(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1

ID   MICSR_1; SV 1; linear; genomic DNA; GRV; PLN; 1759951 BP.
XX
AC   CP001324_GR;
XX
DT   15-FEB-2011 (Rel. 128, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 1)
XX
DE   Micromonas sp. (strain RCC299 / NOUM17) chromosome 3, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Micromonas sp. (strain RCC299 / NOUM17)
OC   Eukaryota; Viridiplantae; Chlorophyta; Prasinophyceae; Mamiellales;
OC   Micromonas.
XX
RN   [1]
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L., Allen
RA   A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E., Grimwood J.,
RA   Gundlach H., Henrissat B., Napoli C., McDonald S.M., Parker M.S.,
RA   Rombauts S., Salamov A., Von Dassow P., Badger J.H., Coutinho P.M., Demir
RA   E., Dubchak I., Gentemann C., Eikrem W., Gready J.E., John U., Lanier W.,
RA   Lindquist E.A., Lucas S., Mayer K.F., Moreau H., Not F., Otillar R.,
RA   Panaud O., Pangilinan J., Paulsen I., Piegu B., Poliakov A., Robbens S.,
RA   Schmutz J., Toulza E., Wyss T., Zelensky A., Zhou K., Armbrust E.V.,
RA   Bhattacharya D., Goodenough U.W., Van de Peer Y., Grigoriev I.V.
RT   "Green evolution and dynamic adaptations revealed by genomes of the
RT   marine picoeukaryotes Micromonas.";
RL   Science 324:268-272(2009).
XX
CC   This Genome Reviews entry was created from entry CP001324.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1759951
FT                   /organism="Micromonas sp."
FT                   /strain="RCC299 = NOUM17"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome 3"
FT                   /db_xref="taxon:296587"
FT   CDS_pept        join(complement(1474..1486),complement(482..1239))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636006"
FT                   /orf_name="MICPUN_99220"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62028.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199A9E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M8"
FT                   /transl_table=1
FT                   /translation="MARRTDELADGDRAAHLAENQLTSVPAEIGHLTSLERLELNHNEL
FT                   TRVPAEIGLLTSLRALSLSSNKLTSVPVEIGQLTSLTALFLGDNLLTRVPAEVGQLASL
FT                   EGLFLGDNRLTSVLAEIGQLTSLTELSLGNNQLTSLPAEIGRLTSLTALLLYDNQLTSV
FT                   PAEIGQLTSLVKLSLTENQLTSLPAEIGQLTSLTELYLYGNQLTSVPAEIGQLTSLVRL
FT                   YLGDNRLTSVPAAIRELRAAGCNVRMDNGVTVDE"
FT   CDS_pept        complement(2196..3374)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636007"
FT                   /orf_name="MICPUN_107844"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62029.1"
FT                   /db_xref="UniParc:UPI000199A9EA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M9"
FT                   /transl_table=1
FT                   /translation="MVDSGNQWKTRGYLPGVNTWGSRVDTWRVKDFVTTVETSLREAAS
FT                   SVFARCQYGQVGESLKQLASVCSGLSFAERTKILDAASKLLNNLTAFNGTDMTLGNAGD
FT                   TNLQPDANSTDGDASYSVDTAIVRVPTDNETLAAACMGTVVSNSADSSVAPVTSRRRTS
FT                   RRRLSQAEADAATLQDAGCWSRVRNSNDALVGMLLGECIQVSLGAGQQLLDGVKACLKT
FT                   KPDRAINVDYTQDIFVKRTTVNGVEKYTPMSTITVERVGTQICGKVTDVGSFFCPARVA
FT                   PNWATATTDIGSTECPIVDVIGAAKLAAIETIRNRNKASGEKDGPLPGLDQASGIAVLA
FT                   VMCLFICGCCVGCRWLVVRRRRRQQAAAGKAMVVHNTLIHSQTQVVQSTAQP"
FT   CDS_pept        complement(9334..13197)
FT                   /codon_start=1
FT                   /gene_family="HOG000231203" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636008"
FT                   /orf_name="MICPUN_56574"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62030.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG505899"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022577"
FT                   /db_xref="UniParc:UPI000199AA4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N0"
FT                   /transl_table=1
FT                   /translation="MDPPTEEGFDDENELTFVKEAPEVNGLVEQIKDALEGRDPADGTS
FT                   TISKTVFHKIQEIVERYQEYPTLLDPHLEGWILPLTSVIRREAHKGSEADMVLVQRASR
FT                   VLHALASVRGYKTVVKFFPHEAKDFEPVVALLVRSHDVGSLATNMEEADELGSAWETRA
FT                   TLILWLSILVLIPFDLVTVDSQVTTNTGVDGAAMAKSGGQQEAPPVVLRILALCQDSYL
FT                   RDPGIVRDRAAFLLAKLLTRPDMPLALQKFLVWATDALGGQSEYSEQEKMFIVPGIVRA
FT                   LAATFKLGKRSELLEVAERLWTNARDLADSPAAKASTLTRKLACKLTQRIGLLFLKPRV
FT                   VSWRYERGARSLEDNLKRAMIISQGGDADAEDRKKAEEAAAKEQEEDEDWDIPEEIEEV
FT                   IEALLTALRDKDTVVRWSAAKGLGRITARLPAELGDEVVGSILDCFLPTENDNTWHGAC
FT                   LALAELSRRGLLLPVRLPDAVPHVASALAYDVRRGPHSVGAHVRDAASYVCWAFARAYA
FT                   PEVLAPHADALAPSLLIAACFDREVNCRRAASAAFQESVGRLGAFPHGIDIIQVADYFS
FT                   LGSRTKAYTVVADHICGYDEYRRRMLNHLCDVKLIHWERATRELAARTISIIGRRDPEW
FT                   IREVALPVLLDRSLSTNLEARHGACVGAAEALLALKNAGEPCVEGELATKVTGLVTAIE
FT                   KARLYRGKGGEVMRAAVSKYVQCLASVSQPLDKGPGPATGPKSLRSTLLASLEENLKHP
FT                   TVDIRDSAVSAMEEFSASYMVGSNPAAGAKRLIVKLATLLREDQNPAARRGAALALGVM
FT                   PGEMLFSCVPGFAAEAPAEENVDAEADPEMIPAWRMALEALKAASIPEEDVEARDADAR
FT                   VCATKGMAGVLSRMATNLVEDDYAATSQAASEVISSLLTCMEDYCTDNRGDVGSWVREA
FT                   AMEALPGAISALQASGLELATGRCATIVSALLKQCAEKIDRTRASAATALCAVLRGRES
FT                   DMLEPLPDVPGLNKLLDAAPTEERLAASWAVPTSAYAALTPLIVADGSDPLAAYRADLI
FT                   EGIVVSAGGVGDSLGKASGGALVAAVKADPALQETVANELVDLLSRRQGVDRVTVPLLR
FT                   VLDLLFSSGALASVAPAHPDPPNAFAHTLAENLRAELKGSRDVAKLCHGVQALSHVAAL
FT                   GPNVINSDRCARTSGLQGILALMVSRYPRVRRVASEALYVLLLGLDEEAAGEGIEAAIE
FT                   LLSDTRWDAELTMVKPERNKLYPLLGLEAPAAALEAAKGPGVKVKVVDENESYAALVGS
FT                   AGY"
FT   CDS_pept        complement(13366..14031)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636009"
FT                   /orf_name="MICPUN_56575"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62031.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AA4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N1"
FT                   /transl_table=1
FT                   /translation="MQFSEALFPQIFPPVEEGEDPTVMTGDFATDTQPRPGRNAFGQKP
FT                   RWPREAPGGIDRATDGPAAHVLFEPSRLHEATCKGFIEEVTWLLDSAPDEQRCTVDDLD
FT                   PGGRSPLHFAAGYGHLDIVKLLTERKCKLEVRDMWMKAPVDWAIQTEQHEIIELLRIEA
FT                   VKQKIIGGKGEVAPLKTKCEFATGKTFEEIDEFMCNWENKVWDKHERACMEERENRAP"
FT   CDS_pept        join(14271..14315,14430..>16316)
FT                   /codon_start=1
FT                   /gene_family="HOG000005867" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636010"
FT                   /orf_name="MICPUN_66596"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61586.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG320169"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI000199AA4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N2"
FT                   /transl_table=1
FT                   /translation="MSMNGKSALVTGAGSGIGRGLCARLAREGASGITMVDLSDDGLAK
FT                   TSALVSAANPKCVTRLISADVANAEDLERAFRGHVREFGDLHACFNNAGIGERANWRSV
FT                   VDVNLNAVIQGTRLAVDAMRGKMGSAKTSSSDRVVVNVASAGGVFPMPQAPVYSATKAA
FT                   VVLYTQSLAHLHKTHGVRVNALCPQFTDTALVQGQFQAIGEAGAKALLAQTGGELLTVE
FT                   QVVDAAMELVRDETKAGAALAVMNRGDSSGGFVAYVPAPNPKFWKRIRTSSLVPGMGSD
FT                   AVGRYPAPSSLPSTFRKVVVHLLSADFASATKIVDVPMPRPAAGEVLIERRYTGVNASD
FT                   VNFSAGRYFGGAKQAASKLPFDAGFESVGVVAAVGSGVKLQPGQPVATLTYGGFSEYAV
FT                   ERAELVMPVPEASPRALVMLTSGLTASLALEMTGGIPLDDALRGGSAKGKPKTVLVTAA
FT                   AGGTGQIAVQIAKLAGHRVVATCGGDAKAKMLTDLGVDRVINYRKEKVRDVLRREFKQG
FT                   VDVVYESVGGEMFSDAMDALAPKGVCIIIGMMSQYTSGGSDAKSAWVPSNHPGLPEKLL
FT                   WKSASLRGFFLPQYAAHFKRHLTGLFRLMQKGQLRGEIDPTRFAGLEAVNDAVAHLQGG
FT                   KSIGKVVVD"
FT   CDS_pept        complement(16396..17931)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636011"
FT                   /orf_name="MICPUN_99223"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62032.1"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniParc:UPI000199AA4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N3"
FT                   /transl_table=1
FT                   /translation="MVMVSQPTHPAFYEDDVRYHKCNVCAAEFNIPPPTRHELMQSFTG
FT                   AEIAALISEGCVIGSHRVFSDELERQMETMHPIQRLMTGYPHWIKGVYLIVDVREDNGR
FT                   ISLPVRTDASLDRVRQRFQAEAERSGYDGISLEVGGKKHTILAGVGSFKEVKDGDVEGI
FT                   KATLAALKAPAMLVLASETEPDCGEDSVTAVNMCRPVQLPPAAAQHLDALNERSNGADS
FT                   DLSTGIPDMMEWMEKFEDTEQFGSLDEAKNALRLEMHLAQYRATMDVMKKYPGVRRVKV
FT                   EHFIGGPCESDDIMWCVVPGGMKRGWTVVSRTLDSSEDESDESVKRAKSNVSTLVSAMM
FT                   LAHTRAVRRDDAQGDVCGGQTVRLRNLQARADLNGEVGLALRYDSESGRWMIRLRNGEG
FT                   KSVKPDNLEAMDGEGGRVFAFWGDARWSRAQLLGEIARGHWGLCRAGVGDITTSTAERW
FT                   ESLETSGRMAFAPVTEMTEDFMKNAHREMQVFRPSAAAAEGEDEGVQRDHSED"
FT   CDS_pept        18257..19363
FT                   /codon_start=1
FT                   /gene_family="HOG000243720" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636012"
FT                   /orf_name="MICPUN_79463"
FT                   /product="GHMP kinase"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61587.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG316421"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AA4E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N4"
FT                   /transl_table=1
FT                   /translation="MTVGHICPDATDDITHRAYARVGLLGNPSDGYFGKCISVSVQNFF
FT                   AEVTLTPNQQMFSSRVTIEPGPSDSTVFESLETLAVTTAKSGYYGGVRLLRALCFKFQE
FT                   YCAERGYDLAERGFTLEYESNIPTQAGLSGSSAIIVAGLKCLMQHYSVYIPLEEQPALV
FT                   LSCEHDLGINAGLQDRVIQCYEGVVYMDFSNEEMVRTQGKGVYTRLPETCLPPLHIVYD
FT                   DNPSDSGKVHADVKQRWERGDADVRSKMSRIAELAERGYKVLSSIGTDKQTGEPMIELG
FT                   MLMNANFNLRKEMFGAEALGARNVEMIDTARGTGSFAKFTGSGGAAVVLCPTNSEEERE
FT                   AMYADCEAKGFKVCPLVVNPGKPSGGAA"
FT   CDS_pept        19556..20161
FT                   /codon_start=1
FT                   /gene_family="HOG000157370" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636013"
FT                   /orf_name="MICPUN_79748"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="ACO61588.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG627112"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199AA4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N5"
FT                   /transl_table=1
FT                   /translation="MFQISRLEDANVKILPENLGKPRLEAITQEIESLYIDKVIKDLGL
FT                   VITLYEIVSIEGGTVYPGEGSAHFKVEFRVVVFRPFVGEIIEGTLKKADKTGLYVDIGF
FT                   FSDIFVPEHLMQEPSVFDEDEQLWVWMYEDAKMFMDLEEPVRIRIQGIKFPDQPRTSDE
FT                   LVGRTALEGATPDGTFAPMVVMADINADGLGLISWWKQ"
FT   CDS_pept        complement(20306..21181)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636014"
FT                   /orf_name="MICPUN_56580"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62033.1"
FT                   /db_xref="UniParc:UPI000199AA50"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N6"
FT                   /transl_table=1
FT                   /translation="MAHVSTMMSRISITAPLHASPHRPAGAGSRRAAVTVRAGKGKGAK
FT                   YRRGADDPYAKEKNKDKMEKQTKAKQSAEDGPLNSVFSKEEPKEEYFLFVRKLRVDGSG
FT                   AAAPAADSDAEKKSVDEGEYSSANIGAMLGMKGPNTDGSGSKISSLGNWLPLGDVSIEA
FT                   GGDLDVVVAERRRMLVKFAKVKHLKLLPVCADEKLEFGVRVQRGPPRGTDPTAVFPVAT
FT                   DAEHEELVWDHETMGEEGSVRAELRLMQSLPSLGKGKKNEMLSSAMDMIKRQQEQAAAM
FT                   KAEREKVDDA"
FT   CDS_pept        21162..23291
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636015"
FT                   /orf_name="MICPUN_99225"
FT                   /product="Predicted protein"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="ACO61589.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG559982"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI000199AA51"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N7"
FT                   /transl_table=1
FT                   /translation="MVETCAMVGCFAENCDNYLTVDLEPEDFSGGSTSRSSRATEPRER
FT                   VRVDVSRDMKRLRVFDGSSFEGPSPRSAKFKRRIARYFPGSATAADERLDAEARGVKEV
FT                   REAPASIEVVEEPDEPPFAEAATNDEPDEKPNAAKTGDEVEPVPYSSLAALDEGMARIM
FT                   KSNRKRSRDAQTLLKRAVKTKEIKFFNRIIKDFGNDKQMGFAEEAFRRIGDAGLSPTVY
FT                   SYTNLLNACVRVGELDRARKVWDDMIAAGVDPNEVTYTVLVKGLAQDGLLAEAARTVRD
FT                   MTAQSRAGVEGVAPNVRTFSTLLRNCVRHADPGVADECIAAMRDADVKPDVASFEYLLK
FT                   ARCAAMDAKGAWAVVDDMDREYLEVPPQAHAALATVSSLTGDVEKARSACEAARQAVKD
FT                   NGAGTVEDDGAGELFGSRGGYGSDSDEPKAANEQVKGRKKDKRHSQQQQQQQQQEEASK
FT                   SVQQFLKLRNSDALRQVEEVEKFLALGDDFVKEVAAVVNRGPESESSPVLIVEGAANVK
FT                   KPLCFKEVFGNDLPVRLEVCSGHGDWVTERAQRDEGKANWLALEMRRNRIRMTWAKAVR
FT                   RRLDNVALLCGMAHEMMGAHVPSGSLTEVYVNYPDPPEWVGSSQCLVDQAFLRDAHRSL
FT                   KPGVGHLTLVTDDPNYAMRMCRELSKVLRLFKPTEHGGKPFKSGVPEGYGGSYFDEMWK
FT                   NGRQNDRYYIRYKRV"
FT   CDS_pept        complement(23336..24058)
FT                   /codon_start=1
FT                   /gene_family="HOG000100014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636016"
FT                   /orf_name="MICPUN_107846"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62034.1"
FT                   /db_xref="HOGENOM:HBG559987"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199AA52"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N8"
FT                   /transl_table=1
FT                   /translation="MATADRNLTFYTHSLCPYAHRVSLCLAEKAIPHKREHIDLSNKPR
FT                   WYLDLNRRGLVPAIQLDGEVKTESLELNYFLDDVFEGAARLTPDGRKEEMQTLIDSFDG
FT                   SFISAGLQFVGGGWGFRRGAPGPRQADRMAVECERIERIIEINGNGGPYLMGAEVTLAD
FT                   LALWPFAERYELAMREFQGVELREMGPSGSLSRWIDAMRSRPSVVGLRPDDNKLLASWR
FT                   RTMRLDYFDYETADVDNP"
FT   CDS_pept        24318..26423
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636017"
FT                   /orf_name="MICPUN_56583"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61590.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199AA53"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N9"
FT                   /transl_table=1
FT                   /translation="MRAAAKTLAHAFTSSRWVAKRSQRVHNIVRATSSTTAPSPLLRRN
FT                   PRERPADGPTYSFDLGSARVAQLRFLAFHGCGTRYTVLYRECDKVEEQPKGGVGRRGRN
FT                   RAAKEVSDDIGFDAGELESTGEGDGPGWRVRLANSQEITLNALKEITPRDMALAALFDD
FT                   DLGDARLYRRGEERWLASTAAPKWPEELLASLDERGVGVHGANAVTCVDGSYFLELMEL
FT                   SAFPTPVIFPHGAWRLPGVGPTVQGNFRNLASAAIGVDAIDALSAIVNNGAGPDAIGRL
FT                   TGELPGRGRIQLGVDGGRAGVGSAHAAVTENEVTVTFAEGSLGLGFAPLDWERQFGAQV
FT                   WDVDDDSAAAEAGVVPGMVFTHIRGESVDGWTFSEIDREFDGPRPLEVKFNTKVPGAER
FT                   LYAVEMIAEEVTEALLRRKDPEMETFDFEEPGAVFEESTAAVIWREEPSTIFFGDAGST
FT                   TVVHHDIIGQVELCHVLSGSKLLAAAPWGKSSEELLRKAGARGLLSDGKDDGEAEEGVV
FT                   LSAPVHRSLTSDEIALLKHDDLAVVLARPGDCVAFSSICAHFATNGANEPCAAVFHGIL
FT                   TPASTHVLASHPERLDPFSDEEIDEDGFDGHLTGRAVLEELIPAGKDVITDYSAVDKID
FT                   SAMAKESGEKGWRMNRKMRGKAGDAAVKRRFAEAVLNMDSARDVSKAPKMWTGTSRTVF
FT                   YVEPVIK"
FT   CDS_pept        complement(26475..27071)
FT                   /codon_start=1
FT                   /gene_family="HOG000125745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636018"
FT                   /orf_name="MICPUN_107847"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62035.1"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199AA54"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P0"
FT                   /transl_table=1
FT                   /translation="MKPNRRGSAVSVRAAGDPPSIYGSPGSRTQIVEWLALELGQDIKS
FT                   VNLNRAIMSSPEYRDVHPFGKIPACKAADGTGIFESGAIMLYLADLAGSLPTPEARGEA
FT                   AAWVIWANATMWPALEASRGKCNLENLFGPVDAILADKAWLLGSELSVADVAVASYIKY
FT                   GQLFFRMDIKAFPNVVRYMEQVEQREAFQSTVMGG"
FT   CDS_pept        join(27285..28396,28457..28661)
FT                   /codon_start=1
FT                   /gene_family="HOG000280651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636019"
FT                   /gene_name="CNX1E"
FT                   /orf_name="MICPUN_79735"
