNKAAGIAGDLKI
FT                   KSQDSKKSIDEVSRRMQKKAGEL"
FT                   /protein_id="YP_003915104.1"
FT   gene            22969..23757
FT                   /db_xref="GeneID:9772689"
FT                   /locus_tag="LLO_p0025"
FT   CDS_pept        22969..23757
FT                   /function="putative pilus assembly and synthesis protein"
FT                   /gene_family="HOG000140143" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="LLO_p0025"
FT                   /old_locus_tag="pllo0025"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraF"
FT                   /transl_table="11"
FT                   /note="equals pllo0025"
FT                   /db_xref="GI:308051531"
FT                   /db_xref="GeneID:9772689"
FT                   /translation="MSRLLMLLVWGLFVTSLHADIVQEHAKGFHWYSVEEQSKPIKKIV
FT                   QPRPATVAKSPYERLMDKRKETLNKLAEALIAPSFNATHEYMKAQMDYSKNNQQFVRYW
FT                   QQVLLFHPELDSTLNFPTDNSAIAVRNDAQKVLINKVIHESSARYGFILFYRGTSSISQ
FT                   KMVMHLLPFIKEYGFSMISVNTDGQLIDGLPNPKSIPLETVQKQVALEAKYMPALYFVD
FT                   LKSNKMSPVSYGFLSLEELKQRIFDVMTQFKRFSYEGVNE"
FT                   /protein_id="YP_003915105.1"
FT   gene            23754..24251
FT                   /db_xref="GeneID:9772690"
FT                   /locus_tag="LLO_p0026"
FT   CDS_pept        23754..24251
FT                   /locus_tag="LLO_p0026"
FT                   /gene_family="HOG000140142" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0026"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TrbB"
FT                   /transl_table="11"
FT                   /note="equals pllo0026"
FT                   /db_xref="GI:308051532"
FT                   /db_xref="GeneID:9772690"
FT                   /translation="MKKRFFLIVLFLLSTHSFANVALDELTQLLNKKQEQEELARTKNK
FT                   RISALSEQHYFIFIYRSTCPHCHQFAPILRDFASSFHIPVEAYSLDGESLRGFDSANLT
FT                   PELFQTLYVSGEYKPVVPALYLVNRPTNQAYAVLFGEAQPAQLANRVDELMTHLEEKFH
FT                   DE"
FT                   /protein_id="YP_003915106.1"
FT   gene            24241..25644
FT                   /db_xref="GeneID:9772691"
FT                   /locus_tag="LLO_p0027"
FT   CDS_pept        24241..25644
FT                   /function="putative pilus biogenesis protein"
FT                   /gene_family="HOG000266196" [ FAMILY / ALN / TREE ]
FT                   /locus_tag="LLO_p0027"
FT                   /old_locus_tag="pllo0027"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraH"
FT                   /transl_table="11"
FT                   /note="equals pllo0027"
FT                   /db_xref="GI:308051533"
FT                   /db_xref="GeneID:9772691"
FT                   /translation="MMNRFTTLRETLFKKTVAALLLLGTSQLFANAESDLSNFFNNLGF
FT                   DANVTGSHAYQTQAAGYAALGSVYARNQVRTIRLAHVDVPGMRSGCGGIDLFAGGFSFI
FT                   KSDQIVKFMQNILSGGAGYALNLALETELPEIAHAMQFMQKLANEINGTNFNSCEMGEN
FT                   LSAAVWPRNRAAQQRLCEDLGRHQGTFTDWAMARQKCSTGGDADSILAQAKNNPEYKDR
FT                   VLINTNIVWDSLQINQFIAQDPKLAEVYMSISGTIVFNVKGALMTYPSLATNQDFIKAL
