(data stored in ACNUC8465 zone)

HOGENOMDNA: METC4_3

ID   METC4_3; SV 1; empty ; DNA; empty ; PRO; 22617 BP.
XX
AC   NC_011760;
XX
PR   Project: 58933;
XX
DE   Methylobacterium chloromethanicum CM4 plasmid pMCHL02, complete sequence.
XX
OS   Methylobacterium chloromethanicum CM4
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Methylobacteriaceae; Methylobacterium.
XX
RN   [1]
RP   1-22617
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Chertkov,O., Brettin,T., Detter,J.C.,
RA   Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N.,
RA   Marx,C. and Richardson,P.;
RT   "Complete sequence of plasmid2 of Methylobacterium chloromethanicum CM4";
RL   Unpublished
XX
RN   [2]
RP   1-22617
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (19-DEC-2008) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-22617
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Chertkov,O., Brettin,T., Detter,J.C.,
RA   Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N., Mikhailova,N.,
RA   Marx,C. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (16-DEC-2008) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001300.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003780
CC   Source DNA and bacteria available from Christopher Marx
CC   (cmarx@oeb.harvard.edu)
CC   Contacts: Christopher Marx (cmarx@oeb.harvard.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..22617
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:440085"
FT                   /note="type strain of Methylobacterium chloromethanicum"
FT                   /strain="CM4"
FT                   /plasmid="pMCHL02"
FT                   /organism="Methylobacterium chloromethanicum CM4"
FT   gene            complement(105..884)
FT                   /db_xref="GeneID:7119647"
FT                   /locus_tag="Mchl_5737"
FT   CDS_pept        complement(105..884)
FT                   /locus_tag="Mchl_5737"
FT                   /gene_family="HOG000042938" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mpop_5430"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mpo:Mpop_5430 hypothetical protein"
FT                   /db_xref="GI:218534718"
FT                   /db_xref="GeneID:7119647"
FT                   /translation="MFCDQIRQSAETAPRAALPAVAAALWKAFAEGHVSEADAEALSAL
FT                   IEARQALRSPHPATSTGPIASNDAQGRVGSPRTGRSGSRPRTDASVERRRRWAASGRMP
FT                   PAIAARFTLAEQAVLSLVAAETCRRKDCRLSVGGMAAIAGVSETTVRNAIREAVKLGLL
FT                   TVEERQITGWRNDTNIVRIISAEWTSWLRLTRKAPKAEDRLSLNSEQKGGGCKSANPTP
FT                   TDLQERGKLRPAEPSQGLPRGSGRLSARRAEMDRGAR"
FT                   /protein_id="YP_002424479.1"
FT   gene            1232..1576
FT                   /db_xref="GeneID:7119609"
FT                   /locus_tag="Mchl_5738"
FT   CDS_pept        1232..1576
FT                   /locus_tag="Mchl_5738"
FT                   /gene_family="HOG000026126" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Caul_4863"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cak:Caul_4863 hypothetical protein"
FT                   /db_xref="GI:218534719"
FT                   /db_xref="GeneID:7119609"
FT                   /translation="MPTNVISRKSLTDFWAIHPQAQGPLTAWYATVTKTEWTGPAHLKA
FT                   AFGSADFVADNRVIFNVGGNNYRVVARFAYAYKTAQIKFVGTHAEYDLIDVVTVGNPNE
FT                   KQERKRKGKG"
FT                   /protein_id="YP_002424480.1"
FT   misc_feature    1289..1516
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2136); Region: DUF2136; cl01912"
FT                   /db_xref="CDD:154652"
FT                   /locus_tag="Mchl_5738"
FT   gene            1580..1993
FT                   /db_xref="GeneID:7119610"
FT                   /locus_tag="Mchl_5739"
FT   CDS_pept        1580..1993
FT                   /locus_tag="Mchl_5739"
FT                   /gene_family="HOG000026115" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mpop_3482"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mpo:Mpop_3482 hypothetical protein"
FT                   /db_xref="GI:218534720"
FT                   /db_xref="GeneID:7119610"
FT                   /translation="MSDARLIKTEAEYKAAMEEIDALFANLPEPGTPEGDRFEFLSLLI
FT                   SHYEDQHFPIPEADPVDLLRFAITDMGRSQTELAELLGSRPRASEVMNRKRALTLDMIR
FT                   GISAAWKLPFEALAAPYTVKRAPRSSARRQALT"
FT                   /protein_id="YP_002424481.1"
FT   misc_feature    1580..1930
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cl09100"
FT                   /db_xref="CDD:175000"
FT                   /locus_tag="Mchl_5739"
FT   gene            2105..2536
FT                   /db_xref="GeneID:7119611"
FT                   /locus_tag="Mchl_5740"
FT   CDS_pept        2105..2536
FT                   /locus_tag="Mchl_5740"
FT                   /gene_family="HOG000001472" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6451"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_6451 hypothetical protein"
FT                   /db_xref="GI:218534721"
FT                   /db_xref="GeneID:7119611"
FT                   /translation="MPIRREHRFFYPIDWPQLSAVIRFGRAKGRCEGCGRPHGRTVFCL
FT                   GDGRWWDDEAASWRDGAGGLVCIEVGAADVLSEIRTTRVVLATAHRNHDTADNSPTNLA
FT                   AFCQRCHMVHDRPEHQRRRWRTLFRRKALGDLFRGPYGL"
FT                   /protein_id="YP_002424482.1"
FT   gene            complement(2599..3918)
FT                   /db_xref="GeneID:7119612"
FT                   /locus_tag="Mchl_5741"
FT   CDS_pept        complement(2599..3918)
FT                   /locus_tag="Mchl_5741"
FT                   /gene_family="HOG000255145" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:M446_5137"
FT                   /codon_start="1"
FT                   /product="flagellin domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: met:M446_5137 flagellin domain-containing
FT                   protein"
FT                   /db_xref="GI:218534722"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="GeneID:7119612"
FT                   /translation="MTSLLTNNAAMTALTTLKSINTQLDVTSNRVSTGQRVSSAADNAA
FT                   YWSIATTVRTDNGSLGAVKDSLGLGSATVDTAYTGLTSVLSNLQNMRSKLQAALTPGVD
FT                   RSKVQTEIKSLQDNMKSTADSSIQSGQNWLSVNSSDTSVYKATQSIVAGFSRDNTGHIS
FT                   FSTVDVKVGDIQLYDKSLTATAATSAKVTASTAIAGTLDFKTNDNEQSTLTIALGSGES
FT                   ADITLDKSSLTAHVKDLGAVTKDELLSAINNSIAASDLAGLVSASLDSAGRLSFETIGN
FT                   PDTDTVAVNIKDGAEGTAIDIGFGTDEAVIYNGVGTAKTTGTGGGILDSGNTNVAAVAI
FT                   SNSTTDAALKAHIDTVDRAIAKITEAATTLGAAKTQIDGQKTFVDTLMKSNDRAIGILV
FT                   DADIEEESTKLKALQTQQQLAIQTLSIANSSTQGVLSLFR"
FT                   /protein_id="YP_002424483.1"
FT   misc_feature    complement(3514..3867)
FT                   /note="Bacterial flagellin N-terminal helical region;
FT                   Region: Flagellin_N; pfam00669"
FT                   /db_xref="CDD:144315"
FT                   /locus_tag="Mchl_5741"
FT   misc_feature    complement(2602..>2895)
FT                   /note="flagellin; Reviewed; Region: PRK12687"
FT                   /db_xref="CDD:105853"
FT                   /locus_tag="Mchl_5741"
FT   gene            complement(4260..4631)
FT                   /db_xref="GeneID:7119613"
FT                   /locus_tag="Mchl_5742"
FT   CDS_pept        complement(4260..4631)
FT                   /locus_tag="Mchl_5742"
FT                   /gene_family="HOG000042774" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:M446_5138"
FT                   /codon_start="1"
FT                   /product="flagellar biosynthesis repressor FlbT"
FT                   /transl_table="11"
FT                   /note="KEGG: met:M446_5138 flagellar biosynthesis repressor
FT                   FlbT"
FT                   /db_xref="GI:218534723"
FT                   /db_xref="GeneID:7119613"
FT                   /translation="MSKSNHTKAFIRKGEVFFLNGALIRAHDSVNVEIMISDTFLLPSQ
FT                   IVSEDTAVSHLKKAYYFIQQMLIEPGFRNQWQNRLDDSLTSLPTETKNIIQEAVKANEL
FT                   QKLLSMIRHETKVDARPLN"
FT                   /protein_id="YP_002424484.1"
FT   misc_feature    complement(4263..4601)