FT                   /product="Molybdenum cofactor biosynthesis protein CNX1E "
FT                   /biological_process="Mo-molybdopterin cofactor biosynthetic
FT                   process"
FT                   /protein_id="ACO61591.1"
FT                   /db_xref="GO:0006777"
FT                   /db_xref="HOGENOM:HBG731522"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR020817"
FT                   /db_xref="UniParc:UPI000199AA55"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P1"
FT                   /transl_table=1
FT                   /translation="MISMNEAVDRVISRAHPLPQESVAFVDAVGRVVAEDFVAPRPHPP
FT                   FAASVMDGYAVRSADCPGVMTLIGASRAGAPMRGSGNTSIQPGQCAYITTGAPLPPGAD
FT                   AVVPSEECRVDGGTVSIDANVDAGKWVRPVGFDIKAGETLVPAGSLVGAHEVGIVAAAG
FT                   GGEICVHRKPKLALLSTGDELAEAGEVEPDASSGRIYDANRPMLAALAKTSGVDDVLDL
FT                   GRAVDDPGALASLVARAHAEGCDVLVTSGGVSEGDRDYLKEVLLGEHGGGIEGEVHFGR
FT                   VMMKPGKPLTFAEVQSKTDCGGNKMLVFALPGNPVSAAVTFHLVVVPTLRRMMGWRDPR
FT                   LRRVHVVVSSDLKLDPERPEYHRATLDWQEHTRHLPAAHSTGKQVSSRLTSMRGAEVLM
FT                   ELPRGPGMVAKGTVVSALVIGNLSSASVQLPAISPEVVR"
FT   CDS_pept        complement(28735..31185)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636020"
FT                   /orf_name="MICPUN_56586"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62036.1"
FT                   /db_xref="UniParc:UPI000199AAB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P2"
FT                   /transl_table=1
FT                   /translation="MKGQQNGAGDGSVGNQPPAGYLQRLWAWLRRPQARGKTNHHIRRS
FT                   RRLSHFATLKTMPELADVPSKCISSPAYRSGSAWEMEYAGKDMMTLLGDAMKSSCSPSD
FT                   LRNAALVCKEWRSMLGYAPAVASILRGGDAFAIAKMLAAKDIESVVQHHISDFVRVLAR
FT                   TAETEEDDTFLATSVADLGNIWMFAFKLSWNSHAEQMIEAWLKVFVTRVREMHLMCSDG
FT                   DPINAAITCIGPVDRNDADVDARLVLHMDLRQTVRRIGEALVPRLGDIIDRASRRLNNI
FT                   MQSLNNLWLHRFHDFIGSPSHVDPSESFATREAVEVDIDNLVAYSLVIRAVFLEFPREA
FT                   SVHLRSLLPLLSIEFDEVQGYLLFEFGVQNAFIGIREKYLSPGGRYATYVKTMQENFSV
FT                   VINITDALLAMQKVVKNGWEPDGLHDALLQALLGSSGDKKLELVRAFPTVAARNLSWLY
FT                   EAITLPDDYVHDEEAGRDADVWDHIEAGVNLVCCLLDTEVQFDGNLIMDRLVRLVPFDR
FT                   GPELLWAINELVRRELTDLRPDAHVIADVLDRPNYMKTRDQAITAFGLLGDEAEPHLDR
FT                   FMEQMKEVLVQETGDRFVQTLYEHRYRLKQNHLRDIILCLNESDWIPEIVTALETVRVL
FT                   CKTEEDATQIMYTMFYEMLDLTSEIDDDGQSYFPCNGGNYLFEAIQYVALRVDEPTRRE
FT                   ILQYLRANSKGPSSQNPYRWLSMLHIRAMIEKDVSPALALDHMLEMYDNNDGDRRRRDD
FT                   IVDYKVEQLEIFNEGRRKLRSEYCDRLAELRLQAEDAFDFLSSSDEEDADDDRDSTGSE
FT                   DIEF"
FT   CDS_pept        31431..32483
FT                   /codon_start=1
FT                   /gene_family="HOG000100015" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636021"
FT                   /orf_name="MICPUN_107848"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61592.1"
FT                   /db_xref="InterPro:IPR011498"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199AAB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P3"
FT                   /transl_table=1
FT                   /translation="MWIRPAILGAQPSGRGGCASATVGDMCLFIGGTDRSPRAFDEVWI
FT                   LKMAPESTDGVSSSDWRWIRKSTTVRGGGTLPARTGATATAVGRKVYVFGGQEPSRGTC
FT                   FNDVVVLDCDSWEWSRLEISGPSPPPRNSHVACVVNGGRLLVVYGGSSPEVGPMSDVYL
FT                   LDLEEGAERWIRPKVTGQAPEPREMHAACVLPNTPGDGDWNGDREIIVVGGRGGASVLS
FT                   DAVVLDAQRLEWVRRGDVGVAVCAHTAVPWRLGRSGAALLFGGFGGAALRGNDTVTVDG
FT                   TTLKTIVKGVSSEDVAFAPEPRFAHSSCLVPGGGMLVFAGVTPEADLGDVAVWVPDERA
FT                   SGVVPACDLD"
FT   CDS_pept        complement(32563..33558)
FT                   /codon_start=1
FT                   /gene_family="HOG000207661" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636022"
FT                   /orf_name="MICPUN_107849"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62037.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG326130"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI000199AAB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P4"
FT                   /transl_table=1
FT                   /translation="MGFGQLVIGPPGSGKTTYCNGIQHFFQLTGRPCAVINLDPANHDP
FT                   PYECAVSVEELITLEEAQREFNLGPNGAMVYCIEYVSKNLDWLKERVTPLVAEGKYVLF
FT                   DLPGQVELFNMHDALREVVAAITGPEWNLRLCTVHLIDSHLCADPAKYIAALMLSLSSM
FT                   LHLETPHVNVLSKVDLMDKYGELDFNLEYYADVMNLEYLADRILDGNQDAIGTAPSPGQ
FT                   TMMRKKYGKLTKGLCELVEDFGLVNFTTLSIEDKASVERVVQLTDKSIGYFNAGGFSAA
FT                   AGPGMENAVGGTDYDERALVSNMTVGSNYERHHEVQERFFTDRDERVVPP"
FT   CDS_pept        join(33700..33732,33805..35230,35262..35266)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636023"
FT                   /orf_name="MICPUN_56589"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61593.1"
FT                   /db_xref="UniParc:UPI000199AAB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P5"
FT                   /transl_table=1
FT                   /translation="MTELAVDRSLLVPTRGESSTQDENFGGYRLARDLLIEDRTEAHVL
FT                   ETPAMDSSAAMGKTLGRIAHLAASRRNQLFDLGIQRPDPGHDDCFAFASEGGVFHAVDV
FT                   PRNIDEPIKVSPINSIPIVATEDPAEGPRMGPSIARAANSNTFALSTGGGDLSVTSEGG
FT                   AVRGCEPPTFGEDGGRRPFVIESVTHRPGSMALLVWAVSTGAGAAVELFRLTVEESPDS
FT                   KAWTPTGAAVKVAEGTSPPLWCKVATSSSVDEVFVVAMETVEGRSVKAKSGEPVQEWLP
FT                   QDDEEAEEWIGNPGSAMVPSDGRGMAAWKAFNAEGDSEDEDDDAPRNPFDADLEDGPLH
FT                   VLMVSAWSDEVKTTARMPRNKPCAIVHGGAHIGVSHGVHCLTVSVEADGSARHVSTNQA
FT                   LSYVAKGKPNRKFVLATPDGTCAAVVETKRSSFVYRTPAPAPNPPKSGLHQIFDLTEKV
FT                   GSKLRGLPAGGVARQNSAEAPVLGARLVC"
FT   CDS_pept        join(complement(36651..36682),complement(36455..36527),
FT                   complement(35367..36311))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636024"
FT                   /orf_name="MICPUN_56590"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62038.1"
FT                   /db_xref="UniParc:UPI000199AAB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P6"
FT                   /transl_table=1
FT                   /translation="MAKGKGADRRKSIFGSKTPAPQVPLEPVNVNSTRQAQLASEPRAT
FT                   RGMARTGKEVVVEDGFKYKRRKNKDTKAAGAGPGSNFAALGRRSTGGDEEILSEVERLR
FT                   SLDPATVFAPDDPAWTLHENIPEDLPESERLQMLIEEICELEMKRERERLVEELGPEAG
FT                   AEAAKSLEDALSEFQLKVEEMIVRGEIKFANDGDAGADLKDAKHEAMAAVLSQLEDEKA
FT                   QWDALEQEALAGASADDEASMEQMRKDVEEVNKAVEALIAAELAAENGEGGTAEELAKA
FT                   VEEAERKLAMQQEGLSALVEGVEALCTRAERAAEVFSKAIAENDFKGLPHVNSPQNLVK
FT                   NLVRGKTKK"
FT   CDS_pept        36845..38251
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636025"
FT                   /orf_name="MICPUN_56591"
FT                   /product="Predicted protein"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="ACO61594.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG560051"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI000199AAB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P7"
FT                   /transl_table=1
FT                   /translation="MADQAGQKKPYDYQERYRHVRQKPLSVYSVEVKGDERTRPGLFAR
FT                   VLDPVYRASTLDELRVRCVEANAVLNSYDIFDRVDIEMDAGPREHPDSAKVTVEVSEKK
FT                   KLNLKGGAYVSQQGEGSMEVSVGLNNALGYAEKLDVEFIKGHERSNSCTLAWNQPRVGN
FT                   VDVDVVTRAFQQVSCSKRLSSFDETARGISVTAVGGGPATVDYSLVWREIADPTRLASK
FT                   SIRQQLGHSLKSSVSYTYQVDERDRPVRPGAGYLARVRSELAGVGWDPQMTRFLKHEAE
FT                   VQAAHTPAEGVTFFASAKLGAMMPLGQNAKDPEKGTCIADRFFLGGVGSLRGFEPHGAG
FT                   PSDERRPPPTKAAASGENLITRDALGGDVLAQLFASYQLEPEWSKLRDIGVYGHFFVNA
FT                   GTLMPWITGERKRVSGRELADSFRASVGVGLVFPLPVGNIEVNYCHTLRSRPGDRVKNG
FT                   LQIGLATALA"
FT   CDS_pept        complement(38367..39365)
FT                   /codon_start=1
FT                   /gene_family="HOG000220953" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636026"
FT                   /orf_name="MICPUN_99233"
FT                   /product="Cytosolic malate dehydrogenase "
FT                   /function="L-malate dehydrogenase activity"
FT                   /function="binding"
FT                   /biological_process="glycolysis"
FT                   /biological_process="malate metabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62039.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0006108"
FT                   /db_xref="GO:0030060"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289884"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR011274"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="UniParc:UPI000199AAB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P8"
FT                   /transl_table=1
FT                   /translation="MVSPVTVMITGAAGQIGYALAPQVCRGAMLGPDTPIILHLLDIAP
FT                   AETALKGVAMELVDAAYPLVKKIVATVNLEEACKGVDVAVMVGGFPRGPGMERKDVMAK
FT                   NVAIYKGQASALQEHASPDVKVVVVANPANTNALILSNYAPKIPKENVTCLTRLDHNRA
FT                   LGQVSERTGVPVSDVKNCIIWGNHSSTQYPDVNHATAGGKSVRELVNDDEYLNGEFVTT
FT                   VQQRGAAIIAARKFSSALSAASSVCDHVRDWVHGTPEGTWTSMGVISPGGDAGYGVEAG
FT                   LMYSFPVTCAGGKWSIVQGLAIDDRSRSLMDATAAELKEEKTMAEELIAAM"
FT   CDS_pept        39478..40530
FT                   /codon_start=1
FT                   /gene_family="HOG000079206" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636027"
FT                   /orf_name="MICPUN_79568"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61595.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199AAB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P9"
FT                   /transl_table=1
FT                   /translation="MNGGNSELPTVSLASFIGECGGCVVGDEPTPEQRLTAGQIDAVFR
FT                   RHGFLYLTDFGVSEEDVRVVFNNMKRLFALNDEEKAKLSKFDPRTNTGFSKFATEALNT
FT                   LRPPDLKESFNIRSRKHYTNDYTGTPEGFGDVAESFWDKLEEASRRLFIACALAMKLPR
FT                   EDMRFFERTFRRFDFSTLRMLHFPPVEDFSPDKLTRDGDALRIGEHTDFGMVTLLFHDA
FT                   ESAGEGLQVKKADAGAGNDASGVAGTNTGWIDAISRGGATAIVNTGALIARWTNDEWRA
FT                   TAHRVVVPNDAAAGRDRYSLAFFLDPDKDEVIETHPRFSDAVDKYKPITSGGFVQMKIE
FT                   EMLKVQGKAT"
FT   CDS_pept        complement(40580..41458)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636028"
FT                   /orf_name="MICPUN_80078"
FT                   /product="Glycosyltransferase family 7 protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO62040.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="UniParc:UPI000199AAB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q0"
FT                   /transl_table=1
FT                   /translation="MLPQSINSLIGAAAANFATKGGSATLHHTVVPGDASVVWQREVLG
FT                   VCVPYRDRRDQLEVFASHLRTFLHGQGVPFRIYVGEQMAGGSFNRGWALNVAYKFAEPE
FT                   VDYVVFHDVDMLPLPGVDYRYSSMEGMDARHLSTEISQFGYKIPYNRYCSGVFMSRKEF
FT                   FRDINGFATTFWGWGGEDDEFCARWAKKKFGGWEAAEAAPGGLHNMFGRPEKGRGRFLS
FT                   MEAGHKSDRKNPHWKKNDQKLQSFLSSPETVNKADGLSTTGEPTQILKGKVETPLYTVY
FT                   RSSFPPNLRQP"
FT   CDS_pept        join(42389..42619,42746..43267,43736..44165,44497..44795)
FT                   /codon_start=1
FT                   /gene_family="HOG000219146" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636029"
FT                   /orf_name="MICPUN_97103"
FT                   /product="Amidohydrolase"
FT                   /function="allantoinase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="allantoin catabolic process "
FT                   /protein_id="ACO61596.1"
FT                   /db_xref="GO:0000256"
FT                   /db_xref="GO:0004038"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG724623"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="UniParc:UPI000199AABA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q1"
FT                   /transl_table=1
FT                   /translation="MDVLSMIMALFFMLLAVWSQSQLAALQQPKSEAAPALEILYSKRV
FT                   VTRGAVIAAAVHVSDGRVQSIVPMRNAPKGPKVTDYGRLAISPGLVDVHVHLNEPGREE
FT                   WEGFETGTKAAATGGVTTVVDMPLNSYPTICDAATFDGKIAASKGKLHVDVAFWGGLVP
FT                   QNAHNETVLDELIERGVVGLKTFMSPSGIGDFEQSFKPDLEAALKTLAKHQVPLMAHAE
FT                   LPSDVDLDPNADPRKYATYLATRPRKWEQDAIAQLVEIASTTEGAPIHIAHVSDADSLE
FT                   MIAEAGRQGKRITSETCTHYLTFAAEEIPDGSTLHKCAPPIREAENRERLWEGIKNGTL
FT                   TFVSSDHSPAPPEDKLVEEGDFLRAWGGISSLQFSLPATWTQALARGLTLADVAEIWSA
FT                   RPAAVVGLGAKGTISAGKDADFVVWDPEAEITVGEDWKVEHKHKLTPYHGMKMKGKIVA
FT                   TYLRGEKIYSSSDERGKYSHNHRAAGPYGRPLLRK"
FT   CDS_pept        complement(44858..45592)
FT                   /codon_start=1
FT                   /gene_family="HOG000219455" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636030"
FT                   /orf_name="MICPUN_79469"
FT                   /product="Cyclase"
FT                   /protein_id="ACO62041.1"
FT                   /db_xref="HOGENOM:HBG686791"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="UniParc:UPI000199AABB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q2"
FT                   /transl_table=1
FT                   /translation="MCSSPNDGHGGHIVDITATIRASLPTWLSETGLGEGHRTETWSML
FT                   NGDDANASELTFSAHTGTHVDAPRHFVPWKNQQGMETVDIGAMNGPALLIEAYDVPVLN
FT                   REALEALGIPNAVSRLIIRTDNTRRKLMHTTAFTPDYVAFDTEGAKWLVEHRPDIRAIG
FT                   IDYLSVAALDHLAEAHVALLDHGIVPIEGLVLDEDKIDVGWWWLHCAPLKVEGSDGAPA
FT                   RAWLTPVNDPAGAKKPPRKCGQ"
FT   CDS_pept        45722..47734
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636031"
FT                   /orf_name="MICPUN_56598"
FT                   /product="Fused protein"
FT                   /protein_id="ACO61597.1"
FT                   /db_xref="HOGENOM:HBG560093"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199AABC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q3"
FT                   /transl_table=1
FT                   /translation="MVLTVTSLLEVDGCPPIKLREERDNEDVPLRTGCRVWSCARLLAE
FT                   WLANRSGGGEDDGAGPIVVGRDVLELGAGTGAVGLTCAALGASSVTMTDRDEAALALMH
FT                   TNARINGHYDASSTCEVCVQGLDWGDPATYIQGASYDLVVAADVLYLPEHCAALPDAVA
FT                   AHLAPGGEVVVACGLRRAGLLEALVDSLRSVGLDDVCVDLGTLGLDPVDGADARNRAAA
FT                   AVTASEHAHDGAQISAAGGYALVTASVKADWKPPERLSARAVADAKREREEEERNEEER
FT                   NEAERNEADRPRIRGEGNRTPGAVASETAATREEDQLGGEPSEIDSDANSAMGDFLDDF
FT                   EDLGVDAGAPVTRAVPASDDDDEDEVDTLPPYRVHPSPAEVASGAPSASTIAAAADSLA
FT                   RNGFVVLEAEDGAGLVASDVLDSALAASDGYLDRLLAAAKAKGLRVDSDIFRFAELCSR
FT                   AQGGRRFDVTAERRRCGNGGSITLPPRPYPTSDDESAAAAATDAWDGLRRAVDPWVSSA
FT                   LLRSGLMVENDGKGATFGVTAVGCVTSLPSAPEQHFHADGRERGIVNVFVPLVDVPASM
FT                   GPTHFRRGSHAWDHDSPYLTREQRRAQEGAEDVVPELRRGSVLMYDYRVFHRGGANLTG
FT                   KRRPVAYVMYARDGTEDTWNFPDESVWDPDSTGAG"
FT   CDS_pept        complement(47829..48536)
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636032"
FT                   /orf_name="MICPUN_56599"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO62042.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199AABD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q4"
FT                   /transl_table=1
FT                   /translation="MADSRSNYSLTTFNSSGELVQIKHALAAVQSGATSLGIRAVNGVV
FT                   LATEKKLPSTLVDETTVEKIAQLTPEIGMTYSGMGPDFRVLTKKTRKETQVYYRTYHEL
FT                   VPCSQIVRETASVMQEFTQRGGVRPFGVSLLMAGFDSNGPQLYQVDPSGTYFAWKASAI
FT                   GKNMVNAKTFLEKRYSEDMELEDAIHTAILTLKEGFDGQISAENIEIGIVAEDRKFRVL
FT                   TSAEVADYLSEVE"
FT   CDS_pept        complement(48814..49737)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636033"
FT                   /orf_name="MICPUN_56600"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62043.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AABE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q5"
FT                   /transl_table=1
FT                   /translation="MEGAPIDEAPASGQEPVGAPHEENPPHNDDNPVTKLFKDMGTKVK
FT                   NVVAAVERMEEEVIDDKTVNDKVKAIQHTRNVKTLRQMWIDLILSKEFTTIIDQVFDKC
FT                   CKLNDDDGDGHEGDGKLDRTELGAAMTMLWERLDQKTGGGKKLPRIKESEETVLRRYDA