FT                   LYGGKLPSYHCTDTGPQSHCLSIDATSTQEISAKNALVAQVQELLQGIYDNIKMGKELS
FT                   DKQKGLIELTQPAVFNLISANAQQNTGIQGSYELAQSVATDLLAQYLSNSLDIIRASLS
FT                   GKELGAHNEERLYKNLQLAQQFVARFSTESRERFNAALQTNELIRNNVKQALSALTPTL
FT                   RTAYYGDAQ"
FT                   /protein_id="YP_003915107.1"
FT   gene            25641..28400
FT                   /db_xref="GeneID:9772692"
FT                   /locus_tag="LLO_p0028"
FT   CDS_pept        25641..28400
FT                   /locus_tag="LLO_p0028"
FT                   /gene_family="HOG000140141" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0028"
FT                   /codon_start="1"
FT                   /product="putative sex pilus assembly and mating pair
FT                   protein TraG"
FT                   /transl_table="11"
FT                   /note="equals pllo0028"
FT                   /db_xref="GI:308051534"
FT                   /db_xref="GeneID:9772692"
FT                   /translation="MSLLTIYTPQNGEYLKTVLDAMVTLLGTSTYKSAQDIISILAVGV
FT                   VGFQYVSGKRIQAISRYVLCTFVFLFCILGIKTPVAIIDMQTADSAGPALTVDNVPLGV
FT                   GLPAALISGIGYGLTKVSSNILHMPQDLDYTRTGMLFGSRTFLAATSSDLSLSPELSRD
FT                   LSTYIRQCIFAAKLLGSQQISPNEMKHSSDLIRLYFEHPSPIYRVLFHDGSNLSCIDAA
FT                   ARLKPELNTGIEKQLVHLSNIMTKGDKEKFSDGLAAAHSYFMNVSKDAAQVLTQNILIN
FT                   ATRESALDAFAFAGADAELMNYTNSSSLQKMHVAEANSFWLAGYRLPYYMTVFWMLTLC
FT                   IFPLVMLLALVPAMHGVYLIYMQTQVFLWSWPPMFIIIHFFVSLASSTTLTLFGSKNGG
FT                   VTFSTIDSIASIQSSFAYTAGGLAISVPVISLFIAKGLPNLLSAASQHLGGMAQSLSTG
FT                   EAQSATQGNISMASYSGWNMNYNNTHANKWDTNYQHMEGRATVQADNGALLSQGIDGSR
FT                   VINAQSAMSQMATRLHASDRISSSLQDSASQSFQNAQSHRTSADSHYQQALSGLSQFNE
FT                   SDASEVREGTGINRTLSNALNQDLRQMHDAVNQYNQHHDKSGQVSWDAAVSARIDTRKG
FT                   VFGSFAHAVTGISGEASTSLKTGLSASNSVQAFFNSSEGQSFSSALNHMESTAKTHHLD
FT                   ANDSFNLSKSEQIAANLSQGHALSDMASAEYSKGEHYQHMANRVKEHSDGMDRVLDQAF
FT                   HDWAVQQYGVQVEKALMGTDASSLSSQQQLADQFMSSSQGQSAVKEQVSRMMHSSPEHV
FT                   KNQFEAQRASMTAHQKALIKQAHQEGSGGVLNKSQERHLSQVQDNTIQQAHDLRMDNRE
FT                   DLSKAYQHQASSTQREIQASEADLAHRQAQQKQDYVDNDRGFKEGRYE"
FT                   /protein_id="YP_003915108.1"
FT   gene            28437..30434
FT                   /db_xref="GeneID:9772693"
FT                   /locus_tag="LLO_p0029"
FT   CDS_pept        28437..30434
FT                   /locus_tag="LLO_p0029"
FT                   /gene_family="HOG000266197" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0029"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraD"
FT                   /transl_table="11"
FT                   /note="equals pllo0029"
FT                   /db_xref="GI:308051535"
FT                   /db_xref="GeneID:9772693"
FT                   /translation="MKQSSLQNMWQFMSGGQIFDYKTKMMIQVSNRIFHWAVLGFVVLF
FT                   SLIMAFYASSELKLVVLHHISRFLVKFHNGEYVLWTNLNGSKITAFFYQKSPLIQASVH