FT                   /note="Flagellar protein FlbT; Region: FlbT; cl11455"
FT                   /db_xref="CDD:175267"
FT                   /locus_tag="Mchl_5742"
FT   gene            4771..4941
FT                   /db_xref="GeneID:7119614"
FT                   /locus_tag="Mchl_5743"
FT                   /pseudo
FT   gene            complement(4932..5465)
FT                   /db_xref="GeneID:7119615"
FT                   /locus_tag="Mchl_5744"
FT   CDS_pept        complement(4932..5465)
FT                   /locus_tag="Mchl_5744"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0001128"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rec:RHECIAT_CH0001128 hypothetical protein"
FT                   /db_xref="GI:218534724"
FT                   /db_xref="GeneID:7119615"
FT                   /translation="MSEQSVPARLNVEAKLEAFNRALLGDDELGAVVRGHIYIENELIA
FT                   FIKARLPVPEAIKDRDIDYNMRVKLAVALGLDLSFEPALNCAGSLRNQFAHSLEARIGK
FT                   QEAVNFKKALAAHRAVTLASYRQAHIDLGTEAAAIPIKQQEPKDRIILCFVTLWAGILI
FT                   ATYAAAVARSADQP"
FT                   /protein_id="YP_002424485.1"
FT   gene            5776..6024
FT                   /db_xref="GeneID:7119616"
FT                   /locus_tag="Mchl_5745"
FT   CDS_pept        5776..6024
FT                   /locus_tag="Mchl_5745"
FT                   /gene_family="HOG000032052" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mpop_5031"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mpo:Mpop_5031 hypothetical protein"
FT                   /db_xref="GI:218534725"
FT                   /db_xref="GeneID:7119616"
FT                   /translation="MSKQIISRVAAALALTLTATAAIAGEPAGIDNTKTVGALTLETRG
FT                   LATDTGSVHRQGGYSLPGAVQWKVPATDDRVKQAAAF"
FT                   /protein_id="YP_002424486.1"
FT   gene            6886..7176
FT                   /db_xref="GeneID:7119617"
FT                   /locus_tag="Mchl_5746"
FT   CDS_pept        6886..7176
FT                   /locus_tag="Mchl_5746"
FT                   /gene_family="HOG000032365" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mext_0496"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mex:Mext_0496 hypothetical protein"
FT                   /db_xref="GI:218534726"
FT                   /db_xref="GeneID:7119617"
FT                   /translation="MFLIMFAAIPAGLLAMSFTASTSLLLALMAGPLVGSVTALCAALF
FT                   LAWHRGSEWRSDDDLEQQTDAMVGALRSLAKQGRAVDAAPAIRTTKPSQAA"
FT                   /protein_id="YP_002424487.1"
FT   gene            complement(7337..8467)
FT                   /db_xref="GeneID:7119618"
FT                   /locus_tag="Mchl_5747"
FT   CDS_pept        complement(7337..8467)
FT                   /locus_tag="Mchl_5747"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rle:RL2313 hypothetical protein"
FT                   /db_xref="GI:218534727"
FT                   /db_xref="GeneID:7119618"
FT                   /translation="MRERPGHPTLFDHWDRMAARVAATRQAVEHEKKHGQGNRRHKGKR
FT                   QAWSIDRQRLAEVQKVIHHRHGGACDTDDGATYLRAAMPHLLRLHGGGDEAHDKILGWA
FT                   AVWLPTMPQADVAAAVENAFRHDPPPLKADTLAELLNMHRDERTALSLRTIGAVDQTSR
FT                   ERAAERKRKSAEHQAAKRQRAGATPRSQSKVAIAKAQGISLSTLKRRLKQAAAQEAANR
FT                   PDPISSAIDPKDLQPTTKPGHGTGLSVPGPAREASQRQIVGAVGPTPGARTRAVPAGHA
FT                   VPLPLPENGFQENGDFFGSDDAWISLGSALDYAGGLMPPEVARAVRLAQRARSMTQDAV
FT                   ARHIGISRPQLANALQGRFGLSRSAAANLCAWLAAA"
FT                   /protein_id="YP_002424488.1"
FT   gene            complement(8467..8751)
FT                   /db_xref="GeneID:7119619"
FT                   /locus_tag="Mchl_5748"
FT   CDS_pept        complement(8467..8751)
FT                   /locus_tag="Mchl_5748"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534728"
FT                   /db_xref="GeneID:7119619"
FT                   /translation="MRDASTLALAVADKLEADAAPTRARITDEMIGMFLWHRAGIRNEQ
FT                   ALATLINRVRAIIDGRARRPRPANDPAPRVPRTRPAPAPVQLSFALETA"
FT                   /protein_id="YP_002424489.1"
FT   gene            complement(8757..9038)
FT                   /db_xref="GeneID:7119620"
FT                   /locus_tag="Mchl_5749"
FT   CDS_pept        complement(8757..9038)
FT                   /locus_tag="Mchl_5749"
FT                   /gene_family="HOG000140903" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bbt:BBta_1498 hypothetical protein"
FT                   /db_xref="GI:218534729"
FT                   /db_xref="GeneID:7119620"
FT                   /translation="MLTGEQLRAARAMLKVEQGELAELSSVSVETIKRLERIDGPISAN
FT                   SMTLDGLRRALETEGVVFLPENGGLPGVRLRRDPPANIRTRKRRGAES"
FT                   /protein_id="YP_002424490.1"
FT   gene            9143..9445
FT                   /db_xref="GeneID:7119621"
FT                   /locus_tag="Mchl_5750"
FT   CDS_pept        9143..9445
FT                   /locus_tag="Mchl_5750"
FT                   /gene_family="HOG000042352" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:M446_3327"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: met:M446_3327 hypothetical protein"
FT                   /db_xref="GI:218534730"
FT                   /db_xref="GeneID:7119621"
FT                   /translation="MSSRRQLNWSTAMQGLRADRIQVPAGFLGARGRIEVAARLGKVAL
FT                   VKADGSFDRAGIMRAATQAAKAHQLSYGSTWAVAMSVSLKAAWQAASTTRARAAH"
FT                   /protein_id="YP_002424491.1"
FT   gene            9494..9934
FT                   /db_xref="GeneID:7119622"
FT                   /locus_tag="Mchl_5751"
FT   CDS_pept        9494..9934
FT                   /locus_tag="Mchl_5751"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BTH_II2324"
FT                   /codon_start="1"
FT                   /product="1A family penicillin-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bte:BTH_II2324 1A family penicillin-binding
FT                   protein"
FT                   /db_xref="GI:218534731"
FT                   /db_xref="GeneID:7119622"
FT                   /translation="MLPAMTRRATIASALAMLAAPALPAAPSPFAVAIRRARLADAAHL
FT                   QAGRDSIDVFGSNGPRPAYWRAYRFGVMAERYSARRAVYALTPATADEAHALVAYFAER
FT                   ASLTADPGAAKAARRRLRKVFARPGAASAPEMPAILKPPAPS"
FT                   /protein_id="YP_002424492.1"
FT   gene            10015..10551
FT                   /db_xref="GeneID:7119623"
FT                   /locus_tag="Mchl_5752"
FT   CDS_pept        10015..10551
FT                   /locus_tag="Mchl_5752"
FT                   /gene_family="HOG000081219" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534732"
FT                   /db_xref="GeneID:7119623"
FT                   /translation="MSHVLTIRSDAETVPYHADPILAAIDRHAEAWSVFQVAPEGQASV
FT                   DADAEAFDALHALLATPCATRAGMFCLIRHLRWWLAEEAVNAGAYNTDDGLDAWGVAQA
FT                   READLSRCLGVERIERLPIALPSGRLLGPVIDLRPVAAATPVRFARLLSRAGDVVAALA
FT                   LVIGGCGLTSLASLL"
FT                   /protein_id="YP_002424493.1"
FT   gene            10598..11338
FT                   /db_xref="GeneID:7119624"
FT                   /locus_tag="Mchl_5753"
FT   CDS_pept        10598..11338
FT                   /locus_tag="Mchl_5753"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534733"
FT                   /db_xref="GeneID:7119624"
FT                   /translation="MRNPLRSLVTRPADKPSLRDRLAATRERFRRRPASQVSPELAGLI
FT                   AESERLAAAIKGPDCDAGDWWPDRGLVHQSVEARAAVICFPSAGVADTGAKLASLGRVQ
FT                   GANDIRGEVRCSIEYGNATYDDLALIVVAELLEMRGDAVALLPAPNPDPIFAAIAEGER
FT                   LRRISDEAYRLPDMGLDPLPEKEVASEALYAHVNGVLLKTTPTTAAGCAALVRFAQAFR
FT                   ESEGISLCEGNAELVALIARSPAL"
FT                   /protein_id="YP_002424494.1"
FT   gene            11405..11944
FT                   /db_xref="GeneID:7119625"
FT                   /locus_tag="Mchl_5754"
FT   CDS_pept        11405..11944
FT                   /locus_tag="Mchl_5754"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: kpn:KPN_01966 electron transport complex
FT                   protein RnfC"