FT                   DSDGHLDRDEFHGFARTYFSRVEWSSWRVACHGATKGFGFYVAQRMLLQPAIGMVKTAV
FT                   GPIVKAKIQKALESGAASVLRGSLRKVKYAVKRPLAKTNNAEGKAILEEELMEMRAKAR
FT                   AKLVALVKSVAICCVGGSVGAVAGWL"
FT   CDS_pept        49931..51466
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636034"
FT                   /orf_name="MICPUN_56601"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61598.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AB25"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q6"
FT                   /transl_table=1
FT                   /translation="MTTTSLAAGAVAVPRAMRVGARVSRRRSIARRRTLTTPRAGFLDD
FT                   MGVGDLGTSSPSSSAPVELANSIGSAVGRTYTELFPDLPSEVLGVSVPDTARALADAAR
FT                   PATDAAFQTLPDDAKSGLSDWWQREVDSGFTLVTGNAEYELALALLVFLWATGRPGVFG
FT                   GAFDAYFANAFDAVLLNKKFDKDSIKIRGKLGDGSFGSVSYAEDTDTGRELVVKQAKSV
FT                   QGAAQLQNAEEYMNRRVRRAPLVASGCAKYLGSYEVVEGASSPTLVWAFEGDVTLEELI
FT                   VRRDFPECVEELLYGGAQGGDDYAKRTSKVAKSVLRNLLSTLAGLHDIGIVHRDVKPAN
FT                   LVFMGRKFKLVDFGAAADLRTGKNYEPEQGLLDPFYSPPENFIMPERIPAPPPLRPLTA
FT                   SLSPLVWGTFLPDLFDSFSAGLVFLQMCVPQLRGRKVMDPNGSFRRLLEENNYDLRKWR
FT                   KVVEPQGWDFSALDANLGLGWDLACRLVCKRNFLQRGRLGCNTALLHPFFWTP"
FT   CDS_pept        complement(51506..52540)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636035"
FT                   /orf_name="MICPUN_107850"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62044.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000199AB26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q7"
FT                   /transl_table=1
FT                   /translation="MAYISVVLNDWKYSCPIVWSFYSTALAAGRENGKLRREVEQNLRL
FT                   KYSKELPPPNTSSEPPSEKSMKSGIKSGMKGVAKGMTDVAKVTSGGLTYLLFGGKDDMS
FT                   NEMREELEVELDKIRRSRRARTRWFLALTLMNNPSLIAMRRPWGGQPQNVAMLKPSHLP
FT                   HAVKKGWLRRRGGILGVVNDDYVMLTPGVLYIFEHDLARNPKVYTLSSRVLVRRLFVSV
FT                   RDQTSGGWHFGGDRYEPGPDEVDPPDAEDGLRLPSKKIDDKEKGNKKKDDKDKGGDGDP
FT                   AKSAESSKWKLREKHFFVISIPGGPMEVFASADLDDVTDWVGALRASCLGAPDRSMLAG
FT                   LKQD"
FT   CDS_pept        56429..57250
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636036"
FT                   /orf_name="MICPUN_107851"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61599.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q8"
FT                   /transl_table=1
FT                   /translation="MRGSFADLVAVPSSQLATKPPSLTHAEAAALVLPGLTVVQALRQH
FT                   GFGPGTRVLVLGASGGVGHLAVQVASARGAQLVVGVCSGRNVEFVKSMGADDVLDYEAL
FT                   EPPDDDEAGVAPDPLVEALREVLRKHGGRPFDLVLDTVSSHDARDRAHAYKSRIRSNPA
FT                   LLDDSPNAADKHNYVTIGGRTGGWITAGVKRVTGVNLFKRGKELFWINFNQCAPDLRTL
FT                   RALAEGEGSNGGVRAVKPAIERTVPLTDEGVREAFRALHGRRVRGKLAIEL"
FT   CDS_pept        58152..58379
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636037"
FT                   /orf_name="MICPUN_79671"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61600.1"
FT                   /db_xref="UniParc:UPI000199AB28"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q9"
FT                   /transl_table=1
FT                   /translation="MALARTWGDELTLRACSDAFQCVIHVVQSTAENWYLVYEPQTEEG
FT                   DGRESRRRKRLFLTYVSPVHYNSFTREGDN"
FT   CDS_pept        join(complement(60082..60114),complement(59732..59846),
FT                   complement(59417..59508),complement(58729..59286))
FT                   /codon_start=1
FT                   /gene_family="HOG000264788" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636038"
FT                   /orf_name="MICPUN_107852"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62045.1"
FT                   /db_xref="HOGENOM:HBG560144"
FT                   /db_xref="UniParc:UPI000199AB29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R0"
FT                   /transl_table=1
FT                   /translation="MDKASLRLSGRVAAHGNGRIGNEKFTLTASTGFANGGTVTLRATP
FT                   GFSPKYDENEKKLNFQGDAISNVGDIGKLSEIDVQFSKSGVELAGQACDVTVARDHAEG
FT                   DNAAPSGVRIKSNVDKVGDVTITAIQAGHKTLNDEDARAEKNAIRIAADIPLSDVNADL
FT                   TGSVDYDLVSKNANVRIGYHKDDITVKLRTLIKEDGDKRTAASTINLDYSGLEGIGVGV
FT                   EVKDDKTGHLQITKDDFKLKVPIEENKVKTNDASITYNWAIDM"
FT   CDS_pept        complement(<60993..>62148)
FT                   /codon_start=1
FT                   /gene_family="HOG000116697" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636039"
FT                   /orf_name="MICPUN_68791"
FT                   /product="Predicted protein"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /protein_id="ACO62046.1"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG481888"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="UniParc:UPI000199AB2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R1"
FT                   /transl_table=1
FT                   /translation="TDPDGPLAGLTFAVKDNLDVAGHRTGCGQPTWLDTHPEPARQHAP
FT                   PVASLLAAGAACVGKTQMDELAWALQGENHHYGTPINPAAPERVPGGSSSGSAVAVAAG
FT                   YADVALGTDTAGSVRVPASYCGLCGFRPTHGRVDATRGCVPLAPSFDVVGWFARDATTM
FT                   LRCGSVLLPPWGAWDTAFDLRFDGAIARDAFELCDEETRATLREAVARACGPGPLGEAG
FT                   GGTVEVDVGGGGSTPPLTEWWNVFRVIQANEVWRAHGAWVSEHQPRFGPGVKERFEGAG
FT                   GVTDAEAAEASKTRDAIAASMESTMVDEATGKDRFLFLPTSPGPPLASGADAQTVESFR
FT                   NRQLRLTAAAGLARLPQATVPVPRRSGPPLGLSVVGPRGTDEALL"
FT   CDS_pept        join(62719..62808,62902..63022,63113..63387)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636040"
FT                   /orf_name="MICPUN_56608"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="antibiotic biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61601.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0017000"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniParc:UPI000199AB2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R2"
FT                   /transl_table=1
FT                   /translation="MSAFVQSAFTTGGSTFVRARPQTRRAPATRASGRVSLRVQAIAEG
FT                   RQSLFVAVTVKSGKMEEYEKLIKRHITNCYMNDRCMYFDFGVNQDGSDPNVVYLYEVYE
FT                   DEAALQEHRDSSHLKEYLSAAAELTDSHDVRTLNLAPYGSVNCNYAGQCEIGEGMWD"
FT   CDS_pept        join(complement(64692..64727),complement(63593..64510))
FT                   /codon_start=1
FT                   /gene_family="HOG000231322" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636041"
FT                   /orf_name="MICPUN_56609"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62047.1"
FT                   /db_xref="HOGENOM:HBG525604"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI000199AB2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R3"
FT                   /transl_table=1
FT                   /translation="MRPILLKGHERCYNKEGDLLFTCAKDHHPTLWYSDDGERVGTYIG
FT                   HNGAVWTCDVTEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMV
FT                   ISSDPFMGVPAALHIVDVAANREEQTNEIKISMSGPEGRINRALWGPLNRTILTGGEDG
FT                   VIRLWDVETGKIVHEANDHKKQIQHLSLSVDKTHFISASLDKTAKLFDSETLECLKTYA
FT                   ADRPVNAAILSPILDHIILGGGQDAMAVTTTHSKAGKFDSKIFYKIYEEEIGGIRGHFG
FT                   PINALAWHPDGRSFTSGGEDGYVRIHHFDNDYFRIK"
FT   CDS_pept        join(65064..65129,65419..65544,65700..78299)
FT                   /codon_start=1
FT                   /gene_family="HOG000237308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636042"
FT                   /gene_name="DHC1.3"
FT                   /orf_name="MICPUN_56610"
FT                   /product="Dynein heavy chain"
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /cellular_component="dynein complex"
FT                   /protein_id="ACO61602.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="GO:0030286"
FT                   /db_xref="HOGENOM:HBG723668"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniParc:UPI000199D57D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R4"
FT                   /transl_table=1
FT                   /translation="MAPNGEDMPPAGLGHTGRTQAEDGVGRASLTRDALANQLYLKTKP
FT                   PSATAFRPSQTMGRTSALKSTGRLEPLTAARPPAVSAPAMMGTAGRNNAMGATYETTVR
FT                   SSTPARVGGAVTLAPLTPTGDSSRANGSLGTTDAVPTGSLRVSPSKPLLRPESEDDGYQ
FT                   YLALLRWMRRNAADEERRVANALPPGPHGADEFVYLARLDRDPNDWQPYALGVREYHGV
FT                   DRTDYYTMSAQGITHFLDGVQPEFITAERWELEVANYKKIKSLTVFRTYKKWKSWKLWR
FT                   KSVMSAKMQRAASVLEKNLFVLDPVFAPTIDKIRDACRELSKKRLSKVRTGEVRTLGAF
FT                   VDEVKEAREEMTEEFARFSAEQTATVSDACQRSLDAMEARLEEFYGDDLPCTDRMDRIS
FT                   GHGSAGPSSPAAGRGSATGRMSGPGSKRGGSEDAAQYAYTVAATRRTEQRRCLTFVKLM
FT                   DYVMCDTMHDMLLDSVTDVLSATKQCEEDQFEMPKPPYRLHKPRLKVQSAMKRMFRKIT
FT                   QENRRQSASKKVREAAKENQLMDTIKDRQMQARHEKEDDELNRFEPEFPVLPQFEVELA
FT                   WDERASQTVFEPSFHDFQSEVEKTVKSFIDILAKVKRLPDDKALMSKMTDALEMEQSSG
FT                   KGVDMADLAYTERWRELVRQVRRSLAFGFDTATRYKDNFDIFVNMKKKNAETSTSQIVE
FT                   NYKSGDLVIDNFRRDTITYLDQKKRMEAFYVDQNVGIVKIKSQRLQTALLPSPTAKLEE
FT                   LSKMLPGLAAEMFDKFIEEVHAGTNKLANPPKSAEDFMDVMRFCVDLRESTLERLGAQA
FT                   EEVKALYDLINEFGFPIKEEDQAKFALLEDDFAMLETVLDESEGQQEDRIKQFAAEMIE
FT                   AGKEVNQNLKDLAKAATDEMILDVEAPREQVLEFVEDLTTKVEAQQAEAKRIVKIQETF
FT                   KVEPTEFESLKAVAEDVALKRSMWVSDKEFDGLVVTWAESVFDQIDVASMEEKVQKMGK
FT                   LCVKLERGLQPNSVVPAFKAKVDAYKQLLPVISALGNDALLMRHWDKIQEIIGQPIVRD
FT                   ETFTLQKILDMKCPDHSDAISQVSVEATQERQLESQLEKIVKRWQDVSFAVTNYKESKD
FT                   TFILGGLEEVFTALEDSMVTMTTILSSRFVAGIRTEVEKVEKNMNVFSDTLDEWLAVQK
FT                   NWMYLESIFSAPDIQRQLPNESKQFYGVDKMYRDVMRKTRENDNAMRAATTPGYLEKFQ
FT                   KANETLDFIQKNLEEYLETKRMGFPRFYFLSNDELLEILAETKNVQAVQPHMSKCFDGI
FT                   KSLDFGEDPKSVDIFAMFSAEGERVQLGKNLKARGNVEQWLTAVEAAMVAALKKQGKES
FT                   YVSYAKEARTDWVRNQPAQIVIMVAQIYWCRGVIECLESENPVAAMEKYLEKNRSDLKD
FT                   MTAVVREDLTRLHRKIIAALITIDVHARDIVEELWQEKVESVNDFKWQMQLRYYWDDKD
FT                   DICLIRQTNTLFNYAYEYLGAQSRLVVTPMTDRCYMTLTGAMHLRLGGAPAGPAGTGKT
FT                   ESTKDLGKALGVQCVVFNCGDNLDYKFMGKFFAGLSQCGAWACFDEFNRIDIEVLSVVA
FT                   QQLLTIQNAMKAGLDIFTFEGREMPLKHTFAVFITMNPGYAGRTELPDNLKALFRPMAM
FT                   MIPDYALVAEVMLFSEGFETSKDLSRKMTKLYKLSSEQLSQQDHYDFGMRALKSLLVMA
FT                   GALKRGSPDLDEQVVLIRAMRDANLPKFLSADCELFENLIMDLFPGKVVPESSSGDLER
FT                   AIVESINEVDLQPKETFVTKVVQLYETFNVRFGVMLVGPTGGAKTTNYQILKSAMTKLR
FT                   NEGHPNDSFQVIHTYVFNPKCIKMGELYGEYNLGTGEWTDGLGSTLIRNAVADQTMEKK
FT                   WVVFDGPVDAIWIENMNTVLDDNCTLCLPNGERIKLNPITMRMLFEVQDLAVASPATVS
FT                   RCGMVYMPPNELGWLPYVTTWANTQLPEAMTDDTKAYILSLFNKTIDGGLSFMRKNLKE
FT                   AIPTVDINLVTSLTALFKSLVQPEKGVDFADDKLSLHPKLAKVFVFSYVWSLGGNLQEQ
FT                   FHAQFDEWARAHFADNIKELEKVPPADEGAVLYDFYVVTDDIDFPKGRFEHWDKAVKPF
FT                   KYSKDVPFFQLLVPNLDTTRFSFLLETCLDVDKSLLLTGGTGVGKSVIITDYLARSQEP
FT                   RGLVNIILNFSAQTPAKDTQLLIESKLEKKRKTRFGAPPNKKIVLFVDDVNMPARETYG
FT                   AQPPVELLRQYQDFRGFYDREKLFWKDVEDTTLVCACAPPGGGRQEVTPRFFRHFNMLN
FT                   VPPPNDATMKIILGSIFSGFLDSSFGPENDKKFPKEFQEIVTPVVDSSVEVYRRMSEEL
FT                   LPTPQKSHYTFNLRDLSKVLQGMLLITPDKCKALDVMTRLWVHESMRVFHDRLISVEDK
FT                   DYYKVMASELVEKNFAVVLEGKYEDPPVPEGEAPPEPEVDEDGNPVEYKLGTRAYKDLF
FT                   EDRNIIFGDFLDQNCEPEERVYEEGDDIPKMIKIMEDYLEEYNFSATNQMNLVFFMDAA
FT                   EHATRIARILRQPRGNAMLVGVGGSGKQSLTRFGSFMAGFKCFSIELTRGYGITEFRDD
FT                   LKNLYVQTGIEGTPTVFLFTDTQIVTEGFVEDINNILNSGEVPGLFAQDEKERMMTEIR
FT                   PYAESLGLNPTKDVLFSTFINRVRDNLHIILCMSPVGEAFRSRCRQFPSLINCCTIDWF
FT                   MEWPEEALTSVSNKFLSTVDLGSPEVNKHVANMCVDVHMSVTQTSERFFQELRRKFYTT
FT                   PKSYLDLINLYTALLAEKREELGNAKDRLLNGLNKLAETNVIIDNLKIELGELQPVLEE
FT                   KSAATAELIEQVNRDKADAAEVEKKVIEEEAQAKALAAETEAIAASAKADLEEAMPALD
FT                   AAVESLNALNKNDIVEIKNLPRPPPLVGVTMEAVLTLLKEKTDWASARKVLGDTGFMKR
FT                   LFEFDKDNISPKTLKRLEKFVNREDFTPEIVQSQSQAAKSLCMWCRAMHVYAGVEKVVR
FT                   PKRKALAEAEASLAATLAALKEKQQFLKDVQDKVAQLEKDLAKAEAESQSLKDQAQLTE
FT                   DRLVRAEKLTSGLADEAVRWKSTAESLGDQRELLVGDVFVSAACISYFGAFNGAYRDEL
FT                   VDLWTSRCRELGVPVSENCSLKNTLASPVEIREWNIWGLPTDDVSVDNGILVTRGRRWP
FT                   LMIDPQAQANTWVKNMEQKNALKIIKLTDGNYLRTMENSIRNGTPVLVEDIGETLDPAL
FT                   EPILQKAVFVQNGRTLIRLGDTDVDYDPNFKFYLTTKMPNPHYLPEVCIKVTIINFTVT
FT                   IKGLEDQLLGDVVRKERPDLEEAKDRLVLSISNDKKQLKDLEDKILRLLKESEGNILDD
FT                   VDLIKTLETSKTTSTMINGRVKEAEQTEASINETREKYRPAAIRGSILYFVVADLALIG
FT                   PMYQYSLNFFMKLFNQCIDNSEPSERLRKRLKNLMSYTTYFVYVSVCRGLFEEHKLLFS
FT                   LLVCTSIMRVMTVQEKFDEANVGDAEESDEEDEDEEAKPEVAAPVESPAVIEAREWNVF
FT                   LRGTPLNYEAPAKTVEWLTDAVWRNVCYLETDLPDYLTGFTADMAAKSAEFEAWAESDS
FT                   PFQEPMPGGWDDKLTYFIKLAVVKVFKEDKAVASAQQYIGAELGKAFTEAPPWTLDDVF
FT                   PDTNSRVPIIFILSTGADPTAMLQRFATKMGWVPGERLHFCSLGQGQGPIAEEMVSKAQ
FT                   DNGDWVCLQNCHVASSWMLSLEAMVNNMSQDYNPVHDDFRLWLTSMPAAIFPVLVLQNG
FT                   IKLTNEPPKGVRANMKRTFNDIQEDVWEGCSKPQPYKKLVFALSTFHAIIQERRKFGPL
FT                   GWNIRYEFNASDIECSMLTLKMFLEEQDEIPWAALVYVTGQINYGGRVTDDLDRRCLMS
FT                   ILKKYYLPDILDDNYRFTPSGTYYAPPEGDLFSFRDYLEQLPLTEAPEVFGMHPNANIT
FT                   FQLQETRKMMDTILSIQPRATSAEGGKSPDEIVAALAAEIESNIAPPLDLDDACPGLFD
FT                   RTASGQLKSLSVVLGQEIERFNKLTRRVLSSLKELQKAIKGIVVMTGELEQMYTDFLNN
FT                   KVPGLWEKVAYPSLKPLGGWIVDYHRRIDFMRTWLTKGNPKSYWLSGFFFPQGFMTGVL
FT                   QEHARKYQQPIDALNFNFEVLEGKETAEDITEAPEDGVLIDGLYVDNARWNREMKYLDE
FT                   SDPGVMISNLPVVHFVPVMGYYPPPLLAPADPKEYQCPLYKTSVRAGILSTTGQSTNFV
FT                   ICVGLPIRPGTDSDFWVLQGVALLCATND"
FT   CDS_pept        complement(78458..79255)
FT                   /codon_start=1
FT                   /gene_family="HOG000100016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636043"
FT                   /orf_name="MICPUN_56611"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62048.1"
FT                   /db_xref="HOGENOM:HBG560174"
FT                   /db_xref="UniParc:UPI000199AB2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R5"
FT                   /transl_table=1
FT                   /translation="MMDNKVHISDGTTGRMPSAKSNKNHLFGHAIAEDLVRRYFSRSLD
FT                   KKDKVGLAAFGMHVLCHPPERRVLKLCYLCELMAVIAGLVMFFSSYLLRFDATSTFGIM
FT                   GAFFANVSLMCNLCGIINCLFMGFKISTGKGSVYEALDVLQGVGQTVNLIVFGVNGAGM
FT                   AYMFYSLDLTTDDYLRWANLGIFIPAFCYSYGFVIWYVLSYEPLSWWHQWSWNYELFKP
FT                   MYIIAWLRMGRVPMRERAAAQLEYLLADLPDDVMAILKADGNV"
FT   CDS_pept        79459..79935
FT                   /codon_start=1
FT                   /gene_family="HOG000029296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636044"
FT                   /orf_name="MICPUN_107856"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61603.1"
FT                   /db_xref="HOGENOM:HBG638995"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniParc:UPI000199AB2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R6"
FT                   /transl_table=1
FT                   /translation="MNRRDEPGASTSSSSTLVALVDGDCALCSGYARLVSALDGKGAVY
FT                   FETQQSDAGRALLKRCGMPTDLSSIVVVEVSPKGKAVGYVRSTAVLRTFLALGAPWSAL
FT                   YLTVAIPEFIRDGVYGLVAKHRYSVFGTNGGRCALPDAVTRRRIGRVLPAGLLD"
FT   CDS_pept        complement(80012..80356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636045"
FT                   /orf_name="MICPUN_56613"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62049.1"
FT                   /db_xref="UniParc:UPI000199AB2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R7"
FT                   /transl_table=1
FT                   /translation="MSATPPMSHPTRPGLDDLPDPPAAPRKKKPTRSRVFPAPADDDDA
FT                   ATTPAASRRRLVFGDGGEFDSPEGGGGAGAAGGAGGTRTPASPPMTRGRASGGKEPKTP
FT                   PVSKIKSMPR"
FT   CDS_pept        join(81190..81219,81391..81435,81611..82810)
FT                   /codon_start=1
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636046"