FT                   LAQETLWRKAQISLIFGGAVYLLITLLFSRFFIKLGEKYTKDQFISGTRLADSPKETIK
FT                   SVNESQRGASEIKLLNRLPMPKFSEKQGMLFHGTTGAGKTQAMMMLLEQIRALGEPAII
FT                   YDKECTIKPYFFDECIDVELNPVSKLCANWKMWRECANPLEFGSFATYLIPKSVQGSDP
FT                   FWVDSARTIFTSMAWKIRDYAEKDPVFLLQLLLTTSLEEIRNILKGTESENLVSKEIEK
FT                   TAISIKSVLATYTKALRFLEGLEKSGKEDFSIKEWIENTADPKKYNKGWLFITSRSKYH
FT                   KEIKPLISLWLGLAMQGVQSLAANNKGRIWLVMDELASLHRLETISDTLADIRKFGGCV
FT                   AIGIQSIAQLDFIYGTHEAGAIADLLNTSIYFRSPKSKVAKWVSEDLGPQVINEMKESQ
FT                   SYGPDSVRDGNTVGSQRTKRNTVEEGDIMTLDDMECYVRLVGNHPITRLKNQYIERKEI
FT                   CVPLIERTINFDALEKVNHRALMVQNNPQRNDDVKKIHQFETLAHEVSDKDLVPPESPY
FT                   AEPQDHAATNKNDTDAIELREASIVIKEIF"
FT                   /protein_id="YP_003915109.1"
FT   gene            30453..36323
FT                   /db_xref="GeneID:9772694"
FT                   /locus_tag="LLO_p0030"
FT   CDS_pept        30453..36323
FT                   /locus_tag="LLO_p0030"
FT                   /gene_family="HOG000140140" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0030"
FT                   /codon_start="1"
FT                   /product="putative conjugative transfer protein TraI"
FT                   /transl_table="11"
FT                   /note="equals pllo0030"
FT                   /db_xref="GI:308051536"
FT                   /db_xref="GeneID:9772694"
FT                   /translation="MLTLNKISAAKDAVHYYTTQDNYYLSDRDSLNSLSRWIGNGAQKL
FT                   QLSGQIEPSQFLKLLDGQLPSGQLLGIIDKGERQHRPGTDVTLSAPKSVSILALVGQDE
FT                   RLLQAHQEAVNITFGRIEQLAAEARITFNGETTFEKTRNLVAAMFVHTTSRELDPDLHT
FT                   HVPILNMTERSDGLWRSLSSRAKNDKEHLDHGFRELIYSNQHYLGLVYMSSLAKKVKEL
FT                   GYDIRIKDRYGNFEVVGISDEAITATSKRRVQILDDMKERGTSSAKAAEKSNLSTRNPK
FT                   VEIDSQALHQQWVDEIKELGIDLRGIIQDSKLNTGRGAVKSTHTTPLSPDAQKAVSDAM
FT                   SHLSEYSTQIQHGALVRQAMTFSAGLVGHEHIEREIESLLSVETLQGKPMEYYTTVSLL
FT                   AREKDFIAKTTNELKTSFSISVPNHGLTSSVFKNNERIQIIDVAGFQCEKELIQDMVHL
FT                   AEANQLNSYVLHPGSLKTQQLRADIKHLDTGFISRIKNLFKDDIMHTVSGFQYHYGKHI
FT                   KASPFTKKKQDLVIVHDAQKLSFDDLSALSDMTQASQSKLILLNNSAGTLGFSAGNPIK
FT                   VLKEQGIHSYQSLTTPIKGELKLSVGKQINESMSAAWLQLTPEQQQKSALVALNSKQKE
FT                   AITRQIREGLVQQGQLSRQMKKVAVLATVSLTQTEKGYAHSYKVGDNITFYNEGRTPKH
FT                   YKVYEVDSKGLHLENAQGKTSLFAYDTKEDFRVSREKILEIAVGERLINEQSLYHQRVK
FT                   YAPKSSFSVSKVTEEGIYVRHESNTLFLTNKVLSEHHFDYDYCKKPHEIKPDTIQVLVA
FT                   AKPYQLNRNLIGEIGENAEQVLLFTEDEPKAQRFLEREQLKWTAYEVQQKKPDLVYRDI
FT                   AYANKALAREINSLIHHLELKSEDKEGIAATALTYALAKCTERNAAFKHSDLMTHALMH
FT                   ALGEADFEDIAPLLKARMADSLVYLDTYWTTKEVLHIEEAILKANYQEQNTVQPIEPSA
FT                   QKLLSLPETLTQGQKDAITLVVSTSDRFVSIQGLAGVGKTTMMRHVKDIAQSNQFQVLG
FT                   LAPTHKAVEELNANGIQAQTVDSFLRNDGGLGANHLVIVDESSMIDNEKYHALQQKCID
FT                   TQSRMVFTGDITQLQSLASGIPHELTIKSQSQKTAFMTEIVRQNPNPELKKAAEFASRR