FT                   /db_xref="GI:218534734"
FT                   /db_xref="GeneID:7119625"
FT                   /translation="MPSLNLRNPLKRDPNRPTLKQRAVALKARAGRVLRRPAPVEAPAL
FT                   ATGANPRLAALVAQCQEARRKLNDPAIPDGPEADAIGEAETCLLMEVLRFPSKTVHDLA
FT                   AEIPFLREEAEDAARGWDGRRVPFEASVPGAAWAGLLRDIEHLAEAAPSAGAKTDPIFA
FT                   ATEASKISHSASQPGA"
FT                   /protein_id="YP_002424495.1"
FT   gene            11948..12226
FT                   /db_xref="GeneID:7119626"
FT                   /locus_tag="Mchl_5755"
FT   CDS_pept        11948..12226
FT                   /locus_tag="Mchl_5755"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mex:Mext_2448 hypothetical protein"
FT                   /db_xref="GI:218534735"
FT                   /db_xref="GeneID:7119626"
FT                   /translation="MADILTFRARRPAPTVSRTDVLDGPALRLELEQAAQAALDQAERL
FT                   IALLDRMDGNADDEDGGDAEQSLGAPEGHASRIVWLRGSASDDELTS"
FT                   /protein_id="YP_002424496.1"
FT   gene            complement(12221..12379)
FT                   /db_xref="GeneID:7119627"
FT                   /locus_tag="Mchl_5756"
FT   CDS_pept        complement(12221..12379)
FT                   /locus_tag="Mchl_5756"
FT                   /gene_family="HOG000081091" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mpop_0877"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mpo:Mpop_0877 hypothetical protein"
FT                   /db_xref="GI:218534736"
FT                   /db_xref="GeneID:7119627"
FT                   /translation="MFVLSLICLVSGATLAGAAPDRPVPQAACESMAGSFIVGGLCLLG
FT                   FGLSAFL"
FT                   /protein_id="YP_002424497.1"
FT   gene            12761..13408
FT                   /db_xref="GeneID:7119628"
FT                   /locus_tag="Mchl_5757"
FT   CDS_pept        12761..13408
FT                   /locus_tag="Mchl_5757"
FT                   /gene_family="HOG000019423" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /codon_start="1"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   met:M446_3124 cobyrinic acid ac-diamide synthase"
FT                   /db_xref="GI:218534737"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="GeneID:7119628"
FT                   /translation="MHVILIGTQKGGSGKSTLAAHFGALAERDGRTLLIDADPQGSLAF
FT                   WHRRREAKTPLLAKADGNSIAGILDAAEAEGIAWAVIDSPPHNAALIASLMSRASVTVV
FT                   PVRPGPFDLDAVAATLAMARSLKAPIACIINAAPPITREAETAIVAEARAVLTDMGAPV
FT                   LPGQVSQRASLSHALISGQSVNEYDPEGRAASEIAAMWSAVTELARSFPRKP"
FT                   /protein_id="YP_002424498.1"
FT   misc_feature    12761..13390
FT                   /note="ATPases involved in chromosome partitioning [Cell
FT                   division and chromosome partitioning]; Region: Soj;
FT                   COG1192"
FT                   /db_xref="CDD:31385"
FT                   /locus_tag="Mchl_5757"
FT   misc_feature    12767..13126
FT                   /note="ParA and ParB of Caulobacter crescentus belong to a
FT                   conserved family of bacterial proteins implicated in
FT                   chromosome segregation. ParB binds to DNA sequences
FT                   adjacent to the origin of replication and localizes to
FT                   opposite cell poles shortly following...; Region: ParA;
FT                   cd02042"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Mchl_5757"
FT   misc_feature    12788..12808
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Mchl_5757"
FT   misc_feature    order(12806..12808,13007..13009)
FT                   /note="Magnesium ion binding site; other site"
FT                   /db_xref="CDD:73302"
FT                   /locus_tag="Mchl_5757"
FT   gene            13603..13761
FT                   /db_xref="GeneID:7119629"
FT                   /locus_tag="Mchl_5758"
FT   CDS_pept        13603..13761
FT                   /locus_tag="Mchl_5758"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534738"
FT                   /db_xref="GeneID:7119629"
FT                   /translation="MQVRVNRAGWLEMTRLAQDLDIPLEALMVEAFNDALTKHGKPPVV
FT                   ERRQPVK"
FT                   /protein_id="YP_002424499.1"
FT   gene            13772..14074
FT                   /db_xref="GeneID:7119630"
FT                   /locus_tag="Mchl_5759"
FT   CDS_pept        13772..14074
FT                   /locus_tag="Mchl_5759"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534739"
FT                   /db_xref="GeneID:7119630"
FT                   /translation="MPDLPNSKALRHAAQGGGYLSTGRGVLNATADEPHPLHYKDGRGL
FT                   RIQFSLQAGGGKSAVIAWIAPADFDVIADLMMQADPVAAQRAFGNALVKDAKRKR"
FT                   /protein_id="YP_002424500.1"
FT   gene            14221..15096
FT                   /db_xref="GeneID:7119631"
FT                   /locus_tag="Mchl_5760"
FT   CDS_pept        14221..15096
FT                   /locus_tag="Mchl_5760"
FT                   /gene_family="HOG000045296" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /codon_start="1"
FT                   /product="integrase family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: sru:SRU_1506 tyrosine
FT                   recombinase XerC"
FT                   /db_xref="GI:218534740"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="GeneID:7119631"
FT                   /translation="MSTALVPVEPQPVAIPAQADDDEHMLRLWLARSSSPNTRRNYERE
FT                   ARRFLAHVGRPLAAVRMGDLQEYIAGRPGSSATTALSAAALKSLFAFAQEAGYLRFNVG
FT                   AAVKVPPIKNTLAERIMPEGDALLMIRQEPALRNRVLLTVLYGGGLRISEVCSLRWRDL
FT                   APRDEAGQATVFGKGGKTRVVLLSAATWKVLQALREEALADDPVFRSRKGGALDPSAVH
FT                   RIVKAAAARAGLPADVSAHWLRHAHASHALDRGAPIHLVQATLGHASVATTGRYLHARP
FT                   SESSARFLGV"
FT                   /protein_id="YP_002424501.1"
FT   misc_feature    14284..15054
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="Mchl_5760"
FT   misc_feature    14314..15054
FT                   /note="tyrosine recombinase XerC; Region: recomb_XerC;
FT                   TIGR02224"
FT                   /db_xref="CDD:162771"
FT                   /locus_tag="Mchl_5760"
FT   misc_feature    order(14671..14676,14749..14751,14935..14943,15046..15048)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Mchl_5760"
FT   misc_feature    order(14671..14673,14749..14751,14941..14943,14950..14952,
FT                   15019..15021,15046..15048)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Mchl_5760"
FT   misc_feature    order(14671..14673,14941..14943,14950..14952,15019..15021,
FT                   15046..15048)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="Mchl_5760"
FT   gene            15156..15302
FT                   /db_xref="GeneID:7119632"
FT                   /locus_tag="Mchl_5761"
FT                   /pseudo
FT   gene            complement(16035..17297)
FT                   /db_xref="GeneID:7119633"
FT                   /locus_tag="Mchl_5762"
FT   CDS_pept        complement(16035..17297)
FT                   /locus_tag="Mchl_5762"
FT                   /gene_family="HOG000135879" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mpop_1194"
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein; putative
FT                   flagellin C-ter domain"
FT                   /transl_table="11"
FT                   /note="KEGG: mpo:Mpop_1194 conserved hypothetical protein;
FT                   putative flagellin C-ter domain"
FT                   /db_xref="GI:218534741"
FT                   /db_xref="GeneID:7119633"
FT                   /translation="MSSSITLSAATRQNLLSLQDTAAMMSTTQNRLSTGKKVNSALDNP
FT                   VNFFTSQSLNSRSGDLNGLLDGISNGIQVVQAANQGITSIQKLVDQAKSITSQAIASKN
FT                   TTTEGIGASAVVQPTADGVLKIEVNGVEKSINIKQYTAAVDAVAGTPASNGADGVVGGG
FT                   DDVAAVAGTPAVPASGDDEQAIVDKLNAAVGTKVFSLDSGNKLVASGAGKVEIKDTATA
FT                   TALGLTAPAGSASTADFKSEDKTRTSLAKQFNSLLTQIDQMAKDASFNGVNLISSGEKT
FT                   NKLHVQFNENDSASLDIDGVDLTTGEAGLNIAAITIDDAGKAFQSDDDITTAVSSLNSA
FT                   SNTLRAQSSTFGSNLSVVQNRQDFSKQLINILTTGSSNLTDADLNAEAANSQALSTRQS