FT                   /orf_name="MICPUN_97107"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="adenylosuccinate synthase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61604.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004019"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="HOGENOM:HBG658237"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="UniParc:UPI000199AB30"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R8"
FT                   /transl_table=1
FT                   /translation="MSAVALSSAAWGDEGKGKLVDILAQEYDIVARCQGGANAGHTIYD
FT                   DEGKKYALHLVPSGILNEKAKCVVGNGVVVHLPGMFNEIDTLEKAGVKIDASRLVISDR
FT                   AHMLFDLHKEIDGLREAELSGNKIGTTKRGIGPAYASKATRNGIRVGDIRNPETFAQKL
FT                   RTLAADAAARFEDFEYDVEAELVAYQKYAERITPFIADTVHMINEEHKAGKRVLVEGAN
FT                   ATMLDLDFGTYPFVTSSNPSLGGVCSGLGLAPNKFETVIGVAKAYTTRVGAGPYPTELF
FT                   GELADDLREKGYEYGTTTGRPRRIGWLDVVALNYASAINGFTHLNLTKLDVLSGLPELK
FT                   IATAYKLGDGTVTNAFPSSIEELEKVECVYETLPGWEEDISKMRDWDELPAKCKAYVEK
FT                   IEELTGVECRYLGVGPGRDAIVVKP"
FT   CDS_pept        83178..83663
FT                   /codon_start=1
FT                   /gene_family="HOG000216641" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636047"
FT                   /orf_name="MICPUN_56615"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61605.1"
FT                   /db_xref="HOGENOM:HBG735283"
FT                   /db_xref="UniParc:UPI000199AB31"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R9"
FT                   /transl_table=1
FT                   /translation="MGRCPTGGGKKTSKQKNRGYACKSVKRTKFQLPHADVIYKAVHQH
FT                   LKEQAEGGGAKRPGKAREISSYEAMIKGDPNQPFNEDLPGGGQFYCMFTGRHFESAEAL
FT                   ARHQKTKQFKRDKKRVLNGPKPHEQRDAEAAAGMGAPDNGRPLNRAPKQAPAAMAVE"
FT   CDS_pept        complement(83764..84849)
FT                   /codon_start=1
FT                   /gene_family="HOG000172217" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636048"
FT                   /orf_name="MICPUN_99249"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="ACO62050.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG714097"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S0"
FT                   /transl_table=1
FT                   /translation="MAADPTAAGPGGLSEEQAAVYDRQLRVWGVEAQRRLGASRILVAG
FT                   LTGLAAEACKNVALAGVGALVLYDDGAPAVDAAPGNFLAASGLADAAGTADADALTVAN
FT                   ATAATLREMNPFGEISILPGPSDLSGIDAAAVKGCDAVLVTGCSLAVAERINDACRDAG
FT                   ASFFYGECRATVANFFADLGPNFRYAVERGRSNTAEKDGDAANNAGADAAVVSSFVPLR
FT                   EAVTCKWCTLGDGREGGVRRVNRLAPAWLLSKRFERSLKRPPSAQDVPTMLAEVPALEK
FT                   EHGVKPGWLGDARWAVEDVVAGASGVGDGGESPAVAAVVGGILAQEVLRSVTGKGEPVR
FT                   NSFFFGVRNGQGTVENMGCPT"
FT   CDS_pept        complement(85104..87209)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636049"
FT                   /orf_name="MICPUN_56617"
FT                   /product="Set domain protein"
FT                   /protein_id="ACO62051.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI000199AB33"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S1"
FT                   /transl_table=1
FT                   /translation="MGSSGEDGSKLELGKIVEVSGKGLGIVATRDAVAGEVVAREQGPM
FT                   AISLSRDQLGVRCCRCAGRAARPSATQICDEGCGAMWCSPECAVADTHLHADSGECSFL
FT                   LDIGPDPRVAMCQPCGPGDRRTGRRRRVESDWVTLADDVRLLLRARRVGILEGGAEERL
FT                   ASLDANAPAPDDDDESSLLAAASEGSDATLRRIASIAVDAHKRRDGGGGGGIIPEDAEA
FT                   NDANEARDDDHAELDSWLRAALIVFANSFDVEAWGARRGSEFPRPARVAGAVYRTLSRF
FT                   NHSCAPNCTWSFVHESESKPGGGAVSVNVRAIKPVKSGDELTISYVDPTVGRAERREQL
FT                   WAKYRFECACHLCVGPRDVNRQLPGTDPYLEAVFGTIDEKDARATVEETDGMIRDVRAA
FT                   IRSIRTDEDVKKLDLAVDALRGKLRCRTRPFEVDRGEMAKLIEGEEARPRWTHSRRPDH
FT                   VSKAEHERLQGDGFHPFHFTSMEAYGILGVASSIKAKWLMFREPGDKAGIAKLMKIALG
FT                   YSMLRASALDELARKEAGFGDAASRAWMEVSERAMSCGVLERVDDPVRGPYRHLDQTYL
FT                   MSNAFRKVIECDDGGEDGILHSAVMCLPTAPGSMGGPAWHGTSFNGVDVALEPPSGTFE
FT                   IASDVAMNLADYHSPGLWKHIVGAFNAHQEEVGAATVPVSEDNIEKEEAKPARMAVGEE
FT                   CADDAKG"
FT   CDS_pept        join(complement(89388..89518),complement(87378..89289))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636050"
FT                   /orf_name="MICPUN_99251"
FT                   /product="Oligopeptide transporter family "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO62052.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniParc:UPI000199AB34"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S2"
FT                   /transl_table=1
FT                   /translation="MTPTYEAVDPLSPRAVIAGMLVGFVVSAMNVSFGLKAGWGQGGSV
FT                   LAAAVSIGLFSAMKPKIPFTQLEANVCQTVASAAGSMTMAAGLIGPIPALHLLGMRYSV
FT                   WTMMTWGASVAFLGVFFAVPLRRHFLLESQLRFPSGTATAETIKSMFADARRAKSQVGT
FT                   LIHASVFAAGTVVLTWCFPWVLRPPLFATLGLASAARWGWGIRIDATLVGGGILMGTRV
FT                   GVSVLVGGVCAWGMVGPWAAARGWVTGDPLSMKGGARGLLLWPGVTMMAVDSLMQLALA
FT                   TVCRPRRRRKVAMGGDSSNKSGQEATKRRTKWTYDDVDADGSSEAPLLGGGGGDDDDEP
FT                   GLLKSPDVLPKSKPTLVGWAGIEDGNVHDESIVPAGDASPPADFKEDHPDAIPRSWWIV
FT                   GLAVTGVWTASVLHLNFGMALWQPVLALPVAAVMSYVAVRCTGETDINPIGPMGKIIQL
FT                   VFALVAPGAIVTNLMAAAVACGGAGQAGDLMHDFRAGLMMRLSPRKQLLAQLMGIPIGI
FT                   LGAVPTYALFAATYPIGGEQFPAPAAVAWRAVAEVLTGPEGGGLPAEAKALMLMAAAFT
FT                   AWVRTVERMAETRAETNPNSRAARWIKRLMISPTSAGIAFIIPPEFSTTIAVAAIGSGY
FT                   WERRNREHHEDHAYIAASGLLAGAGVMGVVTALVSMAFGTTAPET"
FT   CDS_pept        89706..91805
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636051"
FT                   /orf_name="MICPUN_52109"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO61606.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199ABA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S3"
FT                   /transl_table=1
FT                   /translation="MGPKKGGTKKAAQTAKTAKAAGKKPPGRPRKVKEPVQEEEPAEDA
FT                   PADDDQADDEKGSGRSEPADDATPMDDADPVEAKATDDDAPAAKEDPPAADGEADDKTK
FT                   AGGDEPHPTIGTVPDETVRSCLRIVVPSDKAGYVIGPRGKIVAHARKESGCGFHLQETS
FT                   KTHAARVAVVTCADKRSEPGSFQGVRGVEMVYLRSTEEMIPKDADLNDPPMGARPEQTQ
FT                   TQRVHIIVAASQMEKADVSELATGAGADCEKVVALEKGSKDCEALHAALGSIVFPTDRF
FT                   VEIVGTDAAVRAALTVLMMRLDYRANPPIASEDPLLLIDAPDVKEGYFREKKEKDRLQR
FT                   ARDSHGAGRDGRGRHHPYGGGGRGGGGGGNYDRGPPPRGSGGGGGGDEIRMTFGIDAQF
FT                   AGGVIGKMGSNVGQIRRESGARITVHESHGKFRVVAIEGTDRQCHDAKHLVQQAVTKQG
FT                   GGPVGAHRIEPSTGRGGRDGRGRDTAVHRDPVVRGGAAGGGSYYDQYDRRGRGDRGYDR
FT                   GGYDRGGYDRGGYDRGGYDRGGYDRGGGYGRDAYYDAQGPGSAYADRSSYPDRGGYGGG
FT                   GRDAPHYDERDTHRQWLGGDRDGGYNNYQGVQQSHQQQQGWAGQNQQWGGSNQQQSYNN
FT                   QQPSYHGQQQSYDQGGGYNNNQQGGGNDYYNRGQQQSGYGNQGGQYDQQGDYYSRGQQW
FT                   GGSRY"
FT   CDS_pept        complement(91903..96459)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636052"
FT                   /orf_name="MICPUN_56620"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62053.1"
FT                   /db_xref="UniParc:UPI000199ABA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S4"
FT                   /transl_table=1
FT                   /translation="MPPPRGRGASPFGDPFTFGKPLVLNSQPPTFFGSSLAPPADASAS
FT                   DAPMGGGAVTRSRSARRKVGGYGVTAPAKHGPKDTFTRTTGTDAPSPITGDDRDRPARR
FT                   VAPRVVTKIPVLDDWEPAEDENEDPSVIPPHVDDVPASAAATKAARGRNPARTAETARG
FT                   PAPRRPPPVSSRTTRTTTTKRPASANLREEDERGRNDAAAVVIAARARAKARLAPPRVA
FT                   FGGRPPKKPSPVKRQRHDPDQPPPPDDQQTAADVDVVPRPKPGFSFGVRPNRGGPSLWG
FT                   PGKDSPGPAAYHEGPAPECDQVRGHVPAVTFGAPPDRTRRSGAGWNAGAFPELDPDAPG
FT                   PGEYAGGDDTARVLDKIAGKSRAPAFTFGGGKDDIGKVAAKDFAGAPGPGAYHIDEILA
FT                   VAAERRRIEKGFSFGERVGAAWHEAGPGRDAPAPGTYADGTEVRRSGGGFSFGNAPKTP
FT                   SFIPSSKDGPTPGPGDYLDRKKEKENGGGENDGGDGRTRKSAEGGFTFGWRRPDPAKSA
FT                   TEPGPGAYHRDAQLDDPEALRPGPAFSLGTKLERGGALDGKKDAAKMPGPGDYEVRKSA
FT                   EAGPSYTIFGRPNDGVVVGVDLNEKASLPGPGRYHTPLSPGGRAYTLGSRIEEKDAKRD
FT                   TPAPGEYGAPMPVGAQWGDRNRGFSVLGRDAWAGKGWGEEHAEVPGVGRYDVRGSNSKP
FT                   LPSAPAFTMAGKTKDPTHAPPPTRDIGPGEYDGDGGNRPPSGPSFTIGVRGSKDGAYGD
FT                   LESAAEKPGPGAYPNAPKAKDETRESAPSFTLGRKIDVPDERTKVGPTGFSERPGPGEY
FT                   HADGDVVPPEGPGGFTIYERTKSTEFRPGVDSPGPAYYGGFTTDDVEGGLRMSIHERYE
FT                   SGSVFQHTDRSDTPGPGEYAPEVFQFPVRDDGESTSFVGAPPGYTIGVRRESNYPVRRS
FT                   QIGAPGPGEYHPTEGDGVTDPAWSKGVTIGERRDERARRSLDSRPGPGHYHRTRESIER
FT                   ETGRKAPVPGPKIRDRKPWEREKVLEKKADVPGPSDYDTEPSMKKMDKRAPAHRIGERR
FT                   NDAADRRGSGEGAPGPGEYAGDVVRAPDWRRGATIIADRRERSRASAERRPGPGEYHRD
FT                   APRVAKTGVNIGRGAGKDAPGGVFDAAGRGGPGPGEFEPPPGAIRPGRSTGVNIARGTG
FT                   KDAPGGVFERAGRDVPGPGEHWPDGDAASGRGGRSGGKSVRAPGVKIPATGHDAPGGAA
FT                   VWPEDAPGPGEYHEERTKPVRSAVNIGKASGKDAPGGVFDAALKRGGGPGPGEFESGPG
FT                   ALRQKSTAVNMGKGTGREAPGGAMDRRDGPGPGEFWPDEDPAAPTRGHTQRGIPFGKPP
FT                   KPPRPGAKKSSAPGPGEYAGSVVGAPDARVGPTIPRGKRRGLVSKDARDTPAPGDFEPD
FT                   HHPKTVAGLVREALKRPGSMREPTVPRGGKKAGSERTPGPGEYYSGRGEIRVDRGVKMP
FT                   TREAWERDRDRVKGSGLGPKYHPNHEKVSKPLSVKQPMARADDYADSFRSTRGGSRR"
FT   CDS_pept        97294..97956
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636053"
FT                   /orf_name="MICPUN_99254"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61607.1"
FT                   /db_xref="HOGENOM:HBG560240"
FT                   /db_xref="UniParc:UPI000199ABAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S5"
FT                   /transl_table=1
FT                   /translation="MAEDPYKVLGVKEGTPGDELAKVINRKKLLYKTEPEKLKQMEDAY
FT                   EQIVQASLAARLRGDMSGVSESARKNDLAPSLFGPWAPIPSEAPLKDKKVNIAISVAAV
FT                   LFVWFTPGTIRTIQPIIYATIFHAFRMFMKLVDVDPGPSANIDRDAATKHNNKRFFRAF
FT                   ALVMGTFAVSLGITYWIPNMIFETFRLQVPVWYLLNQEVFVSVIVGGCLAYLTCFYR"
FT   CDS_pept        98198..99427
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636054"
FT                   /orf_name="MICPUN_56622"
FT                   /product="Predicted protein"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="ACO61608.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI000199ABAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S6"
FT                   /transl_table=1
FT                   /translation="MFSSLASSSVLSLATAPNVGGGRRLRPARGFARDTPFPIRGATLL
FT                   VPSDVSRLVLARASDVREGDYASEDSYDGDDDGAWEGMSSSRNRSATVIRTAGRDDMYL
FT                   EVDLPAHNMGITFTCGPDATIAMVEKVRQDSAAEQAGIEIGDILFSCSAVELTGSDTPV
FT                   VVGDSEGTDTHWRRIDNFRCLGQPFDVQMAAFNSTAIVDAGFKHRIVRAIFRRDVNPDG
FT                   RSRASRLDEMLGDEKAATDDPTEKDAETSVAKLVSESWKDIVSAVTIEGFGELLFKSLF
FT                   RHDWDLVRLFPFRDCESWEEVRAHPKFQSHAVNVAGAIDKAVSLLGNSSELVPVLRGLG
FT                   ERHHGYGVEEEHYDLLGSALLEALEEGTALSGVSPGGRGWTRELGDAWTETWATVAATM
FT                   KGDLYGTSPR"
FT   CDS_pept        complement(99580..102867)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636055"
FT                   /orf_name="MICPUN_56623"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62054.1"
FT                   /db_xref="UniParc:UPI000199ABAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S7"
FT                   /transl_table=1
FT                   /translation="MPSRFPHGGEDAPLLAGDSRGRGGNAKKSDSGADRLLSRGVTALA
FT                   ALLLIGLCVMLGVHLMGSYHSADSDLSNKDRSWIETLDDGTKILHGADGKLSIVSGDAG
FT                   KKSSKHHKKKKGTDDILDLLHNENAKGSIEGEIDPNKDIASQQNDILLNKEKEMMDQLT
FT                   AMAKGKGGPDAKGSSKKPSVNPAEAAEKMLAGGNAPTTSTFDPRAALRHHEEALEHLST
FT                   KDKKANENLKLTDQEKSELEQLEELTRKPPPGPPAYVTPEEQLLHKAAMKAKKHDEKGA
FT                   EDWYNQLDDSVDVFEVRNQALIELEEASHKKDDKKGAEGVESTKASAKHAAKASAKAKA
FT                   TKPSAEPIASTELEPVASTEPEPVASTEPEPVADKEGEVAKTGEDELEADVELADTEPE
FT                   PEPEPEPVEPFGAHDSEAKNDDEDGPDPAEPIEPFGAHDSKVEAEPEADDDDEPVEPVE
FT                   PFGHDDEKDAEPVEEKPDAVEEEAEAAEKEEEPEPVAAKAEDPEPAANAEKEEEPEPVA
FT                   AKEEEPEPAAAAEKEEEPEPAAAADPTSAAPASDAGDKHPTPEQIKWWKDHHPNGAALG
FT                   HRTRNRRPVSRRPRHEAEAALGVAPSNPKASSVPASRWSGVDLAQHLSCSDSLADPATG
FT                   KTFDVATEFYMSDETTLGPNGEAIKLGPRARAVRDTTFVSAFLRVDGPGAPDPTRYLTG
FT                   VRHAACNAGRARLNSVFFADSPEMCAHVRRLYDNGRALSNELAPPVPRLGSGKFRCQVK
FT                   AVKNLPLKPATGLRPEAVIGGCANSANAFVWYNKVNFMVDAAEMCESDPDAEKTSQFAW
FT                   FDGDVAGPGALKALLAHPLDPAALVAGAKDEKVHFTCHPRAVREAQAVEPCRAGETMVM
FT                   PRVFSGTPQALRGFKRRWDAYMHRYVPLSTHTAAELGQWRMARGFFADYKNPPNAARGA
FT                   GLKPVEAAIAVNTRSGGWTCPCPSEEYVMNRLLNDEMFPEEKQFSGGKIAMLVTQEEKA
FT                   REEEKAQLTAKGGDAVAGMGGPRRPAAQAGVGTASSFSLRRGLGLLEDGLNAAALGAEA
FT                   IESDVPGKQFIDASPDGTDGSCARSEDGTPSGFAELPSMGLISWRFN"
FT   CDS_pept        103342..105057
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636056"
FT                   /orf_name="MICPUN_56624"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61609.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000199ABAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S8"
FT                   /transl_table=1
FT                   /translation="MACAVLHPPSPVAEMFGRRPAEPSAGLPFSQATLDRLATAAADLR
FT                   RFLARVHFAHETVPGMMPGALYHPTEVFDLAKARYEHVWMPLLASENSASPRKLAAPLD
FT                   VQWMHHLHRLDPDAYRVDCERAFGRLVDPADPFLVAGDGAPSDDQAAESFARDAWNAIA
FT                   PEWPFDLEAALVDHRRRGGRLPPRGSSSAISFDSSSCDMIGSATRQGGFLWQVLPSETY
FT                   GDEDFIHRAARRYAMLVILWRDFPGEFLVPTYDQDLVWHAHLSVPSVYEKEMRTATYRN
FT                   AIGHDDSVNDRTPGAKLEVRGRRTMELWRTHYPVSTWDEPYARRGAMWRGDAPDWYWTC
FT                   QFPRPIPPSRAPGPVTEGSTFNQRIPAVELAPNVFYAPPSRIYDYTSRGNEKSGWICTF
FT                   EELVPPPFERAVDPGVQYVKVKVRYAGTTELVEGAWLRFQVPIGIFPPEFIADVDDASF
FT                   ITTCSFPVPHCEKYLHATFVTPVDIRHVIAQYQNRGCCVFCCGGGQQKNDYGLGPARQP
FT                   TTSSYGGGCGAACGSGGGGVGGACGGSYGGGGCGGGGCGGGGGGCGGGGGCGGG"
FT   CDS_pept        join(complement(106298..106626),c
FT                   omplement(<105911..106190))
FT                   /codon_start=1
FT                   /gene_family="HOG000200792" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636057"
FT                   /orf_name="MICPUN_80268"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62055.1"
FT                   /db_xref="HOGENOM:HBG609841"
FT                   /db_xref="InterPro:IPR013170"
FT                   /db_xref="UniParc:UPI000199ABAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S9"
FT                   /transl_table=1
FT                   /translation="MSYNGIGLQTTRGSGTNGYVQTNKFHRSASRLQRTEWRDLKDIHG
FT                   AGPKSNKPNEEILAHQRKREIEVKLAQLEDDLEEKGVDAEEIAERLKEARVKFEREAER
FT                   KSGPGPADDTHAIARRKAEKMESLRRAFGITREHAEEREGEAFDQDLQAKIRDQKRADR
FT                   EEEMRQREERRVKEQRRREKERKRAEKERKEAEKVRKKEE"
FT   CDS_pept        complement(107042..107296)
FT                   /codon_start=1
FT                   /gene_family="HOG000238827" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636058"
FT                   /orf_name="MICPUN_56626"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62056.1"
FT                   /db_xref="HOGENOM:HBG560273"
FT                   /db_xref="UniParc:UPI000199ABAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T0"
FT                   /transl_table=1
FT                   /translation="MSQFLRQLGALKVKEVPKFLQDKVTVANVTSHTQKFIAEYKTKYI
FT                   DAGSPMPIYHVMCGVFVTAYITVWPTEYRHMMAAKHGHH"
FT   CDS_pept        complement(107502..108644)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636059"
FT                   /orf_name="MICPUN_107857"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62057.1"
FT                   /db_xref="UniParc:UPI000199ABB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T1"
FT                   /transl_table=1
FT                   /translation="MISATIATCRAAPATSVPRSRAAARAVPSAMRPAPTAISRSRVAA
FT                   RSAPAFREARRVRGAALLARASKGDRVSIGDMKKALVAAGVDTSSCFERADLEAKYALL
FT                   TDDQKAMKGGGSSGASAGSGSGASSSSTQQQEQQRASSSSSSSSSSSSSSSTSSSSSSS