FT                   EIGKAFEHIKNIDPEEYVQRKTPIQGLNHSSLVEIKCIDEEGKKDYTSIYRVIADDFLS
FT                   RTHECQKNTLIVAHAHEDRTPIEVLLRDGLRKQHQLHSQDVLCKHLFPVSLDQADQVKA
FT                   HSFEPGDVIRFGKNYSVAKKDEYFTVKAVDSEANKLFCVDQSQVEFTISASILPKTMPS
FT                   FYKLHERPLASGDRIRLKRNDDARGIIANEEYTVTQVFGKTVGLSNHKNQVTLNLKEQA
FT                   DLHWDYAYTNTAYSSQGATSKFMIALELEDRLVVTTHRSHEIDATRSSHQATFYTDNIE
FT                   GLVNRLEDPLKQRDADKTSALLTEEAYRLKQQKQQRISTQLIDRAQEPILDEAKEQRND
FT                   SRPVKKYESSQKPSINADELYKGLLNVSDSLVKSLLGEPNHRLSTQSEYRYGAKGSLKI
FT                   DLDSGLWHHFETGESGNLFHLIEREKGLSGFKETLQHAAQYIHYIPEYERKTPQKLNEK
FT                   KEREVKEGKRQLAQKLFQQSQPIQGTIAEKYLIIHRGLAHYENADLRFCRSVYTKTQDG
FT                   KKHVPALLAFSKDQQGNIHHVQITKLDSYSANKDKSCDSVKQTFGLINNYFVNLNHQGK
FT                   GDIAYFTEGVETGLSILQANEHARVYAVLGKANFSNIDPKDSPKHVVICLDNDGKDTYK
FT                   YAKNEQTNTIIKAAEKLHDSGIQVSLMIPKKENTDLNDVLVKEGREELKKLLSRLMSLD
FT                   EFKKQCALENKEPVLKKINQDKNIQSLIKNDRKLNTQNDNEFKRLNQGLIKGIKERVHQ
FT                   RELVERNRTFNKPLPNREMEREI"
FT                   /protein_id="YP_003915110.1"
FT   gene            complement(36320..36640)
FT                   /db_xref="GeneID:9772695"
FT                   /locus_tag="LLO_p0031"
FT   CDS_pept        complement(36320..36640)
FT                   /locus_tag="LLO_p0031"
FT                   /gene_family="HOG000140139" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0031"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0031"
FT                   /db_xref="GI:308051537"
FT                   /db_xref="GeneID:9772695"
FT                   /translation="MEITIDIGADTLHSLNKITKMNSTELNVTAAEMLSFGARIYLQSL
FT                   EKKTDESTQLLLENSVRSVQIITEVLYSVYNKELSKIGAYDAETALAMIERMLPNLLKS
FT                   IS"
FT                   /protein_id="YP_003915111.1"
FT   gene            complement(36631..37080)
FT                   /db_xref="GeneID:9772696"
FT                   /locus_tag="LLO_p0032"
FT   CDS_pept        complement(36631..37080)
FT                   /locus_tag="LLO_p0032"
FT                   /gene_family="HOG000140138" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0032"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0032"
FT                   /db_xref="GI:308051538"
FT                   /db_xref="GeneID:9772696"
FT                   /translation="MKENDVITLRISEYEREYLNKIAHQFDLQKRGSSDISPAKALKFL
FT                   LEYCLHNEISPQRKNESPLQDIRKMIEQIHASIPHLMYHNHYQSLVISSKINDDSLKEI
FT                   KQKTIEYLNDNFSGFQNNSYKEVRFKMNGIGLKTLPIEEGVSLWK"
FT                   /protein_id="YP_003915112.1"
FT   gene            37448..37897
FT                   /db_xref="GeneID:9772697"
FT                   /locus_tag="LLO_p0033"
FT   CDS_pept        37448..37897
FT                   /locus_tag="LLO_p0033"
FT                   /gene_family="HOG000140136" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0033"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0033"