FT                   LSISALSLANQAQQGILQLLR"
FT                   /protein_id="YP_002424502.1"
FT   misc_feature    complement(<16977..17291)
FT                   /note="Bacterial flagellin N-terminal helical region;
FT                   Region: Flagellin_N; pfam00669"
FT                   /db_xref="CDD:144315"
FT                   /locus_tag="Mchl_5762"
FT   misc_feature    complement(16038..>16565)
FT                   /note="flagellin; Reviewed; Region: PRK12688"
FT                   /db_xref="CDD:171664"
FT                   /locus_tag="Mchl_5762"
FT   gene            17461..17865
FT                   /db_xref="GeneID:7119634"
FT                   /locus_tag="Mchl_5763"
FT   CDS_pept        17461..17865
FT                   /locus_tag="Mchl_5763"
FT                   /gene_family="HOG000135890" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07378"
FT                   /codon_start="1"
FT                   /product="flagellar FlbT family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: flagellar FlbT family protein; KEGG:
FT                   met:M446_0687 flagellar FlbT family protein"
FT                   /db_xref="GI:218534742"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="GeneID:7119634"
FT                   /translation="MPLRITLKPFERLIINGALIKNGSRNSNFVIENHCKFLREGEIIH
FT                   ESEADTPCKKLCVTLQVLHLSEDPAEVENLFFRQAVDVMKIMPSAAPFMSAIQSALAEK
FT                   NTHAAIKAGKQLVYHERDLLAARSDETAAA"
FT                   /protein_id="YP_002424503.1"
FT   misc_feature    17467..17835
FT                   /note="Flagellar protein FlbT; Region: FlbT; cl11455"
FT                   /db_xref="CDD:175267"
FT                   /locus_tag="Mchl_5763"
FT   gene            complement(18067..18306)
FT                   /db_xref="GeneID:7119635"
FT                   /locus_tag="Mchl_5764"
FT   CDS_pept        complement(18067..18306)
FT                   /locus_tag="Mchl_5764"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534743"
FT                   /db_xref="GeneID:7119635"
FT                   /translation="MSLADLRRRLERHETARHIGGPTNIVANYPVEDAEGRDAIHNWRQ
FT                   WVQDGRASVKGDVLYLMQPPLTVEEWTAAHVAEH"
FT                   /protein_id="YP_002424504.1"
FT   gene            complement(18303..18500)
FT                   /db_xref="GeneID:7119636"
FT                   /locus_tag="Mchl_5765"
FT   CDS_pept        complement(18303..18500)
FT                   /locus_tag="Mchl_5765"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534744"
FT                   /db_xref="GeneID:7119636"
FT                   /translation="MSLESLRKRLDRIERTRSGSHARKVLRIITEDDADRARQLAGIDL
FT                   SGLFLIERRLIDPNPRSLHA"
FT                   /protein_id="YP_002424505.1"
FT   gene            complement(18497..18703)
FT                   /db_xref="GeneID:7119637"
FT                   /locus_tag="Mchl_5766"
FT   CDS_pept        complement(18497..18703)
FT                   /locus_tag="Mchl_5766"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534745"
FT                   /db_xref="GeneID:7119637"
FT                   /translation="MSLAHLRRRLERLESRHLGAAGLPWVWIVAHDDEELERKTADMIE
FT                   AGKMQLGQSRIVWRPITPSWSAP"
FT                   /protein_id="YP_002424506.1"
FT   gene            complement(18700..18882)
FT                   /db_xref="GeneID:7119638"
FT                   /locus_tag="Mchl_5767"
FT   CDS_pept        complement(18700..18882)
FT                   /locus_tag="Mchl_5767"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534746"
FT                   /db_xref="GeneID:7119638"
FT                   /translation="MPSAIERRLAKIEQRFRSRLRGVHRYSDDELDALISWLRDPDPSR
FT                   ERWAANLLQREGLIR"
FT                   /protein_id="YP_002424507.1"
FT   gene            complement(18866..19108)
FT                   /db_xref="GeneID:7119639"
FT                   /locus_tag="Mchl_5768"
FT   CDS_pept        complement(18866..19108)
FT                   /locus_tag="Mchl_5768"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534747"
FT                   /db_xref="GeneID:7119639"
FT                   /translation="MTLAALHRRLERIERREGMHGDLEQMSDAQLWRIIRRDYSALARE
FT                   HGSLLAAIQHLRATGETALAGLIEEDTGGADAVRH"
FT                   /protein_id="YP_002424508.1"
FT   gene            complement(19105..19527)
FT                   /db_xref="GeneID:7119640"
FT                   /locus_tag="Mchl_5769"
FT   CDS_pept        complement(19105..19527)
FT                   /locus_tag="Mchl_5769"
FT                   /gene_family="HOG000042405" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:M446_0803"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: met:M446_0803 hypothetical protein"
FT                   /db_xref="GI:218534748"
FT                   /db_xref="GeneID:7119640"
FT                   /translation="MNTNSGRFEKGQSGNPAGKTPGTRNRTTIAMQELLEGEADALTRK
FT                   AIELALGGDTVALRMCMERIIPFRKDRHVIFDLPKIETAADIPKATASLLEAVASGTIT
FT                   PAESADIGRAVDAHLKALETHELTERLNRLDGATGQ"
FT                   /protein_id="YP_002424509.1"
FT   gene            complement(19583..19822)
FT                   /db_xref="GeneID:7119641"
FT                   /locus_tag="Mchl_5770"
FT   CDS_pept        complement(19583..19822)
FT                   /locus_tag="Mchl_5770"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534749"
FT                   /db_xref="GeneID:7119641"
FT                   /translation="MNTRELASYRAGLLQASHMALIAATALELRDDAGELRQQAAVAAL
FT                   RGLADGLKADTTHIEPQAFRGFGIHKIPEAGIPL"
FT                   /protein_id="YP_002424510.1"
FT   gene            complement(19819..20070)
FT                   /db_xref="GeneID:7119642"
FT                   /locus_tag="Mchl_5771"
FT   CDS_pept        complement(19819..20070)
FT                   /locus_tag="Mchl_5771"
FT                   /gene_family="HOG000032633" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mext_1871"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mex:Mext_1871 hypothetical protein"
FT                   /db_xref="GI:218534750"
FT                   /db_xref="GeneID:7119642"
FT                   /translation="MIATEIDSQWFHNNPDREFRMRRQPPAEFQAWPVPPEPGMVAWCI
FT                   IRKKDGAVEQFALPEGDAMDDYDEELAALFDQLQGHSK"
FT                   /protein_id="YP_002424511.1"
FT   gene            complement(20113..20448)
FT                   /db_xref="GeneID:7119643"
FT                   /locus_tag="Mchl_5772"
FT   CDS_pept        complement(20113..20448)
FT                   /locus_tag="Mchl_5772"
FT                   /gene_family="HOG000051927" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_1256"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mrd:Mrad2831_1256 hypothetical protein"
FT                   /db_xref="GI:218534751"
FT                   /db_xref="GeneID:7119643"
FT                   /translation="MKRPHTTGHLGVPPPPSDPMEPATPVQPAVTEAVVDALLSLVAAA
FT                   ETQPAGPATKAYRAAIRRKGEEVAAAGGSEVLEAVLRQVCDAAPDRAERRERILTEAWA
FT                   GLPGWRL"
FT                   /protein_id="YP_002424512.1"
FT   gene            complement(20445..20714)
FT                   /db_xref="GeneID:7119644"
FT                   /locus_tag="Mchl_5773"
FT   CDS_pept        complement(20445..20714)
FT                   /locus_tag="Mchl_5773"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: met:M446_0800 hypothetical protein"
FT                   /db_xref="GI:218534752"
FT                   /db_xref="GeneID:7119644"
FT                   /translation="MIAAIDRWGPFADGIDNAERLARLRALRAITHLCAGPRGERLATE
FT                   LERAERDVSRLPSALAEIAALAALDVGKCSPASPASTVQPERHS"
FT                   /protein_id="YP_002424513.1"
FT   gene            complement(20711..22327)
FT                   /db_xref="GeneID:7119645"
FT                   /locus_tag="Mchl_5774"
FT   CDS_pept        complement(20711..22327)
FT                   /locus_tag="Mchl_5774"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mag:amb0657 hypothetical protein"
FT                   /db_xref="GI:218534753"