FT                   SSSSETKKDSGSGFDPSKVFQSVLNTIRETANRVDVKWGVGAKLREQTKGFRDAIVNLD
FT                   EKLGATAFVKRVAPPAWAEVQKFRATPLGRIANSVFFIWLFFSGFFWTLVTLGITGVFL
FT                   TNLLFPNFFAERAQKMQAEAQARFREQQAAGMGGMGGNPYGGMGGMGGMGGMGGNPYGG
FT                   MGGMGGMGGGGGTGGGSSSAGRKSYGSGDVFDVDADVKDA"
FT   CDS_pept        108818..109318
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636060"
FT                   /orf_name="MICPUN_56628"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61610.1"
FT                   /db_xref="UniParc:UPI000199ABB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T2"
FT                   /transl_table=1
FT                   /translation="MSRAFIVASTSSGLVAPGRAPRTRHSGPNPVALKPIGRSPAYAPS
FT                   LKKKEDDVGGSRNKPGIARLFGGGNSDMKAKVAQLEYELENERAHASELGGKLRAVEGE
FT                   LAKVKDSLDLYKGRCKEQEKEIFKLEKKNEETQRGFDTGMAVAKKQIKYLEELLEEEKR
FT                   KNQ"
FT   CDS_pept        complement(109375..109887)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636061"
FT                   /orf_name="MICPUN_56629"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62058.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ABB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T3"
FT                   /transl_table=1
FT                   /translation="MEKTTIWRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAHV
FT                   GPCEHGVKYRSYCKVCSACSHGRRRSTCKECGGASICEHGRVRSQCKECGGSEICEHGR
FT                   RRSLCKECGGGSICEHGRQRSQCKECGGGSICEHGRRRSTCKECGGGSICEHGRRRFRC
FT                   KECGKEC"
FT   CDS_pept        109990..110217
FT                   /codon_start=1
FT                   /gene_family="HOG000199698" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636062"
FT                   /orf_name="MICPUN_79527"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /protein_id="ACO61611.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="HOGENOM:HBG560304"
FT                   /db_xref="InterPro:IPR009400"
FT                   /db_xref="UniParc:UPI000199ABB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T4"
FT                   /transl_table=1
FT                   /translation="MVSAVHGSLIETDIPCKVYILHINEQLPPAERFVIQDLDETHLLV
FT                   QPHRLEYVKAEVKAWQQKNQFTPPTDLRQT"
FT   CDS_pept        110227..110973
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636063"
FT                   /orf_name="MICPUN_79527"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61612.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniParc:UPI000199ABB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T5"
FT                   /transl_table=1
FT                   /translation="MGVATVTPVIAAPRPTHRPGGRKSRVVRANALEIADVVRVASDGG
FT                   VVLAGYVASDLVAQASETRSAERSAEECRVDVDCEIPPTPQGLDVIRLNRYAAFGWFDG
FT                   CISHVFIGWLDAASSGWTSNEAARCFDQVVVDMALFSPVWCALFLISMEAMMMDTRLPL
FT                   RAAVSARLKGEYSELLLGNLGFWIPANAVVFGLVAVDYRVAAFSAINFAYTVLLSIWAE
FT                   GDKDKPQEAADKEKVETKEIETVDQI"
FT   CDS_pept        join(complement(111131..112881),complement(111081..111096))
FT                   /codon_start=1
FT                   /gene_family="HOG000012638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636064"
FT                   /orf_name="MICPUN_56631"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62059.1"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniParc:UPI000199AC26"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T6"
FT                   /transl_table=1
FT                   /translation="MVAEDAPPAVETEESPAPAEGAPAADDPPPSPPVEAEETPAPNPD
FT                   DDAPAPSGDSRVDGGVVARGPRTESHHDAGAGAEDLVDCTFVVLPERFEHSATIPATEP
FT                   FASVKSMLASALPIPLDAVMTLRQPDGGEPLPDDACLADYGVGAADEVDLELVVAYRTE
FT                   REMRAEAEENARREAEDFARLEEQAAAAAAAEAAQLAEESRLANTDAPSSLPETLRVTV
FT                   RGARRGEPSRVVTVRIDASGCVKPRYLGGFRDRRDGTVYHHASNQTIPTKPRVWKTKFT
FT                   TETQTAQGRSRLAQTTAQASTQMARKDLVMDESRDVEVWTGKYMTYDEVMVIKARHTLT
FT                   LQKYFRGMRARRLANELRAIRDDAVRRAEEEEAARAAAEERRRRFEIERRIRPKTSEDF
FT                   ELLYDELEQWRVRETAKVEAEFPPETDARRLAMSQLLAKETELIRTIGRLRIAANNANR
FT                   ERRVERALEDMSQTKRWERKDGSLVEVDTPFTVRARELARLYDALRLETRRDVSTDERL
FT                   DVLVHVKWTVKEFDCGLTREIVELADREADLLNRGRDPAAMTGLRRRIANLFLQFVETP
FT                   EFNPESARRTTD"
FT   CDS_pept        join(113184..113276,113369..113572,113683..113746,
FT                   113880..114520)
FT                   /codon_start=1
FT                   /gene_family="HOG000256146" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636065"
FT                   /orf_name="MICPUN_80273"
FT                   /product="Predicted protein"
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="ACO61613.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI000199AC27"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T7"
FT                   /transl_table=1
FT                   /translation="MAHTSGIGADVFDKGNWYHEVLEDGLAISYRVEEVLHKGQSKFQT
FT                   VEVVKTKPFGRLLITDGLMQSSEDDEYVYHQSLVHPALAGHPEPKKVFIAGGGEGATLR
FT                   EVLKHPSVEECKMVDIDGEVVDMCAKHTPFYNAGAYESPRAKLVIGDAKAGLEAEPDGS
FT                   IDVIICDLSDPLDGGPCYQLYTTSFYEMCKSKLAPGGILVTQSGCAAVRDCKAVFTPIN
FT                   KTLREVFPQVWGYTVCVPSFCSEWGFNIATKDADHVDLYTGITANGELDKRLAARGLGA
FT                   LSYYDGITHTRMFSLNRTVREACERETRVMTVENPLFMCSTDTHAGVFEPEK"
FT   CDS_pept        115061..117271
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636066"
FT                   /orf_name="MICPUN_56633"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61614.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI000199AC28"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T8"
FT                   /transl_table=1
FT                   /translation="MADDEPPGDAVHTKGLWNRRRDLRCVRRHLGIGPDGDPDVEVRCA
FT                   RGDRVIAVGYRRVLLGDHGPYLELEREHVRWENLRLMPGGAARFYDEYRAIVDGESYDD
FT                   IAHSSIGTGGGGRGAKLYDQLKTVEGQGNPPRDSAWAVANNRPHEEGYAAYVVGKIYVG
FT                   AYDVAVRDPVVDADDVRRALPKPGGSGRVAWWKPARGVGAIVPDGVVGARNEGAGGGEE
FT                   EFATKEVSVTRDALAGGADTLAPGEGVWFDLESSGPSDRSVAVNVTGPGGEPVRQLCPG
FT                   AAAAAAEAARNGQKRSETARALRDGRRSAAALAAARARTVPWEARAEVERDAVAGAARR
FT                   IARILRDNCAAIAGLARIEGEGQRTLRACLRGWARWARKGSKSGEGDGSFGAGGVGRPS
FT                   TAPTLASPRRRDPPPGESPPPPRLNLTSAGRAKGLFAPVTRPPTPVASNPKTPRGPDEA
FT                   GDDPPAASVALPAWLTAVARGAVVCEVSHTRSSSAGDAAADAAGRVSKRCGFEARMPGL
FT                   EDSVRPVVVELTRDGVGALRTGAEGAEGADSGDRDPVAEAVARVDENLPVAEFGSSPLV
FT                   LVLPAGEEKASGSTVHPPRVPRLALRASKRVVGVVCVSSGPEQLVRDAVALAGACALGT
FT                   APFVPTEVFAAAGLDAAREWSRDDPRVASCVAVFERAGWGAARGMETGAGRDYCWRCGD
FT                   RSHRKRDCERVAGARPGENRPATTGGGGGRDVEAARVAELRL"
FT   CDS_pept        join(complement(117465..118370),complement(117377..117391))
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636067"
FT                   /orf_name="MICPUN_56634"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62060.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AC29"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T9"
FT                   /transl_table=1
FT                   /translation="MSSSLLRPSLLAIASRHAMSSPTKAALGRKHASPARRSFDVTVSA
FT                   AASQNVDKKYVPGEPIANACVVVTGANRGIGLEFCKQILAKSPGNSVIASCRDPNAADD
FT                   LVALQKEVGESRLAVVALDVADETSIASWAQGLGALEPVQAHGGSIDVVINNAGTTGTD
FT                   GYSKWELEDMTADEMMHVYKINTVGPLLVTQQLVKRGLIGDPGSLNPVSLVGNVTSKVG
FT                   SVDDNGSGKGYAYRASKAALNIVNKSMSIDLADRGIWCQLLHPGWVRTRMTEGRGLIDA
FT                   DESARGLIRCVMFRETRLFPLGYGG"
FT   CDS_pept        118548..122960
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636068"
FT                   /orf_name="MICPUN_56635"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61615.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI000199AC2A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U0"
FT                   /transl_table=1
FT                   /translation="MEASEELDHAGTAPGATGAKETAAGGGDSPMNENVGPGAMGTSTA
FT                   QTEAAAPGSGGKSAGTPDLPQSEPRSLTADDDDDERSGAAGVTADARDDDAGAELPPSR
FT                   SPDDAPVAPTTTTPAGPSSGDPARSLADVLGKRPTPASDPKSSASAKPPAKKAARAKPS
FT                   TGPGITSFFGGGGKGGSGSDEDAPSRMPTRAEKLAADEAEEAAAIAAALAASEADEEDR
FT                   RAKAAAAAAATEAPTAVPVATEAPTAVPAEGAAAATASPVQDHEPDPTAAVVSASEAKK
FT                   THPLLVAAQRKKEKAAAEARAKAEAEARAKAEAEAKAKAEAEARAKAEAEARAKAEAEA
FT                   KAKAEAEAAAVAKAEADARAKAEEEERRRAAEDAALLADGSCEICGVDDDDGLLCDGCD
FT                   GVFHAKCVDLDSTPANEWFCARCAEHGVTNAGGGVAQRRAAKRKKANDEKRRANPFFMT
FT                   PDERRVAAEREAKQALMRDLEAVKQTDAALSTGKKVHHFFAMQKEKAAAAKESGASAAS
FT                   LNPLGLYVLPAPIERAMPPVHITPPIDPTVAEDEAVGRNALASVAGPPRKITRDGRFNP
FT                   SPDATLDSIRRALSPPAAVDTEEEQEEEDPGGEEGVDLEEAEDAYLTDAARYVLASEGR
FT                   WNAGAIVSGELASARGELRARLASLRARGAARAAGRDGSSSTDGSRLDRSTPSIGPAAA
FT                   AGALWTDAYAPAATDQLVCDGGAARGVRDWLDAWSSRIFAEEAGVVVKPPKDKEKAGNG
FT                   GRKGKRRKKGRGNAAASDDDTSDEECDEWDDESSGSLGTYAPLVTKRGGLPANGLLLCG
FT                   PVGSGKTSAVYAAAEEFGFKVLEVNPSRKRSGLEVLSQFGEATQSRRIGGGGDEQKKQG
FT                   AGGIGGFFGKKPAPAATTTSAPAKDTAKKDTAKETARNTLILFEEVDVLRGEDRGFMAA
FT                   LAQLIAGAKRPIVLTSNSPSLPSLIDAPLPAGTSGDGLRLARVRFRSPSPADAAVYASL
FT                   VAAAEGKRVSPGEVASAARLADAGDVRRALLSAQFAASSPAAEMTRRPTRGTTKSRSTA
FT                   AVAALEYDTNAVAAVAAELIARVDPRVAAAEALAPARALYAMSLVAEASQIEERETERR
FT                   AEEAAVRRRAEVVAAAAAAKAERAARNDARIEKGPLGSVGGRGGDRRGSLGLVAAGRSA
FT                   ANGDDEDGEEAERAAKVAAAADAARDAYLAEAAARFAERAPGGESPGGDSPETPPDAYP
FT                   GDDWARALRELDSLASLSASLSAADAMLNPARATVTGPSNGAAERVDVGGWLGGAGAAW
FT                   GDGGDGGWFDPSDDAEERGGADLAGEPRHTIGGGGDVAREASARIERLAVDACLGDRLV
FT                   DCRPPPRGGVGGGPPPAATGPASSVPKPAVSYGRVPAMGAAAARLRELAECTGATCARG
FT                   YGCGLGATGEANERAFFLARIVRIQEESASGVGAEGGRRRRKKASQYLQVGADVARELA
FT                   ALGTFGVTA"
FT   CDS_pept        complement(123029..123388)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636069"
FT                   /orf_name="MICPUN_56636"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62061.1"
FT                   /db_xref="UniParc:UPI000199AC2B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U1"
FT                   /transl_table=1
FT                   /translation="MSTTVTVIRKRPHCSATSVHEQEAIKLMPPPPPLLVPVMESEWER
FT                   KRRQSDIRRAENAFMEQQLRRERAEVERIACERTRIAMDNCERSELHAFLEELRVSGRV
FT                   SADEIVKRLACRVPA"
FT   CDS_pept        123994..125280
FT                   /codon_start=1
FT                   /gene_family="HOG000062589" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636070"
FT                   /orf_name="MICPUN_56637"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61616.1"
FT                   /db_xref="HOGENOM:HBG485380"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI000199AC2C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U2"
FT                   /transl_table=1
FT                   /translation="MVAIEEGLTRINSAPYEALLPRPDSPPLRKADPNKATVAKWSETA
FT                   DIFEYGAAANPDMAPIPVLVHPPSLHEEGETRIIPFDINDCLDIETACTSPNLMASFVR
FT                   VRVGESIETKANATSQAFYVIRGTGSTSSEHGTVSWGDGDLFVVPVTEGALKHTCVEAE
FT                   KGGAALYWIHDEPLMDYLGVKPNGKKFEPTFFSREKMLAQVQEISHQQTEGERNRLGVL
FT                   LGNKACDQTKTLTHVLWSLLNSIPAKTVQRPHRHNSVALDLAVAASPNVYTLMGKEIDA
FT                   NGDIIDPIRCDWTPGGVFITPPGWWHSHHNESDEVAWVLPMQDAGLYTHQRTLDIRFVD
FT                   DELELHKAGKIRGSAFAVTNKQYMHMVECGATVPHTRVAGMKRVWSLQEVEEEDPSSSG
FT                   DAAAPKKKTVKKVASYSRLPAMKASSVEP"
FT   CDS_pept        join(complement(127443..127501),complement(125420..127298))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636071"
FT                   /orf_name="MICPUN_56638"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62062.1"
FT                   /db_xref="UniParc:UPI000199AC2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U3"
FT                   /transl_table=1
FT                   /translation="MAAWEMTKEALRKVCRDNNGYAHAPELNDVLHLHCKGIAEITNLE
FT                   EYTGLKTLYLESNSVDDLEGLLHLDRLRCLYIAKNCLRDLDRAARLVALTTLDVSDNQI
FT                   VTLEGLRDHPSLSTLVAVNNKLREVSAIEALGSCVQLVTVDLSRNKLEDRAVVDFFLSP
FT                   AMSDRIRLLKLQGNPAVSEVPSYRKTLVSGMKRLNYLDDSPVFPKDKRLAAAWLRGGVE
FT                   EEKAERARIFEDERRERERHRAAFDDMVANARREAEEKERAGIRTKRDPYRFMSEEAAE
FT                   EARMLADGMTEWELEEMRANEQLPWQVRERERTLSEKTEADRAPNRAERPDEDDEDDEE
FT                   EGDGVAEVGPPEHVADDDGDERIPVAIPIDDDRPTPGIFVAQVDDDDDPAAPASAPPPP
FT                   PAPTSTTMTDEDREASEASAAEELRRELEKMRAARRGDRHEVVDGATRRRKELERAADS
FT                   ANRSGGRGSGSQRSPVVFGTRAYDQLWAQAKAMGDADGDNGEEVREDDEDSLDKESFKE
FT                   SFKDEDGVQNELDADGANSVNSESVDGTSNYSYGDKENRWERASMASVGATVASTEAGE
FT                   LDGIDEFDETEDETENTEDTEDTDEVNSTDGDDPLDRYTVSTVASGKETGKETGDDGRA
FT                   ANDDELWGLD"
FT   CDS_pept        join(127700..127770,127874..128172,128322..129784)
FT                   /codon_start=1
FT                   /gene_family="HOG000280683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636072"
FT                   /orf_name="MICPUN_56639"
FT                   /product="Anion exchanger family"
FT                   /function="inorganic anion exchanger activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61617.1"
FT                   /db_xref="GO:0005452"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniParc:UPI000199AC2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U4"
FT                   /transl_table=1
FT                   /translation="MAPLNETPEDGDGTRELLTDPLPEPLAWSGEFAGGLIADVKRRAP
FT                   HYVSDWTDAFLPANRGRCLSSVAFLFFACLAPAIAFGALFAEYTGNELGATEMILSSAI
FT                   SGVAYAFLSGQPLCVLGATGPELAYTVVFYNMCQKFNVEFLPARVWQGLWTALFTCMLS
FT                   AFDASALMNRVTRFTEEIFAALISVIFIIEALTSVVKLYTEHPGDDNDGTSRMASAFLG
FT                   TMLCFGTYGTAMALRSVKRGGKMFNRSVRDAMGDYGVTIAILAFTGVAIAFKRYGDTSV
FT                   PTLAIPSEFAPTWINPKTGEPRAWLVSPLGINEDFPPWAIFGTIVPALGLTFLGYMDQN
FT                   LTSILINRKDHALRKPPAYHLDLLVCGAVVYPVCAMLGLPFTHAATVRSMTHLVSLTEY
FT                   KAVPVDVTTGGKSIEESKGFVAARRARSLSMCGEPSVAAAKKTAKEGFEDASGDNSGSV
FT                   EMKTVAVGVCEQRVTQLLIHALIACSLAISPVLRVVPKSVLSGVFLYMGVTSTAGNQLF
FT                   DRLHLLLFVWCEENRPRGLPFMRPSRCGAEFLPVRRVHAFTCVQVALMGGLYAMTKVGA
FT                   VAVAFPFFIGALVFVREWALPSMFTSDELDALDA"
FT   CDS_pept        complement(129992..130489)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636073"
FT                   /orf_name="MICPUN_56640"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62063.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AC2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U5"
FT                   /transl_table=1
FT                   /translation="MKLLDALSGRVTRSARFREYVDQSFAEVDHNANGSLDRAELHLAV
FT                   MLFFDKLNAKVKKRAIPPTKAELMALFDEVDTDESGELSLEEFVAYMERLCAQCTSGLT
FT                   VSLLKSFIAVPFTAIALSVGIKKVAPGMHQKIKEAKGLGSATLSFCASQIVNKVPAFAA
FT                   VP"
FT   CDS_pept        complement(130670..132871)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636074"
FT                   /orf_name="MICPUN_56641"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62064.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AC30"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U6"
FT                   /transl_table=1
FT                   /translation="MAAPDAPDESTSRMGPYDVLEQIGKGAFGAAWIIQTRGNDSNPPR
FT                   RFVLKKIPLARLSERQRHLSLQERQLVAALRHPYIVPYHRSWIERSHTVCIVMRHCDGG
FT                   DLASAAWRARRRRERFPEQTLRRWLAQLLSALAYLHSERVIHRDVKCGNVFLASPPGFE
FT                   PGTSHAPTNSTNSWGDVMLGDFGLARVVDANAADDVQATSTVGTPHFMSPEMLRGAKYG
FT                   FAADVWSLGCVMYELTTLRQPFTAFNMEGLRRKILTSPPAAFIQPGKEGEEDASLYGDG
FT                   WRATIRSMLRKAPEERPSASELLRTSDMADAAADADARAREIEAAAAAERREEGRGEEG
FT                   GEDGRGDGAGDAAFLAAPDREPMPAPGGDWSPSADERSQPPGRSSVRRGWADLDPSYMR
FT                   FNPQRKPRPPPRPQSARPARASTGAPRNPDTETGQKQRAAATPATQKTAQKTAGRRPGW
FT                   NASPRVRPASGGPLGRPASAPRTPSSGDRAAARRASGVVVTGRAVTGRAVTGRAASGGG