FT                   /db_xref="GI:308051539"
FT                   /db_xref="GeneID:9772697"
FT                   /translation="MKLFFQKDALIDHIKKLIQLLIRIKDFVLEPPPGYLEYQKAITSK
FT                   DANFNYMENEFFKRHILPNIIKGHGVLNQGEHLSINHQQLINNPHDTFRVNPVTGLPMI
FT                   GAYDAGGSPFGFNFNHSMHHHINNPSSFNNMHSSNQFNSFDYWNR"
FT                   /protein_id="YP_003915113.1"
FT   gene            complement(38085..38885)
FT                   /db_xref="GeneID:9772698"
FT                   /locus_tag="LLO_p0034"
FT   CDS_pept        complement(38085..38885)
FT                   /locus_tag="LLO_p0034"
FT                   /gene_family="HOG000222632" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0034"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0034"
FT                   /db_xref="GI:308051540"
FT                   /db_xref="GeneID:9772698"
FT                   /translation="MKNYISMDVLRSKAPSIFTQAKAEYTSEKYQHISTSNVIDGLIAK
FT                   GFYPTWAAQSNCRIESKKPFTKHMIRFRHCNIAPSFSMLFPELVLVNSHDGLSSYRLNA
FT                   GLYRLVCSNGLVAGHSYEEIRVRHQGDIVGNVIEGTYQVVEETQKMIDAAEKMSQIKLS
FT                   SDEKLYFAEAAHSLRFEDCAMGQIVTPDKFLKVRRSEEANASDLFSVFNVVQENVIKGG
FT                   LSGYARERGQFKRVRTREVKGIDQNIKLNKALWTLAEKMMQLKQ"
FT                   /protein_id="YP_003915114.1"
FT   gene            39050..39877
FT                   /db_xref="GeneID:9772699"
FT                   /locus_tag="LLO_p0035"
FT   CDS_pept        39050..39877
FT                   /locus_tag="LLO_p0035"
FT                   /gene_family="HOG000140135" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="pllo0035"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pllo0035"
FT                   /db_xref="GI:308051541"
FT                   /db_xref="GeneID:9772699"
FT                   /translation="MNTLMKKLLAFEIKHNLRRPARVYVKSPDLKTIYGSFSLDNTSAF
FT                   ENWEALTLAQQTELKQFIHNIDAVNKHIKPEINDVLTEFRLRLPISLIHALNELSIICN
FT                   KENVELNVYDPIILNIIQQMKISTAKLSNENKAEAFSILEKANIAEYKKIDYSSQIQGI
FT                   FAELLHVHNKSEKLYEKAKSLFGKDKSYSPKALESMANGESNPSKWLVSCAIDLLFDEG
FT                   NDVGKLLSEDDLFMLWVKPQLDQNLDKDLINQRLSHMNLSGLIERTRNYRIYV"
FT                   /protein_id="YP_003915115.1"
FT   gene            40023..40202
FT                   /db_xref="GeneID:9772700"
FT                   /locus_tag="LLO_p4098"
FT   CDS_pept        40023..40202
FT                   /locus_tag="LLO_p4098"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /old_locus_tag="pLEGLO_0036"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="equals pLEGLO_0036; Evidence 5 : No homology to any
FT                   previously reported sequences"
FT                   /db_xref="GI:308051542"
FT                   /db_xref="GeneID:9772700"
FT                   /translation="MKEAMSVQYNYYDSFNPKPLKSYNCKFFSDVEVIYSADQLVDHFV
FT                   HQLKQVFFALYMLE"
FT                   /protein_id="YP_003915116.1"
FT   gene            complement(40346..40564)
FT                   /db_xref="GeneID:9772729"
FT                   /locus_tag="LLO_p0036"