FT                   /db_xref="GeneID:7119645"
FT                   /translation="MRAGLTTELCTAAISAEWTLKGGATLWPGMPEEERRKAAEAASKA
FT                   RHAKGFIALWHAARDLVGNPEIEVSGHLYLEHREGDDGRVLVVKARSRREIPVGLQDVP
FT                   ALILDATLPAPEILKAFFPQIDTPPAIEAAMPHVRVRQIIDAPVSMNKLRPKDEACAGR
FT                   NLTAVRRAIVRRFIEIGRRPMLVIAQKAVADRLRSSGLPAGVAVEWFNNVAGLDQYREV
FT                   RALMVVGRTVPGPTAVEALAGALTGREANLIPKGNWYAPTVRGIRTRNGSPAGVECDAH
FT                   PDPIAEACRWQVCEGELMQAIGRGRGVNRTTDTPLDIDIMCNVVLPVTVDAVEAWDQPG
FT                   EEIEMQADGVVLESAADMATAWPSLWPTAGAARVWLHRHTGASRSTVTDPYIDTLIGKC
FT                   NGARRFRYQRPGVGQKWRAGAYYPAVVPDIRAWLTSRLGPLASLQVEKAASRAPRQCAA
FT                   DYDPALVARYACAAQAEPAQGRPAPVLPEISRLDPDAPISFPPFVRAILDRRPAPPPQA
FT                   ARETGSGSRPRFRLVHSEHAA"
FT                   /protein_id="YP_002424514.1"
FT   gene            complement(22383..22610)
FT                   /db_xref="GeneID:7119646"
FT                   /locus_tag="Mchl_5775"
FT   CDS_pept        complement(22383..22610)
FT                   /locus_tag="Mchl_5775"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:218534754"
FT                   /db_xref="GeneID:7119646"
FT                   /translation="MSPVRAHTVAQWIADGYSGLRVMRCPACGEETFQTWEQLCARLYE
FT                   DVIVVAQRIRCRECHQPPAGLAVVTYKDAA"
FT                   /protein_id="YP_002424515.1"
SQ   Sequence 22617 BP; 3942 A; 7311 C; 7135 G; 4229 T; 0 other;
     CCTGTTGTAA GGAGCAGTCT CTACTCACGG CTGATGACAG GACGAAGTCG GCGCGTCCGC        60
     TGTTCCGAAC GCGCGCAGAC CTGCACTGCA TGGCTCCGCC CTCTCTACCG GGCTCCACGA       120
     TCCATTTCGG CCCTCCGCGC TGAAAGTCGC CCGCTTCCCC TCGGAAGCCC CTGCGACGGC       180
     TCCGCTGGCC TCAGTTTTCC CCGTTCTTGA AGATCCGTAG GCGTGGGGTT CGCGCTTTTG       240
     CACCCTCCCC CCTTTTGCTC AGAGTTGAGC GAAAGCCTGT CCTCGGCCTT AGGCGCCTTG       300
     CGGGTGAGCC GTAGCCAGCT CGTCCACTCG GCCGAGATGA TGCGCACGAT GTTCGTGTCG       360
     TTCCTCCAGC CGGTGATCTG CCGCTCCTCG ACGGTGAGCA GCCCGAGCTT CACGGCTTCG       420
     CGGATCGCGT TGCGCACGGT GGTCTCGGAT ACGCCCGCGA TAGCTGCCAT TCCGCCGACG       480
     GAGAGGCGGC AGTCTTTGCG CCGGCACGTC TCGGCCGCGA CAAGCGACAG CACGGCTTGT       540
     TCCGCGAGGG TGAACCGGGC GGCGATGGCT GGCGGCATTC GCCCTGAGGC GGCCCAGCGG       600
     CGGCGGCGCT CCACGCTGGC ATCAGTCCGT GGCCGCGAAC CACTCCTGCC CGTCCTGGGG       660
     CTTCCTACGC GACCCTGGGC GTCATTCGAG GCGATGGGTC CGGTTGAGGT CGCCGGATGG       720
     GGCGACCTCA AAGCCTGCCG GGCCTCGATC AGGGCGGACA GGGCCTCGGC ATCGGCCTCC       780
     GAGACGTGCC CCTCGGCGAA CGCCTTCCAC AGTGCGGCAG CCACGGCCGG CAACGCGGCG       840
     CGTGGGGCCG TCTCCGCACT CTGGCGGATC TGGTCACAGA ACATCGGTCA CGGTCCCTCA       900
     CGGGCCGCGG TCAGGGTCCA GGCAAAGCCT ACCCGTTGCC GGAAGCGGGT TCCGACTTGA       960
     CACCCCAGGG GGTGCTATGG CGTATGAGGG GAAGTGACTC GGCCCTCACA CGGCCCCAGG      1020
     TTTTCAGCAG CCTCGACCTT GCCGGGTCGG GGCTGTTGGC TTTTCAGGGT CTCAGTTCCG      1080
     CAGCGCTGGT CTCCTTCTCC GGCTCACGAC TCGCACGAGT GCGCGCCTGA TCGGACGGGC      1140
     CATGTCGGCC GGGGCGAACC GTTAAGTCAA CGGTAACTCG GCCACAGCAC CCCCTCTTGT      1200
     TCCCACAGTG AGAACAGCCT ATCTGGGGGA CATGCCGACC AACGTCATCA GCCGCAAGAG      1260
     CCTGACCGAC TTTTGGGCCA TCCACCCGCA AGCCCAAGGG CCTCTGACGG CATGGTACGC      1320
     GACCGTTACG AAAACCGAAT GGACAGGGCC GGCTCATCTC AAGGCGGCGT TCGGATCCGC      1380
     CGATTTCGTT GCGGACAACC GCGTGATCTT CAACGTTGGG GGCAATAACT ATCGGGTCGT      1440
     TGCGCGGTTC GCGTATGCCT ATAAGACGGC TCAAATCAAG TTCGTCGGCA CTCACGCCGA      1500
     ATATGACTTG ATCGATGTCG TTACCGTTGG GAACCCAAAC GAGAAACAGG AACGCAAGCG      1560
     GAAAGGAAAG GGTTAGGCCA TGTCTGACGC TCGCCTTATC AAGACCGAAG CTGAGTATAA      1620
     GGCCGCAATG GAGGAGATTG ATGCGCTGTT CGCCAATCTT CCCGAGCCGG GTACTCCCGA      1680
     GGGCGATCGG TTCGAGTTCT TGTCCCTCCT GATCTCCCAT TACGAAGACC AGCACTTCCC      1740
     GATCCCCGAA GCGGACCCGG TGGACCTTCT GCGGTTCGCC ATCACAGACA TGGGCCGGTC      1800
     TCAGACGGAG CTTGCGGAGC TGCTTGGTTC GCGTCCTCGC GCGTCCGAAG TCATGAACCG      1860
     GAAGCGGGCT CTGACGCTCG ACATGATCCG GGGCATCAGC GCGGCCTGGA AGCTTCCCTT      1920
     CGAAGCGCTG GCGGCTCCGT ACACAGTGAA GCGTGCGCCG CGTTCGTCGG CACGGCGGCA      1980
     AGCGCTAACC TGATCTCTTC CACGCTCGGC GGCGCTTGTT GGCCGGGCGA GGTTCCTTGC      2040
     CACTCGACCG AAGCTGCCGC AGCAGTCTAC GCAGAAGCGT AGCCATTGGC CTCGATGCCC      2100
     TGCCATGCCG ATCCGGCGCG AGCACCGCTT CTTCTACCCG ATCGATTGGC CGCAGCTCTC      2160
     GGCCGTGATC CGCTTCGGCC GTGCGAAAGG CCGGTGCGAG GGCTGCGGGC GCCCGCATGG      2220
     CCGAACGGTG TTCTGCCTCG GCGACGGGCG GTGGTGGGAC GACGAGGCGG CTTCCTGGCG      2280
     CGATGGTGCC GGCGGGCTCG TCTGCATCGA GGTCGGCGCG GCCGACGTGC TCAGCGAGAT      2340
     CCGAACGACG CGGGTCGTGC TCGCCACCGC GCACCGGAAC CATGACACGG CCGACAACAG      2400
     TCCGACCAAT CTCGCGGCCT TCTGCCAGCG CTGCCACATG GTCCACGACC GGCCTGAGCA      2460
     TCAGCGGCGG CGCTGGCGGA CTCTGTTCCG GCGGAAGGCG CTCGGCGACC TGTTCCGCGG      2520
     CCCCTACGGC TTATAGGGCC TGCAAACGAA AACGGCCGGG GCTTCCCCCG GCCGCTCTTA      2580
     CCAATTCTGA CGCTTAGCTT ACCGGAAGAG CGAAAGGACG CCCTGAGTCG AGGAGTTGGC      2640
     GATTGACAAC GTCTGGATCG CGAGCTGCTG CTGGGTCTGC AGCGCCTTAA GCTTGGTCGA      2700
     CTCTTCCTCA ATGTCGGCGT CGACCAGAAT ACCAATAGCG CGATCGTTCG ACTTCATCAG      2760
     GGTGTCAACG AAGGTCTTCT GACCGTCAAT CTGGGTCTTG GCTGCACCAA GCGTGGTAGC      2820
     AGCCTCAGTG ATCTTAGCAA TTGCGCGGTC AACAGTATCG ATATGAGCCT TGAGAGCTGC      2880
     ATCCGTCGTC GAATTGCTGA TAGCAACGGC TGCTACGTTG GTATTGCCAG AGTCAAGAAT      2940
     TCCGCCGCCT GTTCCTGTCG TTTTTGCGGT TCCAACACCA TTGTAGATGA CAGCTTCATC      3000
     GGTACCGAAG CCGATATCAA TCGCAGTACC TTCAGCTCCG TCCTTAATGT TTACGGCAAC      3060
     TGTGTCAGTA TCCGGGTTGC CAATAGTTTC GAACGAAAGA CGACCAGCAG AGTCAAGAGA      3120
     GGCCGAAACC AAACCTGCGA GATCAGAAGC TGCAATCGAG TTATTAATCG CTGAAAGCAA      3180
     CTCGTCTTTG GTGACCGCAC CAAGATCTTT AACATGCGCG GTGAGGCTGG ACTTATCAAG      3240
     CGTAATGTCA GCTGACTCGC CCGATCCGAG TGCAATCGTC AGCGTGGATT GCTCGTTATC      3300
     GTTGGTCTTG AAATCCAAAG TGCCGGCGAT TGCGGTGCTT GCAGTGACCT TCGCAGACGT      3360
     AGCAGCAGTC GCGGTCAACG ACTTGTCATA AAGCTGGATA TCGCCGACCT TCACATCTAC      3420
     AGTGGAGAAC GATATATGTC CAGTGTTGTC ACGTGAAAAT CCGGCAACGA TCGACTGAGT      3480
     TGCTTTGTAG ACGCTGGTGT CGGATGAATT AACCGATAGC CAGTTCTGAC CACTCTGGAT      3540
     AGAGGAGTCC GCAGTGGACT TCATGTTGTC CTGAAGCGAC TTGATCTCAG TCTGAACCTT      3600
     TGAGCGATCA ACACCAGGAG TAAGAGCAGC CTGAAGCTTA GAGCGCATGT TCTGGAGGTT      3660
     GCTGAGCACG CTCGTGAGAC CGGTATAGGC GGTGTCAACG GTCGCGGAGC CGAGCCCAAG      3720
     AGAGTCTTTA ACCGCGCCGA GCGAACCATT GTCGGTGCGC ACTGTGGTCG CGATCGACCA      3780
     ATAGGCAGCG TTGTCGGCGG CGCTGGAAAC GCGCTGGCCG GTCGAAACGC GGTTGCTGGT      3840
     CACGTCGAGC TGAGTGTTGA TGCTCTTGAG GGTCGTCAGC GCCGTCATTG CGGCGTTATT      3900
     CGTCAGAAGG CTGGTCACGG TGTCTCGATC CTAGAACGGG AGAGGAGAGG CGGAGGGGCA      3960
     TCCGGGCTCA CACCGGGAAA GCAGAGCGGC ATCATGCCTA TAGACCCGCT TTGGGGGCCT      4020
     AACCTGCTAC GCACTACACC TCGGGCTCTC ACCGGTTCGA TAGATCGGCA TCATGCCTAC      4080
     AGACTTTTAA GTCTGCTCCA CCGCGCTTGA TTTGCCGCTG CGTTTTATCA AACGCGATCA      4140
     TGACCGGCTC TCCGGTTCTA GATGGCGGCA GTTATCAAGC GCTTAATCGG CTTCAAAGCG      4200
     GGAACGCGAT GGTGGGCGAC GGTTAATAGC CCGCTTAGAG CCACATTAGC AGTGGCTAAC      4260
     TAATTAAGTG GCCTCGCATC AACTTTTGTC TCATGACGGA TCATTGAGAG TAATTTCTGC      4320
     AGTTCATTTG CTTTCACGGC TTCCTGTATT ATATTTTTCG TCTCCGTAGG CAGACTAGTA      4380
     AGTGAGTCGT CGAGCCTATT TTGCCATTGA TTTCTGAAAC CCGGCTCAAT CAACATCTGC      4440
     TGTATAAAGT AATATGCCTT TTTAAGATGT GATACTGCAG TGTCTTCTGA AACAATTTGG      4500
     CTTGGCAACA GAAATGTATC CGAAATCATA ATCTCCACAT TGACGGAGTC ATGTGCCCGT      4560
     ATCAGTGCGC CGTTCAAAAA GAAGACCTCT CCTTTTCGGA TGAACGCTTT GGTGTGGTTT      4620
     GATTTCGACA CGTCTCTCGC CCGCTCATAG ATCCGGCCAC CTACCTGTGG CGTTAAATTC      4680
     TACGGAGCTT GTGCGAGCCT GCCCTCCTAC GTGGTCGATC AGCAGGGGCA TCCGGTCGCA      4740
     TTCATCGAAC ATGTTCGGGC AGGCTGCACC GGTGTCGCCC GCACGACGCG GGCGGTGCTC      4800
     GCCGCCAGCC ACCGGAGCCA CGACATGGCT GACAATTCGT CGGGCAACCT CGCGGCATGG      4860