FT                   ADGSDGFDPYAPVAAEPASALAPKHPADENEAPNNTDETPSKSRDEAPSWTRDEAPSRD
FT                   DVVARARRLLAETSPKLAAPSPIARHDGTDDDADDSRVLRAVAALHARGRHAELARVLS
FT                   NFYPPAEAIPPTPSAPDLEPGQCVMVGASSPTRGTIRYVGAVAFAEGEWVGVEMDDEGV
FT                   GAVTGRAVTGRDGRVGAIQYFACRPGRGVFVPAATLTRA"
FT   CDS_pept        complement(133147..134469)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636075"
FT                   /orf_name="MICPUN_56642"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62065.1"
FT                   /db_xref="UniParc:UPI000199AC9E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U7"
FT                   /transl_table=1
FT                   /translation="MRGSASRTVAWAALARSATIDPARIIASAARASAPAHRREDASRS
FT                   RGRWIERRRRHEHPRFSTVGEAFLVAAHAEVLRRAGAEVPANLAQLLAVVTAEGASPLP
FT                   PDARDGLHPLVLPIAKAWRGDRDDDRVVGLLLRPSPSSPRAPLAGPLPVVLAGPGGVRM
FT                   LAKDAASYVHAAIIREDASPASATTTPEPYPVAGAAGAAGRAMYTRGELAASSMPDRPE
FT                   VFILRNVGKFPDDMEAMALRHLRGVEKEGASPSQSAVTSALVTAEWYANDRAFEGWAGP
FT                   QAFNARMLFAMGRADEARDAARVALSTAACWDTVGTERGGAAEMAALAGLDARMGAREL
FT                   REMLETGGEAHKAAAAAMAGRIPENVGASGGPRGEGGMSEETSRGYATRAAAAALDAVA
FT                   LGSEADVARGAGESWENAREEVGSAYGEAGLAGLAAFVLRR"
FT   CDS_pept        134554..135915
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636076"
FT                   /orf_name="MICPUN_56643"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61618.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AC9F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U8"
FT                   /transl_table=1
FT                   /translation="MPSSSPSSSSSSGGTSAKRRRAKYERKFLRAAARGSLRGCKKALK
FT                   RASSRGSGVDAGFLDVTSASDPDGRTALHLACASGDDDLARWLIKRGADVTSTDARGDT
FT                   PAHLAAHRAPDNVAITRRLTRAGASTHARNDAGETPSSIAERAAESRAARMREFDARRE
FT                   ARTRRGRDADDYEGLGRGPSREAIEEMEWREKLRAEAALGDAIDEFGGGTAGIGTADEM
FT                   NAFYASYVDDWDDGSAYAWREEEEAYAEYMRAGMAARRRKRLDDDNDDDDPRRRRRDSA
FT                   AEAQARATRERDEAAQRVLDEERRKDAEWRERTARRATQQASSSVSSSVFTDFATYRRR
FT                   WGIAAAKADRGESIAYADVPWPFDPESRRGEPDERVVRDVLLGPTGAGAVEEGSGSDAA
FT                   RRALRSEMLRWHPDKFFASKVGSRVASEDVERTRLGVNAVAGVIASLFRRSAGS"
FT   CDS_pept        complement(136036..136548)
FT                   /codon_start=1
FT                   /gene_family="HOG000100018" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636077"
FT                   /orf_name="MICPUN_56644"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62066.1"
FT                   /db_xref="UniParc:UPI000199ACA0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U9"
FT                   /transl_table=1
FT                   /translation="MAPPRIPGGRGGGRGRGKGGYKGRMGKNFRKNPDGSDKPKGKARR
FT                   SGLGLWGIGLVTGAIAGLVALVAHGERAALERESEAVRRRLRRKPRGFSEHAVCRMDCR
FT                   FIGEDEATATLARGKLSKRHSTPGATPCPRWALEDGRVRAVWAECRDETKLVTVIDTVT
FT                   DHPCGPC"
FT   CDS_pept        136695..137873
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636078"
FT                   /orf_name="MICPUN_56645"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61619.1"
FT                   /db_xref="UniParc:UPI000199ACA1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V0"
FT                   /transl_table=1
FT                   /translation="MARGTLRTTPRRANRPVGDEEAATRKMGAMGTGGVSVNARLNLEA
FT                   VERTLAALSGGKENDALGLDTVLVKGLHDMAIDEAIARAGRKASARAGKGIVHNRKGPT
FT                   VSVPDAVKTPAAVRAIVAKALAGKVLSRREQDRLRDELERREGAVPGKPPASSPFTPPP
FT                   PPVNTPVGLARRYPAMTCGDTNESADADASPPFAMTPTLLAEAARLAMRNVGTGKGPSN
FT                   PLGRALAAGERGEPLTSTQRNILDAVEELRAGKIIPDDRMRLLEWAQTDDDDVAVAKGS
FT                   RPMTSPSTVASLCAATFGILPLTPPSDADEDAASSYASDEVFSFDQGKIAGENRVEETS
FT                   PEPWISPVEFNRGKSMTPTLEELARRKEGGEALTEGEDAMVSIFKLASPVAR"
FT   CDS_pept        join(138883..140250,140386..140703,141030..142961)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636079"
FT                   /orf_name="MICPUN_56647"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="protein folding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61620.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI000199ACA2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V1"
FT                   /transl_table=1
FT                   /translation="MNAALSGAALGARLPAIRASKTFGRREGSVSPIQTRISALETAHH
FT                   GRVTESTPPPPPHVEKTVRVGVARVPSDIYAANKVAPDIAAVSRLGAGEISDPRLLLRR
FT                   ALPFVLPDSHPLARVEDSLMEHAGEVKTRGMGSRSISNEALVENLEAQAAPGRGQRASL
FT                   AARRAVATIRSERDALVSFAVAAGNGAVADDIVAELDDVLQSIVDRSEATTTAETTERQ
FT                   SEKKLELDFERALLLVARLQACGADAPAFPVPPRDSPVPGAPPGVVIPRDAMPLNRRAW
FT                   VDLTVRKAKTGEKIVVRVAVDGFNAPYAAGRFMQLAETNGFKRIDRADGFIVAFGEDVG
FT                   TPRHPSASTPLPLEVKLADDGKSEPPLYGVSVDDAGARNARVELPFNAYGTLAMSHSAD
FT                   DVNDGATQFFFLTKESEVTPSGTNVLDGRWSVVGYAVDGAEGLADLNAGDVIESVRETK
FT                   RKKTVDGGLSVPDLALRISRGGFFQVPSIKSRCLGEEARRGTSHGRPERDAPCLSAGTT
FT                   ATGASRRRVARCRARGGWSPACFARISPATPPTSSSRRCAIRTLTATSDVLREPDWGVN
FT                   VDMCDLVNSNFHRYGKDTVKALRLKLQKKTKPQTQYLALVALEMCMKNCGVMFHAKVIE
FT                   KACLDETTKCGAQRGGDARVKQKALALVQEWALQLQLPQYRAAFDELRRKGERFPPTEL
FT                   TSAEVTPMYTPRPNRVDIVEQRLAQMDPADAAAVRAAVAEAEAEVEAEERRMGTRSPRV
FT                   SNGFATSPGGGSTPVGSPPGTRGFRVGSPPGSSARPAAPPRGYEALDEDEPFHGTAERN
FT                   GTAERTYSDGNPYGTAGGGHTSNPTPRSHHAHYPVSHRPELQPPAADASALGDVTSPDA
FT                   VKKLHEDLDVASNTVKVLRDMLGEVDVVTSPEALNDPTIDELSEQCAQMRPRVVSLVQS
FT                   VADESLLMKALSLNDELSEVAQKRDALRAAASADRDTRAAIVASMREEEAAAQRHASAG
FT                   DASGGAPVGNLVDLLGGVSVDPGTDARPGKDKAAPGRAAAAGRAAAADPFGLAAADAPV
FT                   DPFDVSVTVGDGGNVRGRPGASNPLDELLAPPPPPPQVYDPFAASAGVDPASTPPAGGS
FT                   HQPANYYPTVAGTARGGGAVSDPFASANPFASRPPGASPMGAMSVNPLFQAQQQPQQPA
FT                   SSGGMGSLPPAIGASQAPYDPFAASPPPQQRGGSNPFAR"
FT   CDS_pept        complement(143046..144416)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636080"
FT                   /orf_name="MICPUN_56648"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62067.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199ACA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V2"
FT                   /transl_table=1
FT                   /translation="MDFDITTARPAGPRPAAPVAAPQQPGGTQAGSAHHHPPGAGGAST
FT                   SPPVAPDDVPASIFITGVSPAVNDGTLREFLECCGPLRSLAQFGDVPLPGQPRQYVATY
FT                   ADVAAAQSSLVLNNMTLVDRPITVVAAERAVGPGGVLDLSKGGSSAVPSGADLLNPLAS
FT                   MEQAVMTGLVEDPLKLWRQAAEKLPSWFPAGYKRCALFVPIPHLINGAMAAAEARIEFE
FT                   KEVRDTAGGHVDDSDVSRTVYAGNVNSSITEDMLADFFSIAGNVTYVKFAGSEFNPSRF
FT                   GFVEFDTKAAAESAKALTGTQVAEMTIKVKHSNNPIVKDRMRNFWGTCRTERRRRMRRE
FT                   RKRFKEKERERLRGGESSSSESESESSSSSSEERRRRRRRRREREERDEKREKKSRDKD
FT                   ADEGGDEKERKSSREKKEDAREKKSDEEEDEKKLREEARRSRKSRRKSEGEGKEDAA"
FT   CDS_pept        144592..145497
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636081"
FT                   /orf_name="MICPUN_56649"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61621.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ACA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V3"
FT                   /transl_table=1
FT                   /translation="MTTGRRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAPPTK
FT                   GPCEHGLKYRSRCKVCSACPHGKWRKRCKECGGSQICEHSRQRSKCKECGGASICEHSR
FT                   QRSTCKKCGGSQICVHGRRRSTCKECGGSAICEHGRQRSTCKECGGSAICEHGRIRFSC
FT                   KECGGGSICEHGRRHSRCKDCGGASICVHGRVRYQCKECGGSAICEHGRIRFSCKECGG
FT                   SAICEHGRVRYQCKECGGSGICQHGRQRSTCKECGGSQVCEHGRRRSECKKCGGSSICE
FT                   HGRQLHRCKECGADEGTRRR"
FT   CDS_pept        join(complement(146230..146496),complement(145548..146066))
FT                   /codon_start=1
FT                   /gene_family="HOG000204051" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636082"
FT                   /orf_name="MICPUN_80139"
FT                   /product="Predicted protein"
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62068.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG523037"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniParc:UPI000199ACA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V4"
FT                   /transl_table=1
FT                   /translation="MPPRRTRSGDASSGSTTRFFQRHSNVYAYVPNIIGYVRVLLAAAA
FT                   LRLAFTDVPTSLALYALSFVCDELDGRFARMFDQCSEFGKLLDMVTDRLATTGLLMVLS
FT                   REYPDWFFTCVSLVALDVGSHWLQMYAQLLRNKSSHKDVDPSSFFILKLYYTNRIFMGA
FT                   CCVGAEVLYLAAHAATDPRIAAIAGPLRIGATPAKVSVPLPAALGWGTELGVECASALG
FT                   QLALVALPFWAVKQAANVAQLVTSCEALVAHDFPKRKRT"
FT   CDS_pept        join(146804..146953,147103..149577)
FT                   /codon_start=1
FT                   /gene_family="HOG000231056" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636083"
FT                   /gene_name="APC3"
FT                   /orf_name="MICPUN_56651"
FT                   /product="Anaphase promoting complex 3 "
FT                   /function="binding"
FT                   /protein_id="ACO61622.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560448"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199ACA6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V5"
FT                   /transl_table=1
FT                   /translation="MTVIVPEQTPAGEAHLEPFLVELVHESLNSYAYSNAAFLCERLHA
FT                   AAPTEANAHLLATCYYRADQANRAYHTLKGRTSPKCRYLFALCCVKLRRLPEAEAALCR
FT                   SPLPAGGRPPATDSSAAERPAANARATSDVPNGAHGLYLLGRVCKETGRDKAAAAHFAD
FT                   ALALDPFMWCAYEELCALGAEAEAEAATEAALRSADRYPKLADLGKFGASFGGAAESMS
FT                   FGTYGGETTSAATNSEGTSGLSGGGGGGTHSGASSNPNHALGGVLGTVAEGTPTVEKSL
FT                   GFAKPPHSGLPSASGPPVPMSTGGESAYYGAYGDEKTPAPDSTRGLMPPPPPSTATAAG
FT                   VPADDLVTPAPIGGEADHGKPPGPPGGPGGGGGGGGGGGGRGDGGRRKFVDEGKLRKVS
FT                   GQLFQESANAGSGAVRRSSRLAAQTGGGGGAGLDFSTPAMEAGSAEGAEGADPTTSPPH
FT                   HRARGRGGRSTHNPRGSLDGGSRPPLPLPPTSSSGHGGMNAGMNAGYGSNGAGRAGYAS
FT                   NGTALHAGHGGYVGCGRFAEGAAATAALLRPLADGLRTFSMFRCEDALAHLRELPRSQY
FT                   VTGYVLCLVGRAYAEMVNYPEAQRAFEWARTVCPHGLDGMEVYSTVLWHLKKEVELSYL
FT                   AQECVQLDRLAPQTWCVLGNCFSLQKEHETALRFFQRALQLDPRCTYAHTLCGHEFFAN
FT                   EDFEKAMGCYRNALRLDGRHYNAWYGLGTVYYRQEKYELSEYHFRHALSINSRSSVLFC
FT                   YLGMAQHALRRNADALTLLQHAIDLDKRNPLAKYEKASVLLSEDRLEDALEELERLKEV
FT                   APREASVFFLIGRIHKKLGAADAAMVAFSTALDLKPASADVNLIKSAIEKLHVPDDSEE
FT                   EDL"
FT   CDS_pept        join(complement(150555..150851),complement(150369..150450),
FT                   complement(149716..150212))
FT                   /codon_start=1
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636084"
FT                   /orf_name="MICPUN_107861"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="ACO62069.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199ACA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V6"
FT                   /transl_table=1
FT                   /translation="MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPII
FT                   PSLFTPARIARLTGDPVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLD
FT                   PTDITHMFKITKTIGLCATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADW
FT                   FQVYTQHAYMRPMAAMCMFVGIDEERGPSLYKNDPAGYFVGYKATSAGAKEQEAINFLE
FT                   KKVKGKDAGNTFTEQETVRTAIACLQTVLGEDLKARELEVGIVTVDDPNFRLLSETAIE
FT                   DHLTAISERD"
FT   CDS_pept        151072..151671
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636085"
FT                   /orf_name="MICPUN_56653"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61623.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199ACA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V7"
FT                   /transl_table=1
FT                   /translation="MGIRIEWSSPCGGCQKTLTKGSNAKKCGKCNSVWYCSKECQTLDW
FT                   KRPNKQGHKHRCAALAEADKLRGAGNPRSQKAFEAHDSKPMMDRFHEILQRKIQPGERA
FT                   YEVMSKMLEDGVAKGARAIMMIHEEVLGNGTIEFTVVPEAQVEVMLEDDAAFSRHALMV
FT                   RTYDPEKQFVICYETSQPERHIVFRVMAEDILNRRS"
FT   CDS_pept        complement(151792..153837)
FT                   /codon_start=1
FT                   /gene_family="HOG000078828" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636086"
FT                   /orf_name="MICPUN_56654"
FT                   /product="Formaldehyde dehydrogenase/S-formylglutathione
FT                   hydrolase"
FT                   /function="S-(hydroxymethyl)glutathione dehydrogenase
FT                   activity"
FT                   /function="S-formylglutathione hydrolase activity "
FT                   /function="carboxylesterase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="ethanol oxidation"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /protein_id="ACO62070.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0006069"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="GO:0018738"
FT                   /db_xref="GO:0051903"
FT                   /db_xref="HOGENOM:HBG560469"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199ACA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V8"
FT                   /transl_table=1
FT                   /translation="MELKSTNKAFGGEVRKYTHASTATGTPMTFSVYVPPAASLAKCPT
FT                   IYYLSGLTCTDDNAVQKGGAFQACAELGCMMVFPDTSPRGDDVADDDAYDLGKGAGFYV
FT                   DATTEPWAKHYKMYTYVTEELPALIEANLPAAPGLKSICGHSMGGHGALTIAFKSPNAW
FT                   ASTSAFAPICNPVECPWGRKAFAAYGVDGAAHDATELLKANGKAVYPDVLIDQGLDDQF
FT                   LADQLGIDAFEAAAAAAGQKVSIRKHAGFDHSYFFISSFMADHVKFHVNALNKKAEETA
FT                   LVDVAVADDAMLAEFAKTAGKPITCKAAVAWSANQPLSDETVVVAPPKAGEIRVKVVAN
FT                   ALCHTDVYTLEGQDPEGLFPCILGHEAGAIVESVGPGVTSVSPGDHVIPCYTPQCNQPA
FT                   CIFCASPKTNLCPAIRGTQGQGVMPDGTTRFTTVDGKEIFHFMGCSTFAEYTVIAEISA
FT                   AKINRRMPLNKACLFGCGVSTGLGAVWNTCKVTAGSSVAVFGLGAVGLAVVQAAKMAGA
FT                   SRIIGVDLNKDKFAVASKLGCTDCVCPADHGDTPVQSVIVNMTKWGVDYSFDCTGNVQV
FT                   MRAALECAHRGWGESCVIGVAAAGKEIATRPFQLVTGRVWKGTAFGGWKSRSSVPRLVE
FT                   RCLAGELPVDHYVTHQFEANGDVAKATNEAIEALHGGNCLRAVVNY"
FT   CDS_pept        join(complement(155144..155314),complement(154194..154802))
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636087"
FT                   /gene_name="LHCP3"
FT                   /orf_name="MICPUN_90184"
FT                   /product="Prasinophyte specific chlorophyll a/b-binding
FT                   protein, chloroplast"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62071.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199ACAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V9"
FT                   /transl_table=1
FT                   /translation="MALTMSNALVGTGLVAKPAVRSVQARAGLKVFARMTKDRVSLKKD
FT                   TKLGKSRIEIYPEWGEFPSSERTSPLTSLTYDEYKNNVSTEIIHGRFAMLGVTGAWAQE
FT                   NLTGIPWFMAGQECTFDNCSISYLNQSFTPSYDGALLGLIFLEVLLMGYAEGTRTGLIE
FT                   NPFDDVVAGSVFPGGRFDPLNFSDGKEANFFGDDLDTLKIKELKHCRLAMLAWLGILAQ
FT                   SVSTNPEGTEIGPVANWSAHVADVVHCNVVDRSGCVF"
FT   CDS_pept        join(155861..156049,156202..157578)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636088"
FT                   /orf_name="MICPUN_99274"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61624.1"
FT                   /db_xref="UniParc:UPI000199A640"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W0"
FT                   /transl_table=1
FT                   /translation="MSAVVAGNLLALAGTAKPLKRGRSATRTRRVVSAAANADDARVAD
FT                   VKRAVVATLASAAIALPAIAAPVAEIALTPEEQIAAEVAKFEEQRAKCGTSACRDTVTQ
FT                   WESAAVKKIKKKAGIPLDAPAPKAYPTPKRVAPAPVAETEAAPAPAAAPEATSQPAPRA
FT                   AAGPPVDAKADAKARLAERQAASAAAAEKAAAEKAAKAEALRQAQADAQAERVAAAKAA
FT                   AEAAEAKRAAAAAAKADAKADAKPAPAPAKKAAPAPPPAKKAAPAPAKKTAAKPKSPGV
FT                   FDYVVGDVTVAALGSAAALALVAPSFKDKALAGDASGALEEVKGLVTGANQDAAIGKAC
FT                   LLGGVVAADALIHLPVLGFFLPGPAEFVGTVAATLLAAKYFVTREASYEEDIKDFAASI
