(data stored in ACNUC7421 zone)

EMBL: M13766.PE1

M13766.PE1           Location/Qualifiers
FT   CDS_pept        <1..1193
FT                   /codon_start=3
FT                   /transl_table=11
FT                   /note="penicillin binding protein 5"
FT                   /db_xref="GOA:P08750"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08750"
FT                   /protein_id="AAA22375.1"
FT                   /translation="ASSGKILYSKNADKRLPIASMTKMMTEYLLLEAIDQGKVKWDQTY
FT                   TPDDYVYEISQDNSLSNVPLRKDGKYTVKELYQATAIYSANAAAIAIAEIVAGSETKFV
FT                   EKMNAKAKELGLTDYKFVNATGLENKDLHGHQPEGTSVNEESEVSAKDMAVLADHLITD
FT                   YPEILETSSIAKTKFRQGTDDEMDMPNWNFMLKGLVSEYKKATVDGLKTGSTDSAGSCF
FT                   TGTAERNGMRVITVVLNAKGNLHTGRFDETKKMFDYAFDNFSMKEIYAEGDQVKGHKTI
FT                   SVDKGKEKEVGIVTNKAFSLPVKNGEEKNYKAKVTLNKDNLTAPVKKGTKVGKLTAEYT
FT                   GDEKDYGFLNSDLAGVDLVTKENVEKANWFVLTMRSIGGFFAGIWGSIVDTVTGWF"
     aagcttcttc aggtaaaatt ctttacagta aaaatgcaga taagagactg ccaattgcga        60
     gtatgacaaa aatgatgaca gagtatctgt tattggaagc aattgatcaa ggtaaagtga       120
     aatgggacca aacctatacg cctgatgact atgtgtatga aatttcccaa gataacagct       180
     tatcaaacgt tcctcttcgg aaagacggga aatacacagt aaaagaatta tatcaagcta       240
     cagcaattta ttctgcaaat gctgctgcta ttgcgattgc agaaatcgtt gccggttctg       300
     aaactaagtt tgttgaaaaa atgaatgcaa aagcaaaaga actaggctta acagattaca       360
     aatttgttaa cgcaacaggt cttgaaaaca aagatcttca cgggcatcag cctgagggga       420
     caagcgtaaa tgaagaaagt gaagtttctg caaaggatat ggcggttctt gcggatcact       480
     tgattactga ctaccctgag atactggaga cttccagtat cgccaaaacg aaattcagac       540
     aaggcaccga tgatgaaatg gacatgccga actggaattt tatgctgaag gggcttgtca       600
     gcgagtataa aaaagcgact gtagacggac tgaaaacagg ttctactgac tctgcgggtt       660
     catgctttac aggaacagct gaacgcaacg gtatgcgtgt catcactgtt gttttaaacg       720
     caaagggcaa ccttcataca ggccgtttcg atgaaacgaa aaaaatgttt gattatgctt       780
     tcgacaattt ctccatgaaa gaaatttatg ctgaaggcga tcaagtaaaa ggccataaaa       840
     caatttcagt tgataagggt aaagagaaag aagtaggcat tgtgacaaac aaggcgttct       900
     ctcttcctgt caaaaatggt gaagaaaaga attacaaagc gaaggtcaca ctgaataaag       960
     acaacttaac tgctcctgtg aaaaaaggaa ccaaggttgg gaagctgact gcggaataca      1020
     caggtgatga aaaggattac ggattcctta acagcgatct ggctggcgta gaccttgtta      1080
     caaaagaaaa tgtagaaaaa gcaaactggt ttgttttgac aatgcgcagt atcggcggat      1140
     tttttgccgg aatttgggga agcattgttg atacggtaac cggctggttt taa             1193
//

If you have problems or comments...

PBIL Back to PBIL home page