     TGTCAGCGCT GCCACCGGCG CTGGCGAACC CTGTTCCGAC GGAAGGCGCT CGGCGACCTG      4920
     TTCCGCGGCC CCTACGGCTG ATCTGCGGAT CGCGCCACCG CCGCTGCATA AGTCGCGATC      4980
     AAGATGCCGG CCCAAAGCGT CACGAAGCAC AAGATGATCC GATCCTTCGG CTCTTGCTGC      5040
     TTGATCGGGA TCGCTGCGGC TTCGGTCCCA AGATCGATGT GGGCCTGCCG ATACGAGGCC      5100
     AACGTTACGG CCCTGTGTGC CGCCAGGGCC TTCTTGAAAT TCACCGCCTC CTGCTTACCG      5160
     ATCCTCGCCT CCAGGCTGTG AGCGAATTGA TTGCGGAGTG AGCCGGCGCA ATTCAGGGCG      5220
     GGCTCAAAGC TTAGATCGAG ACCGAGAGCA ACCGCCAGCT TCACCCGCAT GTTGTAATCG      5280
     ATGTCGCGAT CTTTGATTGC CTCCGGCACC GGCAGCCGAG CCTTGATGAA CGCGATTAGT      5340
     TCGTTCTCGA TGTAGATGTG CCCCCTAACG ACGGCCCCAA GCTCGTCGTC GCCTAAAAGG      5400
     GCGCGGTTGA AAGCTTCTAG CTTCGCCTCG ACGTTCAAGC GGGCGGGTAC ACTCTGCTCA      5460
     CTCACGATAC CACTCGCATG CAGGGACGCG CCGGCTGCAC GCGAACGGGG TGAACGCGGC      5520
     AGCCAGCGCG CTCGCAGACG AGAGCCCTGA CGCTCAACCG CCGCGATCGG GGATAGCCCT      5580
     CATCAACGCC TGAACGGTCC CGTCGGCTGC GTCACGTCTC GCACCACAAT CAGGTTGATG      5640
     CCGCGCCGAC CAATATGCAC GAAATCGATC CAGAATATGA AATCAACCCA TTTGCTTCAT      5700
     GACGCCACCA ACAGCACATT CCTCCTCACG AAGCGACGGG CACCCGTCGC AACAACGAAG      5760
     AAGAGGCTGA ACACAATGTC CAAGCAGATC ATCTCGCGCG TTGCTGCCGC TCTGGCGCTG      5820
     ACCCTGACCG CCACCGCCGC CATCGCGGGC GAGCCGGCCG GCATCGACAA CACCAAGACG      5880
     GTCGGCGCCC TCACCCTGGA GACTCGGGGT CTCGCCACCG ACACGGGCTC CGTGCACCGC      5940
     CAGGGCGGCT ATTCCCTTCC CGGCGCAGTC CAGTGGAAGG TTCCGGCTAC CGACGATCGG      6000
     GTGAAGCAGG CCGCCGCCTT CTAAGGTGGT CGCAGAAAAG AGAACGGCCA CGGGAGCCAG      6060
     AACGAAGGTG CGCGTACATC CGGCGTCACC CTAATCCCGG CATCGTGGCC GCGTCCGATC      6120
     AAGCGACGAG ATCGCGATCG GCATGTCACT GAAATGGGGC GGTATGGTTA ACAATCAATG      6180
     AGCAGCCCCG CCGCCCGATC TGCTCACGGG CTGGCGGGGC ATGTCGTGTC CACACGACGG      6240
     AGAGCCAAAA CGCAACGCGG CTCGTGCTCA GAGTGCCGCG ATTGGGTTAG CTTGGCATCA      6300
     ACCTACCCTG GCCCCGCCTG TCCCATTTCG CGGCAGTGCT CACGCCTTGC CGCGTCGGAT      6360
     CACACGCGGA TGTAACAGCA CCGCAGCTGG AGCTAAGAGC CTCCTGAACC CTGCCGCGAA      6420
     GAAGGAACGG AGTCGGGCCA GCGCTGCGCT GGGATTATCG TTGCAGGCCC GTGGCAAGCG      6480
     GCTCGGCCAC CGCTGCCACT TCCGGATCGA ACTGGGGGCA TCGATCACAA AGCCGGAGCG      6540
     CGGACTATCA GATTGATGGC GGCACGACAT GTTCCAGCGT CCCGTACTGC GCAGCATCGC      6600
     TGTCGGCGTT GACGTAGCCA AAGCTACGTG TAGGACGGCC AGCGTGCCGA TCGATGAGAC      6660
     AAAACGGCAT CTGCAGGTGA GACTACATCC CCTGCCGCGC CGAACCGAGC CGTATCACCA      6720
     TAGACGCGAC CTGTGGCTCC TTCGATTACG ATGAAGCGCG CCATGCGGAG CCCCCCTTTC      6780
     CAGATCCTGC GTCAGGTCGG ATCCGCGGTA ACCACCTCTT AACACCTCTT GCCGGCACTC      6840
     TTACGCAAGC CGCACAGCCG AGGCGCAGCG GCCGCGAGGG CGTCGATGTT CCTGATCATG      6900
     TTCGCGGCAA TACCGGCTGG CCTTCTAGCA ATGTCCTTCA CGGCCTCTAC CAGCCTGCTT      6960
     CTGGCTCTTA TGGCTGGACC GCTCGTTGGC AGCGTTACCG CACTTTGTGC GGCTCTCTTC      7020
     CTGGCATGGC ATCGCGGCTC CGAGTGGAGG AGCGACGACG ATCTCGAACA GCAGACCGAC      7080
     GCAATGGTTG GTGCCCTACG CTCCCTGGCC AAGCAAGGTC GTGCGGTAGA CGCTGCTCCT      7140
     GCCATCCGGA CAACCAAGCC CTCGCAGGCT GCTTAACAAG CAGGCGCGGG AGCCGGAGAC      7200
     AATCCGGTCT AGAGCAAGTG GCGTTGCGCA ATTTTGTGTG TCGGCCGGTC GGGCGTGCCT      7260
     ACATCTCGCC GAGGCTCGGC CCGGTCCGCA ATCCTCGCTG CGCTCGCGGG GTGATGACGA      7320
     TTTCGTTTTG TTGATCTCAG GCAGCGGCGA GCCACGCACA AAGGTTCGCT GCGGCGCTGC      7380
     GGCTAAGGCC GAACCGGCCC TGCAACGCAT TGGCGAGCTG CGGACGCGAA ATCCCGATGT      7440
     GACGGGCGAC TGCATCCTGT GTCATCGAGC GCGCCCGCTG CGCCAGCCGG ACAGCGCGGG      7500
     CCACTTCGGG AGGCATAAGC CCGCCCGCAT AGTCCAGGGC TGAGCCGAGA GAGATCCAGG      7560
     CATCATCCGA GCCGAAGAAG TCGCCGTTCT CCTGAAAGCC ATTTTCCGGC AGGGGTAGCG      7620
     GGACAGCATG ACCGGCCGGG ACCGCCCTCG TCCTGGCTCC GGGCGTAGGC CCGACAGCGC      7680
     CGACGATCTG TCTCTGGCTG GCCTCTCTCG CTGGACCCGG AACGCTCAAT CCGGTGCCGT      7740
     GACCCGGTTT CGTGGTGGGT TGGAGATCCT TCGGATCTAT TGCTGACGAA ATCGGGTCAG      7800
     GTCGGTTCGC GGCCTCCTGC GCTGCCGCCT GCTTAAGCCT CCGCTTGAGG GTCGAAAGAG      7860
     AGATGCCCTG CGCCTTCGCG ATGGCCACCT TCGACTGTGA GCGCGGCGTT GCCCCTGCCC      7920
     TCTGTCGCTT CGCGGCCTGA TGTTCGGCGC TCTTCCGCTT CCGCTCGGCC GCCCTCTCCC      7980
     GACTCGTCTG ATCGACGGCG CCGATGGTCC GGAGGCTGAG GGCGGTTCGC TCGTCCCGGT      8040
     GCATGTTCAG CAGCTCGGCC AGCGTGTCGG CTTTGAGCGG CGGCGGGTCG TGCCGGAATG      8100
     CGTTCTCGAC AGCGGCGGCG ACATCGGCTT GAGGCATGGT CGGAAGCCAC ACGGCAGCCC      8160
     ATCCAAGGAT CTTGTCGTGC GCCTCGTCCC CGCCGCCGTG AAGGCGCAGC AGATGGGGCA      8220
     TTGCGGCCCG CAGATAGGTC GCCCCGTCGT CGGTATCGCA GGCCCCGCCG TGGCGGTGAT      8280
     GAATGACCTT CTGCACCTCG GCGAGCCGTT GCCGGTCGAT AGACCATGCC TGCCGCTTAC      8340
     CCTTGTGCCT CCGGTTGCCC TGACCGTGCT TCTTCTCGTG CTCGACCGCT TGGCGTGTGG      8400
     CCGCGACGCG GGCGGCCATA CGGTCCCAAT GGTCGAACAG GGTCGGGTGC CCCGGCCGCT      8460
     CCCGCATCAG GCAGTCTCCA AAGCGAAGGA GAGTTGAACG GGAGCAGGTG CAGGCCGTGT      8520
     TCGCGGGACG CGCGGCGCTG GGTCGTTAGC GGGGCGTGGC CGGCGGGCTC TGCCGTCGAT      8580
     GATCGCCCGC ACGCGGTTGA TGAGGGTAGC GAGGGCCTGT TCGTTGCGGA TGCCGGCCCT      8640
     GTGCCAGAGA AACATCCCGA TCATTTCGTC TGTGATGCGC GCCCGTGTAG GCGCTGCGTC      8700
     GGCCTCCAAC TTGTCTGCAA CCGCGAGGGC GAGGGTAGAG GCGTCACGCA TCTGGCTTAG      8760
     CTCTCAGCTC CTCGGCGCTT GCGAGTGCGA ATGTTGGCGG GCGGATCTCG CCTCAGCCTA      8820
     ACACCTGGAA GCCCGCCGTT CTCGGGGAGG AAGACGACCC CCTCGGTTTC CAGAGCGCGA      8880
     CGCAGGCCAT CGAGCGTCAT TGAGTTGGCG CTTATCGGGC CGTCGATCCG CTCGAGGCGC      8940
     TTAATCGTCT CCACCGACAC ACTCGACAGT TCCGCAAGCT CGCCCTGCTC GACCTTCAGC      9000
     ATGGCGCGGG CTGCCCGCAA CTGCTCCCCC GTCAGCATCA CATGCACCTA TCGTGTAAGA      9060
     TTTTGCGCGT TGAGTGTTGA CGCGCTATCG GTATGGGATT ACACGATAAG GGTAATCAGT      9120
     TGACCTTTCA AGGCCCGCCC CGATGTCCAG CCGCCGCCAA CTCAACTGGT CCACCGCCAT      9180
     GCAGGGCCTC CGCGCCGACC GCATTCAGGT TCCAGCCGGC TTCCTCGGCG CCCGCGGTCG      9240
     CATCGAGGTC GCGGCTCGCC TCGGCAAGGT CGCTCTCGTA AAGGCCGACG GCTCCTTCGA      9300
     CCGCGCCGGC ATCATGCGGG CCGCGACGCA GGCCGCGAAG GCGCATCAGC TCTCCTACGG      9360
     CTCGACCTGG GCCGTCGCGA TGTCGGTCTC GCTCAAGGCC GCTTGGCAAG CCGCCAGCAC      9420
     CACCCGCGCC CGCGCCGCTC ACTGATCCCC TGCAATCCTG CTTCCCTCCC CTCCTGCATC      9480
     CCGGCAACCC GACATGCTTC CCGCCATGAC CCGCCGCGCA ACCATCGCCT CGGCTCTCGC      9540
     CATGCTGGCC GCCCCGGCCC TCCCCGCTGC GCCGAGCCCC TTCGCCGTCG CGATCCGCCG      9600
     CGCCCGCCTC GCGGATGCCG CCCACCTTCA AGCCGGCCGC GACAGCATCG ACGTGTTCGG      9660
     CTCGAACGGC CCCCGCCCCG CCTACTGGCG CGCGTACCGG TTCGGCGTGA TGGCCGAGCG      9720
     CTACAGCGCC CGCCGCGCGG TCTACGCTCT GACGCCTGCC ACGGCCGACG AGGCGCACGC      9780
     CCTGGTCGCC TACTTCGCCG AGCGGGCAAG CCTCACGGCT GATCCTGGCG CCGCGAAGGC      9840
     CGCTCGCCGT CGGCTGCGCA AGGTGTTCGC CCGGCCGGGC GCTGCGAGCG CCCCCGAGAT      9900
     GCCGGCGATC CTCAAGCCTC CCGCGCCTTC CTGAGATCCG GCAAGCCGCT TTAGCGGCAT      9960
     CCCGCATTCC CTCACTCCCT GATCCCCTCA CGAGCCCAGA CCGGAGCCCG AACGATGTCG     10020
     CACGTCCTGA CCATCCGCAG CGATGCCGAA ACCGTCCCGT ATCACGCCGA CCCGATCCTC     10080
     GCGGCGATCG ACCGCCACGC CGAAGCGTGG AGCGTGTTTC AGGTCGCCCC CGAGGGGCAA     10140
     GCCAGCGTTG ACGCCGACGC CGAGGCCTTC GACGCGCTGC ACGCCCTGCT TGCCACGCCC     10200
     TGCGCGACGC GGGCCGGCAT GTTTTGCCTG ATCCGCCATC TTCGCTGGTG GCTGGCCGAA     10260
     GAGGCGGTGA ACGCGGGTGC CTACAACACC GACGACGGTC TCGACGCCTG GGGCGTGGCA     10320
     CAGGCCCGCG AAGCCGACCT GTCCCGCTGC CTCGGCGTGG AGCGCATCGA GCGCCTTCCG     10380
     ATCGCGCTGC CGTCCGGTCG CCTGCTCGGC CCCGTCATCG ACCTGCGTCC GGTCGCCGCC     10440
     GCCACGCCCG TCCGCTTCGC CCGGCTCCTG TCTCGTGCCG GTGACGTGGT TGCCGCCCTG     10500
     GCCCTCGTTA TCGGCGGCTG CGGCCTCACG AGCCTCGCTT CTCTGCTCTG ACGCTTAACC     10560
     CGCAATCCCG CCATTCCTGC ATTCCTGGGA GCCTGCAATG CGCAATCCCC TTCGCAGCCT     10620
     TGTCACACGA CCCGCTGACA AGCCGTCTCT GCGCGACCGT CTGGCCGCAA CCCGCGAGCG     10680
     CTTCCGCCGT AGGCCGGCGT CTCAGGTCTC GCCCGAATTG GCCGGCTTGA TTGCCGAGTC     10740
     CGAACGGCTG GCCGCGGCAA TCAAGGGGCC GGACTGCGAT GCCGGCGACT GGTGGCCGGA     10800