FT                   PAGVPDVASTVVEPITKFVGAVKAPDADALVGDFNEWFNGLDDPVEEIAPKAAAFGACV
FT                   AVSYVAHFPVLGLVLPRVLELVGVYVCGGAVARYGEAGTVSLKADLIKVGDDAGAIVKS
FT                   VVSK"
FT   CDS_pept        157786..159048
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636089"
FT                   /orf_name="MICPUN_56657"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61625.1"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniParc:UPI000199A641"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W1"
FT                   /transl_table=1
FT                   /translation="MELPEDLVERIAETCVRAGGLKEWCRSWRGTCRRFSSLRWFEAVA
FT                   RGGVPLAVVPSDRCPTVQLGVSRARSATEDAVARAAATRRALSRIAGRSEDDDDDDDDD
FT                   DDGWDVLGTGPTVLVTPGVHRENVRLTRTCALIGWGSRGSAVIEGSGWEPALAFAGLGM
FT                   SERGTGDTMGWSVGDTGERSVACNLSIRSRNRAQAFAVAVVNGAPKFVRCDLRGGLLVL
FT                   GWKTSPAALACVVRDGRGCGVKVTDHGEARLDGCVVERCGTHGLLLERGGRAVLAGRTV
FT                   VRDNDLEAVLHTPDTDGVALEGEGVDLGPPAIVRVGVRKYDSDDEEGDSGHVSVVVRPN
FT                   VRRLRVGAETLEHLHGHAPDYAWLKRGGFSFDDDGGDEDYEEEEATGSDYDEEETGSDY
FT                   DFDDDDEGVSASPRINEPYRE"
FT   CDS_pept        complement(<159790..160146)
FT                   /codon_start=1
FT                   /gene_family="HOG000198753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636090"
FT                   /orf_name="MICPUN_80006"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO62072.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG241590"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="UniParc:UPI000199A642"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W2"
FT                   /transl_table=1
FT                   /translation="MLLTGPNMGGKSTLLRQAALAVVAAHVGCRVPASACELHVVDAVY
FT                   CRVGAGDGIRSGVSTFFAEMSETAAALNAATDKSLLVIDELGRGTSTADGYAIAYAVAS
FT                   AVAERGSRCLFATHY"
FT   CDS_pept        complement(163903..167667)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636091"
FT                   /orf_name="MICPUN_56659"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62073.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199A643"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W3"
FT                   /transl_table=1
FT                   /translation="MRASFFRSRVVGKEKKGRGKGRAESTDEWDARVAEVDALRDSSLG
FT                   CLPRSIFADVVSRLDGPDVARLGMTCRAARAYCSRPAIWRALARAQEAPALVREDLVNR
FT                   DFTWKQLYAWRRHVLWHRARGVDRIAVADHARVLTCDPVEGGGRVRVAYEAPSPQPLAP
FT                   NLLTWSPDASMLVVAQESAEGCKLVLSAPTACLRPKRSNRFASGDRQFQILDRRRRGTG
FT                   HDRGDGYDSEDATMGDEDSTAAAGHGLGTSGRTQTAGRTQQLAGTNAAFFGRGDSGGGQ
FT                   SGGAAWQQLDDEDDSVDANKAKEPRAYPRGIVAPIDRVRSHKLPAMNSVHVPLRNPVFA
FT                   AFTACGTRLLLMNVRRHGEEFALHELDLTVAMASLHGATPGAAGTRGSKFLAKNHQFKN
FT                   HQSLAGTKRRRGDFVAGDDDDAAAAPANVRGVGPDGWLSADARETLTLVESGRELSFSP
FT                   GPSTRDVLSLVNGAAVGKISPANLRAWSGLDRECTARPVAGGARDRVRAARALERDEDV
FT                   RMNERLRKEENETASEASFELDGDELEEERDNRASTGNTHPAWRAGGGADGGAVEGAVW
FT                   GAHAASDDDEGGLREVSSAPESLWWRRSVDAFRGGYSAGVETLRSAAVQLARSLLPAAI
FT                   VHPAGVRRGGSSRRRGGGSVWGAGRGEREEAAMRRAAEVERRSRSGGRAIKRARLTGRA
FT                   AAAGGAAGGGGDRSRAPVVGGFSRLGKAKKGSGPSASVGYVNPFACAIPSVRRARPSDV
FT                   VSFRRDRLHETSLPGLAHIVQWVRPARDVPSVGRGSNLVAGDSPGGDSPGDHGHWLVPV
FT                   SFPDAMPRAVHLALLPAAPTPGPNEIRGTDAQRRESARLAMLGLDASMPRSAASRVAAA
FT                   VERSVIAARSLFSKDARHPSAPVGAPVGTLEDACVVELAPPAAYNELHVVVSTVAAAAP
FT                   GGKIVCWADDGALWARRAVDGPDGNRTWDRATRVLDLRRCGFGADAGLRIDDEGSVAPN
FT                   PVLHQVCAMQWSASGTRLLILVACHFTTTSHVFPMHQWMVWDPPATWLGASDLSLLEDP
FT                   PSATTHGAGCFAASGGGPGAPVFCRCVSRSYDDALAGDFRCSHGRDRYRCEECGGAGVG
FT                   EDAIDPGTLDSIRARVHETGAYGFDPDDVLGVITRGRWHVPTKTFVQDVLPIFEQYSQT
FT                   HSLWAPDEDRVCYPVRSDGSGAGAGVGGGDHVWMTRFPRMPIVHRLASVGGGRNVRQVG
FT                   EHNALPFKHAFVDSAVVVCEGSFCVWSPC"
FT   CDS_pept        complement(168219..169832)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636092"
FT                   /orf_name="MICPUN_56660"
FT                   /product="Predicted protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62074.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="UniParc:UPI000199A644"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W4"
FT                   /transl_table=1
FT                   /translation="MLNGQNNYQTAPPGGGGFPLVGSHGNMQGMQYGMGPGRGPGGMQG
FT                   APQARGQFMGGMQGGMQGGGMGNPPGVFNAQAQMNGGLGLGGAPPGLGGSPGGARASMD
FT                   RTGSGGQLLARQGSMPGAANGGMMGPNAGAGPRGMMAGGGSFGGGGGGGIPGPRGSGPD
FT                   LLAMINKGGAGSPFGAQGGMGMGGMGEDQTPFDMSEFPSLGGPPPGARGGLGGQPGAQG
FT                   AFGGMGPGQGGVFGGMDGMGSMGDGYGAMALQKPHPEFTIQNEDFPALPGAPGGGGGGG
FT                   GGASKGGGGPALGQPGPFAQGPQGGKLDLNGPMGGGAPYEFGGGKGSGGGKGVGGGQMA
FT                   AATDRFGLLGLLGVIRMSDPDLTTLALGTDLTTLGLNLNSPEPLYKTFGSPWADTPPRP
FT                   EVELLLPACYSVPVAGVRPAVFQKFQQETLFYVFYSMPGDESQLFAADELCARGWGFHK
FT                   ELKAWIMRVAGTEPVMKSERGERGSFWIFDVMSWERIRKDNFNLQYDQLEARPETGDKG
FT                   AGGKETKPPAGGLLTASAGK"
FT   CDS_pept        170740..171867
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636093"
FT                   /orf_name="MICPUN_56661"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61626.1"
FT                   /db_xref="UniParc:UPI000199A645"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W5"
FT                   /transl_table=1
FT                   /translation="MAPADTAGLERLVRTVRSDAEQRKRLVCNACFLAALAQLHPEVVA
FT                   KPKGERRWRREELDALAAATAGRIDDADPVHVIVGVDDLNVNIRYMKGSLVYLRAETNP
FT                   PLRCMMYSSMPPPPGQEEPSADDSADGPKTPGQDETADLPTGPAKVLDDADASHALVRA
FT                   VLERLNDDPTIDTAGGGVDADDPEAVATWRAARVRESLTAAHGAHWHVVHDAKPFGAAV
FT                   VTSGEGRRVLAQRGRYSFLVWRHSSSIKSPLEAIRRRIRADLPALRRGARTTFLVVCAV
FT                   YALWYRAMCREEEEEGGGGGAGGGTRPNDDRTAVGIIAGAEPRLTTFLCAAGESAAPFA
FT                   FFALAVMFALGGGGTASAIGARYARAFARRKRKSA"
FT   CDS_pept        172023..173102
FT                   /codon_start=1
FT                   /gene_family="HOG000264812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636094"
FT                   /orf_name="MICPUN_56662"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61627.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560508"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199A646"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W6"
FT                   /transl_table=1
FT                   /translation="MSFALASLQGRALASPLHVKRTAPRRGTRAVLVRAAVDPERDVIL
FT                   VSGCRERVAQCCVDQLSKNERSAGVVIKVTLPHDAYVGVKNPLNAMAKDLVFPDKPMID
FT                   CLGALDAVECVDESTDLFKGCLKDATGVILASEYAPTLLQTAVDLCDRIKAGAMPKLRR
FT                   VVVLSHIGVERRDVDPWKFMNRKTMVGTGVIGGKPQPGGAPLDRWVDAEELIKATLESC
FT                   GGADKSPWSYTIIRVGDLRGNGPTSVTYGDAMLTLVDNAFDVRMQDIEMEEGDAFEGFT
FT                   KRLSVAVVMNRMLTTQSYRVINRTFSCISTGPVDRERRKGWDVAKGRSPPPIEDKVVDE
FT                   ELQPKEEEENVPAGAPVPT"
FT   CDS_pept        join(complement(177168..177194),complement(176382..176828))
FT                   /codon_start=1
FT                   /gene_family="HOG000012544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636095"
FT                   /gene_name="PSAN"
FT                   /orf_name="MICPUN_93625"
FT                   /product="Photosystem I subunit N, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem I"
FT                   /cellular_component="thylakoid membrane"
FT                   /protein_id="ACO62075.1"
FT                   /db_xref="GO:0009522"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0042651"
FT                   /db_xref="InterPro:IPR008796"
FT                   /db_xref="UniParc:UPI000199A647"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W7"
FT                   /transl_table=1
FT                   /translation="MAAMTVCAPAMLSSKVSTGIKAKATAAKASKAQGAVCFFGDAKKA
FT                   AAATLAAAVLVAGPAMPAKADLTSDLLARTEANKELNDKKRAATSSANFERSRTVTDGV
FT                   CKFPQNMLGCEIASSTGDVAFLSADKALECEGTRDGKVCASKAPGSFPPVFGM"
FT   CDS_pept        178847..181057
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636096"
FT                   /orf_name="MICPUN_52126"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61628.1"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000199A648"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W8"
FT                   /transl_table=1
FT                   /translation="MRPMANGAGGSKGGDAGPAPVVDSANDPMAISETWRRFMDAHVAG
FT                   VGIGTMDDSREWASTALTRLREEEDENRRRMDAVVTPDGRDANGEIVFPVKKDNSFVDL
FT                   LAVAKDDEAARCAVLLALALEAAETEARVAWNKLRAELRWKEPFAPAEKSAALESAHSL
FT                   DSAGDDNGVGGRRLGRRASGVADLDDIIIESPGEFLEQRRNSVAGWDAGAGVGRGGAWL
FT                   LEPLRDRWEARRVLEWSPWVMSEASVGASGELAILSGGGDGDAEGGVAEGGVAEGAPAA
FT                   AADEGAVVGLRGAKEEAARRRAAMTEEPNYVVESVPTQRAFDWTSLVPAASVPQVSVQE
FT                   VISVDAGDDLSSPSSAPGSPKGPGLEDPGSPTSKSIHSVTSDASTINIDALTDLRYGEH
FT                   MVFLVHGYAGSLQDLRLLRAHLQVACPNVHTRVSAANHERTGVDSIEAMGARLAEEVAE
FT                   TMEDLESGALVPRGGGREPRSPAAAAATTAARFGAPPRVSFAAHSVGVLIVRAALTHPA
FT                   MEPYLSRLHLFLSMSGPHLGYAGGDRVGADGMDKKSRRFIGKSAAFQLGLCCTRAINPK
FT                   AKCLSEITFRDAGKIEDCYLYRLAHHKNGLALFRHVVLVSSPQDKYVQRHSARLQLEGF
FT                   RIREGSRRARATMEMARAILAPVLEKAISRERGEAGSSGRDGVERESGARLTSLSRVDV
FT                   HFAKVGGGVDFNQLIGRKAHIDFLETDEYVRFLIWKLRRAFL"
FT   CDS_pept        join(complement(182748..182837),complement(181251..182570))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636097"
FT                   /orf_name="MICPUN_56665"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62076.1"
FT                   /db_xref="InterPro:IPR019385"
FT                   /db_xref="UniParc:UPI000199A649"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W9"
FT                   /transl_table=1
FT                   /translation="MAQRVNSCNFEDSFSDIDMEELDSYLTSPPEMLSGDSPTDDARAA
FT                   ARARLAARAAHVEGGLAAAAAAEAAVASVAAGRGGDELRPVLSNLSANVPAKTPAPRAG
FT                   FKRHHIISPPMKNARVKNDDGLGVNVARAARDLCGDLGEPKESLMRRALEVIGVVEAND
FT                   IAIQVYRIEGEGGQMTSDGARRRTPGGVFWALLRERVTKEEWADIFAEEKEVQRERCRR
FT                   RRRAASAAASLAGSPTFREGFGKGGGPVAPASSSLKTPAPIAAAARLAANADAPARATM
FT                   ASKLRDTAAAFATAVAATPAAAPGSWAARARAPPAFSRAQSAPAAVLASAAKKAAKTPA
FT                   AAAPATPATPFGVVTPENDPNASKGGSWAQRARAAAEAEAAAVEARKIAAYKQRLAKLD
FT                   AKPLAAEAPAPPVVNVEAPAPPVDAMDADVQDGEDWAAEMETEDAGAIAAGTPAANPWA
FT                   GMATFASMVRA"
FT   CDS_pept        183379..183975
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636098"
FT                   /orf_name="MICPUN_56666"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61629.1"
FT                   /db_xref="UniParc:UPI000199A64A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X0"
FT                   /transl_table=1
FT                   /translation="MDAQQLERYANLAPCFFAVIGVVFMAKCKVAWHPILNKTGWKKDG
FT                   VFACSADSVFLRWASLVSHTFFIIGAVIFGNGILAISNVLGLPLVLGFWCASSSIIQSI
FT                   MYMAVFKQSPMGTPDIDGPPVPARVVIAAVWIITTANYIVNRATLYRDVDETRLFGLMA
FT                   VGVFLPAAIGAKHRTKNWRLHYMKDLPARDEAKTY"
FT   CDS_pept        complement(184073..185401)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636099"
FT                   /orf_name="MICPUN_107865"
FT                   /product="Major facilitator superfamily "
FT                   /function="tetracycline:hydrogen antiporter activity "
FT                   /biological_process="response to antibiotic"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62077.1"
FT                   /db_xref="GO:0015520"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="HOGENOM:HBG560514"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199A64B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X1"
FT                   /transl_table=1
FT                   /translation="MLAVFLHLLGFTVTGPITPSLVAHFGLHPSQVGYLTSAYPLGMFF
FT                   ALFAWPRLSDAVGRKPILVMSLLGVGVGLVAQAACVTNGWSLATFLGLRVASGAFAGAS
FT                   PVVKAYLADAAAPEQLPSFMAWREAACTLAFIVGPSLGGLMFSANKDLGACIAVTGWAS
FT                   VGAAFIVAVAVKEIGWRRRDGSNEGAGISGSSADESGADVDESEDDAGDGIDPTGASAA
FT                   AKRAAREQARTEAASAPACPLGRRLYAAVATICVTSFLYNAGQSTFDSFFPVFCAQQRG
FT                   MGPTQIGATLTALAAVSFSISAAGFAAVNKKLGLTSTTALGLALVAVGLGAIGAAPTAG
FT                   LTLFAATLYVTGIPLFTPAIPILLMQCVPPNRRGAVMGLDSAVNAVARIATPIALGGVY
FT                   HASPTAAFAAAGGVVAFACALVLVRRWMVMGPGMKFGGVGSAR"
FT   CDS_pept        186102..186791
FT                   /codon_start=1
FT                   /gene_family="HOG000123402" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636100"
FT                   /orf_name="MICPUN_56668"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61630.1"
FT                   /db_xref="HOGENOM:HBG409904"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniParc:UPI000199A64C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X2"
FT                   /transl_table=1
FT                   /translation="MCAPIRASYRRDNVVESVFEYTQLSLDTSLGISLHDITPQVRRAI
FT                   RESGVTNGTVNVLSRHTTTAVTINEAEGRLMDDIRQYMLKLAPPGDPYLHNDIHLRDGP
FT                   PDWPGGNDAWRAQEPRNAHSHLLSILIGNTLAVPVVDGELAIGTWQSLMLVELDGPRKR
FT                   TVGVQVCGTRSGMGDKPKRIDTSESSSNAASKSYQKKASPVSDGYKDPMDALCEDDPSA
FT                   DECKVFD"
FT   CDS_pept        complement(186865..187356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636101"
FT                   /orf_name="MICPUN_107866"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62078.1"
FT                   /db_xref="UniParc:UPI000199A64D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X3"
FT                   /transl_table=1
FT                   /translation="MGPRPGWCFKADRHGLGYYRDPVQERREPEVPHHRATRNADRDKP
FT                   SPLYHAGEETEEPTYGHHHRGGRSATHHGGDGSQNRGNSIGTRPVVRQSKLFRRHESGN
FT                   AMKDILGNGGAMKWDENRMQGGYSGATYDHEAHNDALLRQHEQASILREVLSEVRGGQR
FT                   "
FT   CDS_pept        join(188489..189762,189806..189812)
FT                   /codon_start=1
FT                   /gene_family="HOG000264720" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636102"
FT                   /orf_name="MICPUN_99282"
FT                   /product="Amino Acid/Auxin permease "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61631.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG609092"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000199A6B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X4"
FT                   /transl_table=1
FT                   /translation="MSSPPWSPTREPHGRYEELAQVDEYGTMRPTPQNDDVSDQASDDA
FT                   LVHHDDSSGWAQTPAWNICLNAAMYCAVPLSMPATLAAGGWFWGTVFFAYATFATYWTG
FT                   LVIGRVYLEHPRLATYPAMASEAFHNLALERTNGDARVARNWRTWSRRAVKITQFATFY
FT                   LDTVTQMIYVAQYFAQLDLGWFGTGAGRDEGDEIQSDSPAGRPRLCQWAWVLVVWAVSV
FT                   PVMQIPTFHASRWVIVPAVAVLAVSVALFLYEVAVVVKPWSCEPGPSFGGVTLPSAMVS
FT                   LGNMAYAYGGHGVFPESLREMREPHRWPSVMRWMYAGLVPAYVVCAVVGYAGYGRFAQA
FT                   NINLNFPKNWVNGVSITLQLLQCYYLIFYTNVVLVLMVETRWGIDPTKTWRPRTSLPVI
FT                   GSTSPAVARMLFRTAFLGTQVALAEWR"
FT   CDS_pept        complement(190250..190819)
FT                   /codon_start=1
FT                   /gene_family="HOG000264294" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636103"
FT                   /orf_name="MICPUN_99283"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62079.1"
FT                   /db_xref="HOGENOM:HBG560516"
FT                   /db_xref="UniParc:UPI000199A6B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X5"
FT                   /transl_table=1
FT                   /translation="MADVSDDDEDWYDTQADADDADADADDDDDANRQPDSWDAFWQRC
FT                   VRDNEQAVRDAGGDPAKVPGPQNLPTGRHGDVLKNGAPADHGKIRCWGCDARTTAQMEC
FT                   AQCLEIMKERAVKAAFDNWERAFFCSHLCYKEHYHEHKARHGPSKSVPTKTDGTIHHFP
FT                   CAEGCGALWDSKALRRHVFDECEPYE"
FT   CDS_pept        191201..193954
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636104"