     TCGCGGGTTG GTGCATCAGA GCGTTGAGGC GCGCGCGGCG GTCATCTGCT TTCCCTCGGC     10860
     TGGCGTGGCG GACACGGGCG CCAAGCTCGC GAGCCTCGGC CGCGTTCAGG GCGCGAACGA     10920
     CATCCGGGGT GAGGTGCGGT GCTCCATCGA GTACGGCAAC GCGACCTATG ACGACCTCGC     10980
     CCTAATCGTC GTCGCCGAGC TGCTGGAAAT GCGCGGAGAC GCGGTGGCAC TGCTCCCCGC     11040
     CCCGAACCCC GATCCGATCT TCGCGGCGAT TGCGGAGGGC GAACGGCTCC GGCGGATCTC     11100
     CGATGAGGCT TACCGCCTAC CCGACATGGG CCTCGACCCG CTGCCGGAGA AGGAAGTGGC     11160
     TTCCGAAGCG CTCTACGCGC ACGTCAACGG CGTCCTGCTG AAAACGACGC CGACGACAGC     11220
     GGCTGGGTGT GCCGCATTGG TCCGGTTCGC CCAAGCCTTC CGCGAAAGCG AGGGCATCAG     11280
     CCTTTGCGAA GGCAACGCCG AACTCGTCGC CCTGATCGCG CGCTCGCCCG CGCTCTGACC     11340
     CTGCCCCTGC GGCGGGGCTC CCCTCGCCGC ACGTCCCTGC ATCCTTTGAT CCAAGGAGGC     11400
     CGCCGTGCCC TCTCTCAACC TGCGCAATCC GCTCAAGCGC GATCCGAACC GCCCCACCCT     11460
     CAAGCAGCGC GCCGTCGCGC TCAAAGCCAG AGCCGGCCGT GTCCTACGCC GCCCGGCACC     11520
     TGTCGAAGCC CCTGCGCTGG CCACGGGTGC CAACCCCCGC CTCGCTGCCC TGGTGGCCCA     11580
     GTGCCAGGAA GCGCGGCGCA AGCTCAACGA TCCTGCCATC CCTGACGGGC CCGAAGCAGA     11640
     TGCCATTGGC GAGGCTGAAA CCTGTCTGCT GATGGAAGTC CTTCGGTTCC CGTCCAAGAC     11700
     AGTCCACGAT CTGGCAGCCG AGATCCCGTT TCTTCGGGAG GAGGCCGAAG ACGCGGCGCG     11760
     GGGGTGGGAC GGGCGCCGGG TGCCCTTTGA GGCTTCCGTG CCGGGCGCGG CGTGGGCGGG     11820
     GCTGCTACGG GACATCGAGC ATCTGGCCGA AGCGGCGCCG TCGGCCGGAG CCAAGACCGA     11880
     TCCGATCTTT GCGGCCACCG AGGCGAGCAA GATCTCGCAT TCCGCCTCGC AGCCGGGAGC     11940
     CTGACCAATG GCCGACATTC TCACGTTCCG CGCCCGTCGC CCGGCCCCCA CTGTGTCCCG     12000
     AACCGACGTG CTCGACGGCC CTGCCCTCCG GCTCGAACTG GAGCAGGCCG CACAGGCTGC     12060
     CCTCGATCAG GCTGAGCGCC TGATTGCCCT CCTCGATCGC ATGGACGGCA ACGCCGACGA     12120
     CGAGGACGGC GGCGACGCGG AACAGTCGCT CGGCGCTCCC GAGGGGCACG CGAGCCGGAT     12180
     TGTCTGGCTT CGCGGTTCTG CCAGCGACGA CGAACTCACC TCATAGGAAC GCCGACAGGC     12240
     CGAAGCCGAG CAGGCACAGG CCACCGACGA TGAAGCTGCC GGCCATGCTC TCGCATGCTG     12300
     CCTGCGGCAC GGGCCGATCT GGGGCAGCGC CTGCGAGCGT CGCTCCCGAG ACGAGACAGA     12360
     TCAGGCTCAG GACGAACATT CCCCCCTCCC TCGCGGCTCT TCCGGCCGCC CCTCAGCAAA     12420
     GAACACGGCA CACCATGAAG ACCCGTCTGA CGATGTGCGC AGCCCTCGCT TTCGGATTAC     12480
     CCTCCCTTGC GCGGGGATTG GCCGGATGCC GGAGAACGTC GCCGAGCTGC ACGACCTGTT     12540
     CGGTGAGCCG GGCGGCCCTG AAAGGTCCGA ACCGCCCAGC GAGCACATTC CGACCGCTGA     12600
     TCCGTAGCAC CCCTGAAATA CGCGATGCCG GGAAGCCTGC AAGCCGCAGG CCCGGCTTTG     12660
     CTGTGTTCCG CCTTCCCGCT TCACATGCGG GCAGGGAAAC CTTAACCACG GCTCCCCACA     12720
     GTGCCGGCAT TCCTGCTGAC CGCGCCTCAG GACAACCGCA ATGCATGTCA TCCTGATCGG     12780
     CACTCAGAAG GGCGGAAGCG GCAAGAGCAC GCTTGCAGCG CATTTCGGTG CGCTGGCCGA     12840
     GCGGGACGGG CGGACGCTGC TTATCGACGC CGACCCGCAG GGCTCGCTTG CCTTCTGGCA     12900
     CCGACGGCGC GAGGCCAAGA CGCCGTTGCT CGCCAAAGCC GACGGCAACA GCATCGCTGG     12960
     CATCCTCGAC GCAGCCGAGG CCGAGGGGAT CGCCTGGGCG GTGATCGACA GCCCGCCGCA     13020
     CAACGCGGCC CTGATTGCCT CGCTGATGTC TCGGGCGTCG GTGACGGTCG TTCCAGTTCG     13080
     GCCGGGGCCG TTCGACCTCG ATGCCGTCGC GGCAACGTTG GCGATGGCCC GCAGCCTCAA     13140
     GGCGCCAATC GCCTGTATCA TCAACGCCGC CCCGCCCATC ACGCGCGAGG CCGAGACCGC     13200
     CATCGTCGCC GAGGCCCGTG CCGTTCTGAC GGACATGGGC GCCCCGGTCC TGCCTGGACA     13260
     GGTATCGCAG CGGGCCAGCC TGTCGCACGC CCTGATCTCG GGGCAGTCGG TCAATGAGTA     13320
     TGACCCGGAG GGCCGGGCCG CCTCCGAAAT CGCGGCCATG TGGTCAGCCG TCACCGAACT     13380
     AGCGCGCAGC TTTCCCCGCA AGCCGTAGTG CCGGCAAGCC GCGTTGCCTG TCCTCCGCCA     13440
     TCCCTGCAAG CCTGAGAACC GCGAACCATG GCAGCACCGA AGCGCCCTAG CCTCTCCTCT     13500
     CTGGTGGAAC CCAAGCCGGC CGCTGCGCCC GAACCCGCCC ACCAAGGCGA GGCATCGGCG     13560
     GATCGTGCAC CGACTGCGCC GCCGCCGTCG GATCTCAAGA CGATGCAGGT TCGGGTGAAC     13620
     CGGGCCGGCT GGCTGGAAAT GACCCGTCTC GCGCAGGATC TCGATATCCC GCTTGAGGCT     13680
     CTGATGGTGG AAGCGTTCAA CGACGCCCTG ACGAAGCACG GCAAGCCACC TGTCGTGGAG     13740
     CGGCGCCAGC CGGTGAAGTG AGGGCCTGTC GGTGCCGGAC CTTCCGAACT CCAAAGCCCT     13800
     GCGGCACGCG GCGCAGGGCG GGGGCTACCT CTCGACCGGC CGTGGCGTGT TGAACGCGAC     13860
     AGCGGATGAG CCGCACCCGC TGCACTACAA GGACGGTCGG GGCCTGCGCA TCCAATTCTC     13920
     GTTGCAGGCC GGCGGCGGAA AGTCGGCCGT CATTGCCTGG ATAGCGCCTG CCGATTTCGA     13980
     CGTGATCGCG GATCTGATGA TGCAGGCCGA TCCGGTCGCG GCTCAACGCG CGTTCGGCAA     14040
     CGCCCTGGTG AAGGACGCCA AGCGCAAGCG CTGATCCCCG CCGGGAGATT TTACGCTTTT     14100
     CTGAGCGAAA GCCCCTCCGC TTTGCAGGCT TGCCGGCATA CCTGCATTCC GCCATTGCGG     14160
     CTATCCTCGT TAGCGGCTAC GCAAGACAAG AATCGTTATC TTGCGTTTAA GATTTCAGAC     14220
     ATGTCTACCG CCCTCGTTCC GGTCGAACCG CAACCGGTCG CGATCCCGGC TCAAGCTGAC     14280
     GACGACGAGC ACATGCTGCG GCTGTGGCTC GCCCGATCGT CCAGCCCGAA CACCCGGCGT     14340
     AACTATGAGC GCGAGGCGCG GCGCTTCCTG GCGCACGTCG GCCGTCCACT CGCGGCCGTG     14400
     AGGATGGGCG ACCTTCAGGA GTACATCGCA GGGCGGCCGG GCTCGTCGGC GACGACGGCG     14460
     CTCTCGGCCG CCGCGCTCAA GAGCCTGTTC GCCTTCGCGC AGGAGGCCGG CTATCTGCGC     14520
     TTCAATGTCG GTGCCGCGGT GAAGGTGCCG CCGATCAAGA ATACGCTCGC GGAGCGCATC     14580
     ATGCCCGAGG GCGACGCGTT GCTGATGATC CGGCAAGAAC CGGCGCTGCG AAACCGGGTG     14640
     CTGCTCACGG TGCTCTACGG CGGGGGCCTA CGCATCTCGG AAGTGTGCAG CCTACGCTGG     14700
     CGGGATCTCG CGCCCCGCGA TGAGGCCGGA CAGGCGACGG TCTTCGGCAA GGGTGGCAAG     14760
     ACGCGCGTGG TCCTGCTTTC GGCCGCGACG TGGAAGGTGC TGCAGGCTCT CCGCGAAGAG     14820
     GCGCTAGCTG ATGATCCCGT GTTCCGGTCA CGGAAGGGTG GGGCGCTCGA TCCGTCCGCC     14880
     GTCCATCGCA TCGTGAAGGC GGCGGCGGCC CGCGCTGGCC TGCCGGCCGA TGTCTCGGCA     14940
     CACTGGCTCC GGCACGCGCA CGCCTCGCAC GCCCTTGACC GCGGCGCCCC GATCCATCTC     15000
     GTGCAAGCAA CGCTCGGCCA CGCATCTGTG GCGACGACAG GCCGGTATCT CCACGCTCGG     15060
     CCGTCGGAGA GTTCGGCGCG GTTTTTGGGG GTCTAGATGA GCGCCGAGGT AGAGGTCTTC     15120
     CCGCCCGAAT TGGCGGCCTT GGTCGAAGCG ATCCAAGGGG CTGTTGGTCC TGCGGCTATT     15180
     GCGGCACGAA CAAAGGCACG ATCGTGCTTG ACCACATCAT CCCGAAGGCG GGCGGCGGAT     15240
     TGGACGCTGC GGAAAACCTC ACGCCAGCCT GTGAGCCGTG CAACCAGCGG AAGGGCGCGC     15300
     AACTCGGGTG GGTGACGCTT GACGGAAGGG TGGGAACTTA TGACCCGAAG ACGGGACCGC     15360
     TGCCGCTGCT CAAGCGGAAG AGGAGAGGTA CGGATAGACC GCGCGATCCG TTCCGAGATC     15420
     ACGCTGGCAT CGACTTCCTG TAGCGCCGCT GTTCCGACCG GTGTCGCGCT CAGGGGCGGA     15480
     TCTCGCCCGC ATCATGGACA TGAGCGGCCA CCGCGACCGG CGCACGGTCG TCAGCTAAAT     15540
     CCGCCGGGCG AACGCCTTCA AGGATCACGC AGGCGGTGGA TTTCTATAAG GCTCAGTTCA     15600
     AAAGGCTCGG ACGCTCGATA GCACTTTCCG ATGCAATATC ATGAAGCATG GCTTCGTGCT     15660
     GGAGTAGCAG CTTTCCTACT TGCAAAGCCT TGCCATAATC CAAGTTCATT AAACTATCGT     15720
     ACAGATAAAA AAACAGAATA TCGTAGGTCC TTGTCGCTGA CATCAACTCA TTCGCTAGCT     15780
     CAACGACTTC ACTTTCAAGC GCACTATGAT CCTTGCTATC ATATATACGC TGTAAGAGCA     15840
     TATATATGCG CTGACATATG GTGCCGGCTT CTGGTGCTAA TGACAGCCCG TCGAGTGAGA     15900
     ACACTGCTTG CCGGGACATC CCAAACCCTG AGCCTTTGCA CCTCTGTGCA TGAACTCACG     15960
     AGAATGGTTA ACAAAACGAA AAGAAACGGC CAAGGCAGTG CCTTGGCCGT TCCGACTACG     16020
     AAGCTTCCGA GCGATTAGCG GAGGAGCTGC AGGATGCCCT GCTGAGCTTG GTTCGCCAGC     16080
     GAGAGTGCCG AGATGCTGAG CGACTGACGG GTCGACAGCG CCTGCGAGTT AGCAGCTTCT     16140
     GCGTTCAGAT CAGCATCGGT GAGGTTCGAC GAACCGGTGG TCAGAATGTT GATCAGCTGC     16200
     TTCGAGAAAT CCTGCCGGTT TTGCACGACC GAGAGGTTGG AGCCAAAGGT GGACGACTGC     16260
     GCACGCAGCG TGTTGCTGGC GGAGTTCAGG GAACTGACAG CAGTAGTGAT ATCGTCGTCG     16320
     CTCTGGAAAG CCTTCCCTGC GTCATCGATG GTGATGGCAG CGATGTTGAG GCCTGCTTCG     16380
     CCAGTGGTAA GATCGACACC ATCGATGTCC AATGAAGCGC TATCGTTTTC ATTGAACTGA     16440
     ACGTGCAGCT TATTAGTCTT TTCTCCGCTG CTGATAAGAT TGACGCCATT GAAGCTAGCG     16500
     TCTTTCGCCA TCTGGTCAAT CTGTGTCAAC AAAGAGTTGA ACTGCTTGGC GAGACTGGTG     16560
     CGCGTCTTGT CCTCGCTCTT GAAATCAGCG GTGCTCGCTG AACCAGCTGG TGCGGTAAGG     16620
     CCCAGAGCAG TGGCAGTTGC TGTGTCTTTA ATCTCAACTT TTCCAGCGCC ACTAGCAACA     16680
     AGCTTGTTAC CTGAGTCGAG GCTGAAAACC TTGGTGCCAA CAGCAGCATT CAACTTATCG     16740
     ACAATTGCCT GTTCATCGTC ACCACTCGCG GGCACTGCAG GAGTGCCAGC AACAGCCGCG     16800
     ACGTCATCGC CACCGCCAAC TACACCATCA GCCCCGTTGC TGGCCGGCGT GCCTGCTACA     16860
     GCATCTACGG CGGCAGTGTA CTGCTTGATA TTGATGCTTT TTTCGACGCC ATTAACTTCG     16920
     ATTTTCAAAA CACCGTCGGC CGTTGGCTGA ACGACCGCAG AGGCGCCGAT GCCCTCAGTT     16980
     GTGGTGTTCT TGCTCGCGAT TGCTTGGCTG GTAATAGACT TGGCCTGATC GACAAGCTTC     17040
     TGGATGGACG TGATGCCCTG GTTCGCCGCT TGGACCACCT GGATGCCGTT CGAGATACCA     17100
     TCAAGGAGGC CGTTAAGATC GCCGGATCGG CTGTTCAAAG ACTGCGACGT GAAGAAGTTG     17160
     ACTGGGTTAT CAAGCGCAGA ATTGACCTTC TTGCCGGTCG AAAGCCGGTT CTGGGTAGTA     17220
     GACATCATCG CTGCGGTGTC CTGCAGAGAA AGCAGGTTCT GGCGCGTCGC AGCGGAAAGC     17280
     GTGATGCTGG AAGACATTCG AGGCAATCCT TTGTCGGATT AGAACCGCCT TGTGGCGGCT     17340
     TACTCCGAGT AGCGACCAAA CGTTGATGCA GGCTTAAATC GATCGAACAA AAAGGATCAC     17400
     GTTTCCAGAT AATTAAAACT TCGTTGCCAA GAGAGTATGG CCCATCAAAA GGATCTGGCT     17460
     ATGCCGCTTC GCATCACGTT GAAGCCATTT GAGCGCCTCA TTATCAATGG CGCTTTGATC     17520
     AAAAACGGCA GCAGAAACAG CAATTTCGTG ATTGAGAACC ATTGTAAGTT CCTCCGTGAA     17580
     GGCGAAATCA TACACGAGAG TGAGGCAGAT ACACCGTGCA AAAAGCTGTG CGTGACTCTT     17640
     CAGGTACTCC ATTTGTCTGA AGATCCTGCC GAAGTGGAAA ATCTTTTCTT CCGCCAAGCT     17700
     GTCGATGTTA TGAAAATAAT GCCCAGCGCC GCCCCGTTTA TGTCAGCTAT ACAGAGTGCG     17760
     CTGGCTGAGA AGAATACTCA TGCAGCCATC AAGGCCGGCA AGCAGCTTGT CTATCACGAG     17820
     CGTGATCTCC TCGCGGCTCG TTCTGATGAG ACAGCTGCTG CGTAGTCAGC GCCACGCAGT     17880
     ACCTGAAGAT TATTGATGAG ATAGCCGAAA TGAAGGCGGC TCCTCGCCCT CTCCGGTCCT     17940
     AGCTCATTGC AGGGACGGCA GGCTCTTCTC TCGTAAGTTG TTCATCAGGT GCTCGACCTA     18000
     GCCGGCGAGG CCGTGGTCGG TCGGATCGCA GCCGGCGCGC GTGTCCTCGA TCATGGCGCG     18060
     CAAGGATCAG TGCTCGGCGA CATGGGCGGC CGTCCACTCC TCGACCGTGA GCGGCGGCTG     18120
     CATCAGGTAA AGCACATCGC CCTTCACCGA GGCCCGGCCG TCCTGCACCC ACTGGCGCCA     18180
     ATTGTGGATG GCGTCGCGGC CTTCCGCATC CTCCACGGGA TAGTTCGCGA CGATATTGGT     18240
     AGGGCCGCCG ATATGGCGGG CCGTCTCGTG CCGTTCGAGC CGACGGCGGA GATCTGCGAG     18300
     GCTCATGCGT GGAGGCTCCT CGGGTTGGGA TCGATCAAGC GGCGCTCGAT CAGGAACAGG     18360
     CCGGACAGGT CGATGCCTGC AAGTTGACGC GCGCGGTCGG CGTCGTCCTC GGTGATGATG     18420
     CGCAGCACTT TGCGGGCGTG AGATCCGCTG CGGGTGCGCT CGATGCGGTC CAGGCGCTTG     18480
     CGGAGGCTTT CGAGGCTCAT GGCGCGCTCC ATGACGGTGT GATGGGGCGC CAGACGATCC     18540
     GCGATTGGCC GAGCTGCATC TTGCCAGCCT CGATCATGTC AGCGGTCTTG CGCTCAAGCT     18600
     CCTCGTCGTC ATGGGCGACG ATCCAGACCC ACGGCAGCCC GGCGGCGCCA AGGTGGCGGC     18660
     TTTCGAGCCT TTCGAGGCGG CGGCGGAGGT GGGCGAGGCT CATCGGATCA GACCTTCACG     18720
     CTGGAGGAGG TTGGCGGCCC ATCGCTCGCG GCTCGGATCG GGGTCGCGGA GCCATGAAAT     18780
     CAGGGCGTCC AACTCGTCGT CGCTGTAGCG GTGCACGCCT CGGAGCCGGC TGCGGAACCG     18840
     CTGCTCGATC TTGGCGAGGC GTCGTTCAAT GGCGGACGGC ATCGGCTCCT CCCGTGTCTT     18900
     CCTCGATCAG GCCGGCGAGG GCGGTTTCGC CCGTGGCGCG AAGGTGCTGG ATCGCGGCGA     18960
     GCAGGCTGCC GTGCTCGCGG GCGAGAGCAG AGTAGTCGCG ACGGATGATG CGCCAGAGTT     19020
     GCGCGTCGCT CATCTGCTCC AGGTCGCCGT GCATTCCCTC GCGGCGTTCG ATCCGCTCAA     19080
     GGCGGCGGTG AAGGGCAGCA AGCGTCATTG GCCGGTCGCT CCATCCAGGC GGTTGAGGCG     19140
     TTCCGTCAGC TCGTGGGTCT CAAGGGCCTT CAGGTGAGCA TCGACGGCGC GGCCGATGTC     19200
     GGCGGACTCT GCGGGCGTAA TCGTGCCGGA CGCCACGGCT TCCAGCAGAG AAGCGGTCGC     19260
     CTTCGGGATG TCGGCTGCGG TCTCGATCTT CGGAAGATCA AAGATGACGT GCCGGTCCTT     19320
     CCGAAACGGA ATGATCCGCT CCATGCACAT GCGGAGCGCG ACGGTATCTC CGCCCAGGGC     19380
     GAGTTCGATG GCCTTGCGGG TCAGCGCGTC GGCCTCGCCT TCAAGAAGTT CCTGCATGGC     19440
     GATGGTCGTG CGGTTGCGGG TGCCCGGTGT TTTGCCGGCC GGGTTGCCGC TCTGCCCTTT     19500
     CTCGAACCGT CCGCTGTTCG TGTTCATCGT TCGTGTCCCT TGGTGCTCCT GCATGTGCAG     19560
     GCCGGTTGCA GGCGCCATCC CTTCAAAGCG GGATGCCGGC TTCGGGGATT TTATGGATGC     19620
     CGAAACCCCG GAAAGCCTGC GGTTCTATGT GGGTGGTGTC GGCTTTCAGG CCGTCGGCAA     19680
     GGCCACGCAG GGCGGCAACG GCTGCCTGCT GGCGCAACTC GCCAGCGTCG TCGCGGAGTT     19740
     CGAGCGCTGT CGCGGCGATG AGCGCCATGT GGGACGCTTG CAGCAGGCCG GCGCGGTAGG     19800
     AGGCGAGTTC GCGGGTGTTC ATTTCGAGTG ACCCTGAAGC TGATCGAAGA GCGCGGCCAG     19860
     TTCCTCGTCG TAGTCGTCCA TCGCGTCGCC TTCGGGCAGG GCGAATTGCT CTACGGCTCC     19920
     GTCCTTTTTG CGGATGATGC ACCACGCAAC CATCCCAGGC TCCGGCGGAA CCGGCCACGC     19980
     CTGGAACTCG GCGGGCGGCT GCCGGCGCAT GCGGAACTCT CGGTCTGGGT TGTTGTGGAA     20040
     CCACTGGCTG TCGATCTCAG TCGCGATCAT CTCGTCCCCT TCAGGCTGCG ATGGCGTTGC     20100
     GGGCCCGAGC GATCATAAGC GCCATCCAGG GAGGCCAGCC CAAGCCTCTG TGAGAATGCG     20160
     TTCGCGACGC TCTGCGCGAT CGGGCGCGGC ATCGCAGACC TGACGGAGCA CGGCCTCAAG     20220
     AACCTCACTG CCGCCGGCCG CTGCGACTTC CTCGCCCTTC CGGCGGATAG CAGCCCGGTA     20280
     AGCCTTCGTG GCCGGTCCCG CAGGCTGCGT CTCGGCCGCA GCAACGAGAG ATAGGAGGGC     20340
     GTCCACGACT GCTTCGGTCA CGGCAGGCTG AACCGGTGTG GCCGGCTCCA TGGGATCGCT     20400
     GGGCGGCGGC GGAACGCCAA GGTGGCCGGT GGTGTGGGGG CGCTTCATGA ATGCCTCTCA     20460
     GGCTGAACGG TGGATGCGGG CGAAGCTGGC GAGCACTTGC CGACGTCCAG GGCCGCAAGG     20520
     GCGGCAATCT CGGCGAGGGC AGATGGCAGG CGAGACACAT CGCGCTCGGC CCGCTCAAGC     20580
     TCGGTGGCGA GGCGTTCGCC GCGCGGGCCG GCGCACAGGT GGGTGATGGC ACGGAGGGCG     20640
     CGGAGGCGGG CCAGCCGCTC GGCGTTGTCG ATGCCGTCGG CGAACGGCCC CCAACGATCA     20700
     ATCGCGGCGA TCATGCGGCG TGCTCCGAAT GGACGAGGCG AAAGCGTGGA CGGCTCCCCG     20760
     AGCCGGTTTC GCGGGCTGCC TGCGGCGGTG GCGCGGGCCT CCTGTCGAGG ATGGCGCGGA     20820
     CGAACGGCGG GAAGCTGATC GGCGCATCCG GATCGAGCCG GGAAATCTCC GGCAGGACCG     20880
     GGGCAGGGCG GCCTTGTGCG GGCTCGGCCT GGGCGGCGCA GGCATAGCGA GCAACTAGGG     20940
     CGGGGTCGTA GTCGGCGGCG CACTGGCGGG GAGCGCGCGA CGCGGCCTTC TCAACTTGCA     21000
     AGGAAGCCAA CGGCCCGAGG CGGCTTGTCA GCCATGCCCG AATATCGGGA ACAACGGCCG     21060
     GGTAGTAGGC GCCGGCCCTC CACTTCTGAC CCACACCGGG CCTCTGGTAG CGGAAGCGCC     21120
     GAGCACCGTT ACACTTCCCT ATAAGAGTAT CTATATAGGG ATCTGTAACG GTGCTCCGGC     21180
     TGGCCCCGGT GTGGCGATGA AGCCAGACCC GCGCGGCTCC TGCGGTCGGC CAAAGGCTCG     21240
     GCCAAGCTGT CGCCATGTCG GCCGCGCTTT CCAGCACGAC GCCATCCGCT TGCATCTCGA     21300
     TCTCCTCGCC CGGCTGGTCC CAAGCTTCGA CCGCATCCAC CGTCACGGGC AGGACGACGT     21360
     TGCACATGAT GTCGATGTCG AGCGGGGTGT CTGTCGTCCG GTTGACACCG CGGCCCCGGC     21420
     CGATGGCTTG CATCAGCTCG CCTTCGCAGA CTTGCCACCG GCACGCCTCG GCGATGGGGT     21480
     CGGGGTGCGC GTCGCACTCG ACGCCGGCCG GGCTGCCGTT TCGGGTTCGG ATGCCGCGAA     21540
     CCGTCGGGGC GTACCAATTG CCCTTGGGGA TCAGATTGGC TTCGCGGCCA GTAAGGGCGC     21600
     CGGCCAGAGC TTCGACTGCC GTAGGACCGG GGACGGTGCG TCCAACCACC ATCAGGGCGC     21660
     GAACCTCGCG GTATTGGTCC AGCCCGGCGA CGTTGTTGAA CCACTCGACG GCGACGCCGG     21720
     CCGGAAGCCC GCTCGACCGC AGCCGGTCGG CAACCGCCTT CTGCGCGATC ACCAGCATGG     21780
     GCCTGCGCCC GATCTCGATA AACCGGCGCA CGATGGCGCG GCGAACCGCG GTCAGGTTCC     21840
     GGCCGGCGCA CGCTTCGTCC TTCGGGCGCA GCTTGTTCAT GGAAACGGGC GCGTCGATGA     21900
     TCTGCCGTAC GCGCACATGC GGCATGGCAG CCTCGATCGC GGGCGGCGTG TCGATCTGCG     21960
     GGAAGAACGC TTTCAGGATC TCCGGCGCGG GCAGCGTGGC ATCGAGAATG AGGGCCGGCA     22020
     CGTCCTGCAA GCCGACGGGG ATCTCGCGCC GGCTGCGGGC CTTCACAACG AGCACCCGGC     22080
     CGTCGTCGCC CTCTCGGTGC TCAAGGTAGA GGTGCCCTGA AACCTCGATC TCGGGATTTC     22140
     CTACGAGGTC GCGGGCCGCG TGCCAAAGGG CAATGAACCC CTTCGCGTGT CGGGCTTTGC     22200
     TGGCGGCCTC GGCAGCCTTT CGACGTTCCT CCTCAGGCAT CCCCGGCCAG AGGGTCGCGC     22260
     CGCCCTTCAA AGTCCATTCG GCACTGATGG CCGCGGTGCA AAGCTCCGTC GTCAGGCCCG     22320
     CGCGCAACAG CGGAGACGCG ATCCATGCGC TGTCCGTGTC GTCGCAGCGC GGGCGGTCAG     22380
     ACCTAAGCGG CGTCCTTGTA GGTGACGACG GCCAACCCAG CCGGCGGCTG GTGGCATTCA     22440
     CGGCAGCGGA TGCGCTGAGC CACCACGATC ACGTCTTCAT ACAGGCGAGC GCACAACTGC     22500
     TCCCACGTCT GGAACGTCTC CTCGCCGCAG GCGGGGCAGC GCATCACCCG CAGGCCGCTG     22560
     TAGCCATCCG CAATCCACTG CGCGACGGTA TGAGCGCGGA CGGGGGACAT GTGGGCT        22617
//

If you have problems or comments...

PBIL Back to PBIL home page