FT                   /orf_name="MICPUN_56672"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61632.1"
FT                   /db_xref="UniParc:UPI000199A6B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X6"
FT                   /transl_table=1
FT                   /translation="MAQTSRSTDIKVTRAMRDATNSVAPRDIAPKPPAEGKENSKYDGF
FT                   FFADPAGLTTPAPAFPTKTMDPSPTSVLMGPGTPDEAAEQRPREKATPENATDDGADAE
FT                   MTLATSPSDGESVDDDVASPESPERPATVPDLAVASTSPFVPNVLEELLGAQLPRAESN
FT                   VRARRDAAGNLAANGAPQSAQTRRVQHATSTPTSATSTRWRSVPSPAQIVSMGREWAAS
FT                   GTVTPGRSTAIPTFLDDLVNNHVAKVAVDTKGTNTESNNTDEWDRTGDLKVECERLKRE
FT                   VDFHREVSKEVGVSLDASAAELERTKRRVEFLEALKDEWDAQFKELSAETERYRAEADA
FT                   AREETLAAEALAAAARAAATSANAEAESLRKNVIHDDDGSTGEAPETSGTTSTSASATS
FT                   AEVGSAALFRRHRSGAENDVAASIAAALRERESELDAARLNLDQTLAAAKAAEAKLAAK
FT                   CEECAALRGEVNVAKSTLAAAREAVAQTEGALMTTLEDKKRLVEDKKRLIKKIEMMETD
FT                   ADAKARDACERVRDATERGRRSVLRARANWGAVALTTAALALGVCAWAAAVPPAGVLIA
FT                   VPFGIDFRDWRLGSDGSTSAFNAGFNVRTVNFTLPGAGYAVAAELSACRADLATSTALA
FT                   SALSSEASRFAGLAEENDRLAAEVEDFARVTESLREREADVRSLESRLAHLEASANDAA
FT                   TRGDDPFAASLAARAETERLRHALAKERSLRRRSAFLEKLDVVSIAAVCVAWGTCLLSA
FT                   WFFARKESGLRRTLNDYGALMEAASAEHERLGSELTRATLDANEERTRRERSEGRAREL
FT                   ERQLDASRKAANEATKRVEAFEAIGRRERERERDGARSAEKRFGKASSFGGGKSVTWDD
FT                   DVSIAPSTTSSSSVVDARAGAQNPEAAARPHNTVFKPPVGGVKSFQ"
FT   CDS_pept        join(194212..194274,194411..196180)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636105"
FT                   /orf_name="MICPUN_56673"
FT                   /product="Kinase/lysine decarboxylase "
FT                   /function="kinase activity"
FT                   /protein_id="ACO61633.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG559924"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199A6B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X7"
FT                   /transl_table=1
FT                   /translation="MKDVDTPHVTPIKGYAADAGKRKRSLDGTPDASPPEVIALETLAV
FT                   IDHSCKVPDHFFKAGPGFKGEVGGSIRVDEETLQTMLVNVGEFSTKAGGSAANTARGLA
FT                   AGFDIRTSLISAVGKDEWGALFTSSMRRAGVDASKTVVRDDPEARTGRCVCLVDKTGQR
FT                   TMRPSFDDKHRLLPNEITPDMFEGSRWVVVNGYSYYSPGFLEAACDAASIAGCKVAMHL
FT                   ASFEIVRKFRPHLTSLLASGKVHVVFANEDEARELVGGGDASSESIETDTKIEAALAKL
FT                   AEWCDIAVVTLGDKGCVAMRDAERVDQKAFKGFDVKDTTGAGDLFSAGFMYGLLRNASL
FT                   ERCCELGCLSGAAVVQTMGAEISADGWTWVHAHMHEGRARSLVRGSAGAVQRELLACYE
FT                   LIESIGRGVVYYGSARLKADNPHFIRSRELGKMVSELLGTPTWTGGGPGMMEAASLGAM
FT                   DAGKAVAGIRIEREAGTKVRSAAQSYLKPEHTVFCKFLSPRKVALVDAGVRKKSEDRTA
FT                   YVFLPGGLGTMDELFELFTLYQLHKLGTDHPVPVIIVNYDGFYDCLLDFVNTMQGHGTV
FT                   GAGEYDQMVVKNTNDEVVDYLKQYYNIEGHDVAA"
FT   CDS_pept        complement(196297..196938)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636106"
FT                   /orf_name="MICPUN_56674"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62080.1"
FT                   /db_xref="UniParc:UPI000199A6B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X8"
FT                   /transl_table=1
FT                   /translation="MAAAARVASSSGASSTSRPVPPRRRGRVAASAASTVATDAAQLAA
FT                   GVVAGAALLSIAWPLLERELRPIRCARCRGMGWTVCTNCKGRGKTGCPPLMYATVERRA
FT                   KMRRSTASDDADSEVPIDGSCDGVMIAGPPRSREDAPTCADPETEAAYAPGLVERLSYC
FT                   RECGGKGRCGCDACNRTGIENNWLYGPAANGGWGARGQWRDPANPPPPPP"
FT   CDS_pept        197061..200516
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636107"
FT                   /orf_name="MICPUN_56675"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO61634.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI000199A6B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X9"
FT                   /transl_table=1
FT                   /translation="MGDEQEKWRRALLKKLRGAAGVKARIDAGDGASLQRSQLARGTAS
FT                   AVADLVARCVEAGLARDGPEIAAALAAGADGGIVAMAAANARGPDGEPGARARRKRERA
FT                   AALAAASSQSGGGGGGGEDAKRTRLDDGDRARGSKRASGECKRATWALHALAKAPDADP
FT                   ASVAVTAKALTAVLRDSKRDAASMDALLASVALYAAAKLRSSALIAEGATDAASDARRE
FT                   LRVCASRVAARVDAQLCARVDARGASNALWALATLASSRGEAGVGERERHAATRALVGA
FT                   LSTRVELRAAFNARDAANALWGCAKARVGLSDEATTQLASAVSGSAPGSAPGSAPGSAP
FT                   PGERGANAVEASMALWALASMRGDGTIGAHVARLAATGVVRRLAECAVKVGPTSTTEVD
FT                   QHRVVANASWAAAKLSERVVSGGGGGDTAGDDPAKMDSEFDAVATGLLRRFASAAVEAG
FT                   PAFQLESPRAAAQLVAALRPSLLDAACGGGGADGVPSADDVAAMTILTHRGLRSCFARG
FT                   REEMEKEARGTRRTSANGAHDVVRKYPESIQKPSSDDLAAFCDAAEALSGFGVVVDAGY
FT                   FRSAVAAACTGGPTALGWRAAGRLEHCVFSVLGLGPVAATVTARGSGSHRGRRGGAAER
FT                   APSADDVAAAERLLRRGAAAAEAANDTRLAMETAAADVLLAVPGPDGPVASGGGGGGRM
FT                   LCVDDTHRLLSRMLRERGGWSVTNWNRFSRKDRRGAPRPPAGAFDAATVRLPPTKAAFA
FT                   MALVAVAARLRAGAVAWIYGADREGVRGCEFDLPDGSFEDVRVVHSCASGGGGGVEGFD
FT                   RGAHVEDSVGSFSVLRCVRTDKPFGVSGSGNPAGGGATQLATRSTTPNRDEDLLEGFKK
FT                   VGRLDVRLGDDVHAFERWVTYPGLFAGGGLDVMTAFLLETMTRSSDGWLGSALRGTPEG
FT                   RGGKEGEFSALDFCSGSGTLAACVRRLAPSARLTLLDADAVAMLAARENLSLPSGSSGA
FT                   SVLDSSEPDGSSPRSVHLPAAFALGDGWTGLSSDERFDLIVSNPPVHLGLRPEFTVLKS
FT                   MCAGFDARLKPGGEAWFVAQRYVPVAGICAGIGGLAAKVARVCANDKFAVWSVRKPPGA
FT                   GREDGSLERKAAKKAKKEKKEKSGGKKEKSGKKEKKEKKEKKYS"
FT   CDS_pept        join(complement(201013..201168),complement(200575..200907))
FT                   /codon_start=1
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636108"
FT                   /orf_name="MICPUN_79960"
FT                   /product="Glycosyltransferase family 1 protein "
FT                   /function="carbohydrate binding"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="lipid glycosylation"
FT                   /protein_id="ACO62081.1"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG629711"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniParc:UPI000199A6B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y0"
FT                   /transl_table=1
FT                   /translation="MPKKRKSVFVTVGTTQFDSLIEALDTPECADALRGNGYGSVVIQR
FT                   GKGTRELPTPLEVRVFDFAPSLADEMLAADLVVSHAGSGSVFEALGMRKPLLVVVNDAL
FT                   MDNHQAELAEELGKRGHLRWCESGGLANAIATFDPRGLTPYEPGDPSGIARALDDALA"
FT   CDS_pept        join(complement(202032..202093),complement(201432..201804))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636109"
FT                   /orf_name="MICPUN_56677"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62082.1"
FT                   /db_xref="UniParc:UPI000199A6BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y1"
FT                   /transl_table=1
FT                   /translation="MIAAAHTVTVRPAAALSARRGLAGSSLRTAAKPPARAALRVRSTA
FT                   TRAEGIVDDVMADIKKKIADNKEKLERAKIVASPPGVPPPPVVPILEPGKIGFVENAER
FT                   QNSRWSMVGWWSLLLVELVAGKGLLEIMGFTVGKGINFTF"
FT   CDS_pept        join(202395..203186,203277..203588)
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636110"
FT                   /orf_name="MICPUN_97114"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61635.1"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199A6BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y2"
FT                   /transl_table=1
FT                   /translation="MSASAPFGSAKRTEELLSLSFNQDSGCFACGTDGGFRIYNCDPFK
FT                   ETFRRRFDSGGIGQVEMLFRCNILALVGGGRSPRFSPNKVMIWDDHQSRCIGELSFRVE
FT                   VRAVRLRRDRVVVVLEHKIYVYNFADLKILHQTDTVANPLGLCALSPTQDSTVMACPGL
FT                   NKGQVRVELYDLGVTKFISAHDGELAQLQLTLDGALLATASEKGTLIRVYDTASATLMH
FT                   EFRRGADRATVYSIAFAPGKDFLAVSSDKGTVHVYVVPERASGSNQEGGVVDAKAAFSF
FT                   VKGFLPKYFSSEWSLAQFKLPDFTRSLVAFGPEPNTLIVVTVEGTYYKVGFDPKSGGAC
FT                   AQVAFSRFLKTAEEEEEGGWGAVRDVR"
FT   CDS_pept        <205043..>205345
FT                   /codon_start=1
FT                   /gene_family="HOG000199425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636111"
FT                   /orf_name="MICPUN_77080"
FT                   /product="Predicted protein"
FT                   /function="two-component sensor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO61636.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG640751"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI000199A6BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y3"
FT                   /transl_table=1
FT                   /translation="HALCVADATAKDQPIVFANDNFFVQTGYPPEEVLGRNCRFLQGPG
FT                   TDRETVRAMREAIAKGKEFHGRLMNYHKNGTSLVNSLVMSPLRDEKGVVTHFIGIQ"
FT   CDS_pept        join(complement(207101..207409),complement(205666..206670))
FT                   /codon_start=1
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636112"
FT                   /gene_name="PGK_1"
FT                   /orf_name="MICPUN_104767"
FT                   /product="Phosphoglycerate kinase "
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62083.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000199A6BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y4"
FT                   /transl_table=1
FT                   /translation="MAAFAAAPALSARAFFAKSSVRAKKTSVRAQARAALKVEAKKKSV
FT                   GDLKKADLEGKTVFVRCDLNVPLDKDLKITDDTRIRAAIPTLEYLVENGAKVLVTSHLG
FT                   RPKDGPEDKFRLTPVGARLSELLSCSVSKVDDCVGDVVKDAVGGMANGSVCLLENVRFY
FT                   KDEEKNGKDFAKQLSEYADLYVNDAFGTAHRAHASTAGVTEFLSPSVAGFLLQKELDYL
FT                   DGAVSNPDRPFCAIVGGSKVSSKIGVIETLLNKADKVILGGGMIFTFYKALGKDVGSSL
FT                   VEDDKIDLAKELMAKAEEKGVKLLLPTDVVVADAFAADAKTQTVSVDAIPDGWMGLDIG
FT                   PDSVKEFQKELNECKSVIWNGPMGVFEMDAFAKGTFAIADTLANLDGITIIGGGDSVAA
FT                   VEKAGLADKMSHISTGGGASLELLEGKVLPGVDALDEA"
FT   CDS_pept        208031..208795
FT                   /codon_start=1
FT                   /gene_family="HOG000264521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636113"
FT                   /orf_name="MICPUN_99290"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61637.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG701377"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI000199A6BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y5"
FT                   /transl_table=1
FT                   /translation="MIEYVTRGEWYDGEIRRFVRIDNENPPRKRGVLFVGSSIFREWRE
FT                   ARDFAADVAPLGADCLNRAFGGSTTRDQLDVMEQIVFPHDPKVLVYYCGSNDVNAGVPP
FT                   RVIRDNFLEWCARAFSRCPSARRILFVSIMRAPQKAPVWDALDEANALIREACGEEGEE
FT                   GRRGLKRVSFVDVNPLLRDASTLEPLAQLYRDDGLHFHPSSYDRFAPAIVDAARRALDE
FT                   CGDSVGRGGTGVRGGESSEAPYDPALPPSLGR"
FT   CDS_pept        complement(208827..209576)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636114"
FT                   /orf_name="MICPUN_56682"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62084.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199A6BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y6"
FT                   /transl_table=1
FT                   /translation="MARSECLYDLLGVADDATDDELKRAYRDAARLHHPDVNPDAEPGR
FT                   FSAVSSAYDVLRDPNKRRAYDATRAWERGVDGGGAGVRTPGATHATWGGFEEYAKGFAE
FT                   RYHRAHATETEWQRRERMAKAAAERAEMEKEFWIQEKARARHMAVEYRRRAAALKHSRA
FT                   LRHEATIGGFWFSKKGWLPMDFVALFTALAFAGGSAHVWKESGRRKFEARGGRAAGEGE
FT                   ETPVVGAVDPKVEVAAAAVKEGETRHR"
FT   CDS_pept        210593..211957
FT                   /codon_start=1
FT                   /gene_family="HOG000036730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636115"
FT                   /orf_name="MICPUN_80233"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61638.1"
FT                   /db_xref="HOGENOM:HBG630213"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI000199A6C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y7"
FT                   /transl_table=1
FT                   /translation="MTKPNRREEGGAPIRPAVWRPGVDGMDADEELEYDPSVYDCLHAW
FT                   QLDWPCLSFDILRDELGDTRERFPHSLFAIAGTQADVATKNHLTMMRLTRLKKTRRVDK
FT                   AAADMDDDSDASESDSDDEDGGIAPINGPIIQVQKVAHHGAVNRVRACPHRPSLVATWG
FT                   ETGVVQVWDLAPQLTKLSMLTADARDAQAAMNVQPQRSAPRHAFTGHADEGYAMDWSPT
FT                   VDARLATGDNAGGIHVWEPREGGRWAVDKTAVFKGHESSVEDLQWSPAEAQVFASCGAD
FT                   GYVCVWDARNANAAPALRVKTHECDVNVMSWNRVANCMLATGADDGSLRIWDLRMFSPS
FT                   DAKHVANFSFHRGPVTSVEWSRFDSAMLATASADHTVCVWDLAVERDAEEEAAAMAAED
FT                   NAMAPEDLPPQLMFVHQGLKDPKELHWHHQIPGLCLTTAADGFNAFKAYNVGPGC"
FT   CDS_pept        212151..213002
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636116"
FT                   /orf_name="MICPUN_107868"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61639.1"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniParc:UPI000199A6C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y8"
FT                   /transl_table=1
FT                   /translation="MASAAGAPAALAARLPRARGCRGARRGVRRVRVSAESPGGREELS
FT                   RPSPPEKFMRFEVRKTLRVPVPEPARVNEAAGRAPRSLERWIQRPENVMEVVFSKEGVI
FT                   PRESGEWRISVIKLPFLDWELNPEFDLRVLPKDAAAREFGVRMVSDALRFAPEGGLEKL
FT                   PPGFAGMDIWSYIDCELFIERLPDDDDGTAGGGARSRTAVCADIDLLIAADIPGVFRWI
FT                   PFFEGIGESAIAGSIESVGEFAQANVQAAYEEWVGAEEAATEPSGAPFGGINLAKREQR
FT                   AR"
FT   CDS_pept        join(213373..213384,213634..213676,213992..214070,
FT                   214242..214300,214568..214719,214896..215579)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636117"
FT                   /orf_name="MICPUN_56685"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61640.1"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI000199A73B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y9"
FT                   /transl_table=1
FT                   /translation="MANAVLGEHVSEAEMPSKEGYVEAQAFASVHDLVHHAILSRPDHR
FT                   AILKEIYATCEREGRIAYKHGKGSRLLTANEHWKSQIRHALYTSPRFRRVDDGEAWSVS
FT                   NPEAKAPEPVTVRVYPGDDEAVAAQRSHEREEHKREKALAAAAALAAAVDLPHQLPHKA
FT                   SRAVSNSRKRRFSNASTTSDDVSDDSPHKRNRRARHHAQGRAPLAEVAELAQTGQPTNN
FT                   PWRKRDDEGRLHRALRRARENDRGLPRLVSRDSSPEPDGEHEATRDDKPVIVMVGNKPV
FT                   VPKGRDIAHNRRKPLEGHRAAMPSGAIPDAWNSVKCGAGASTGFIYHPSNEFITYHLGL
FT                   SG"
FT   CDS_pept        join(complement(217131..217382),complement(215924..216913))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636118"
FT                   /orf_name="MICPUN_113699"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62085.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG559990"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199A73C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z0"
FT                   /transl_table=1
FT                   /translation="MSHRAVVTAREAHARLTAARRYSGGSAGAILKSRHVAPAGRISGR
FT                   WGGVSHRRGSRRGPCLVVAKIWTDDGRRKAAEMMGLTAEEAADEKTLKRAFRRLALRYH
FT                   PDIAKDDAGVEKFHQIQEAYRVLSGADLAHVELPQDQEWDTHDWRWAHRYKGAANGVAG
FT                   VDPEQARRRMGEEERRARVGEQLRSMAGAPTRRKRRVIKPLSAQPSNVAVEFNSGTYDD
FT                   DGGGDECPSDGCASEWAQPARSSADTAGDTAGDEENSTKFAYNARAVRGYQSDRHSTET
FT                   AHERLNAQLAGLHRKKVIRARAMGIEFTESAQSANSGAGKTGRAEDPDAEARRQENKVW
FT                   AAKAARFYGGAGLQLEESTPERFLRLAKLAKEWRDQRSQNSFSQALFSSAEEKMSPKEL
FT                   LQSAVEGASLGACA"
FT   CDS_pept        217787..219739
FT                   /codon_start=1
FT                   /gene_family="HOG000186562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636119"
FT                   /orf_name="MICPUN_56687"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61641.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG384096"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199A73D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z1"
FT                   /transl_table=1
FT                   /translation="MADEHKVRVPTRLRSPSSRLRRSRSCYPISRVGARSSSFHRLPTG
FT                   EIARSIRRCSVHSAAYPPDTDLAMIHRYVAAQALGNAAFSAGNYADAVKHFTDAIGVDA
FT                   ANHVFYSNRSAAYAALNDFDAALNDAEKTVAIKPDWVKGHSRKGAALYGLKRYDDACDA
FT                   YQKGLDLEPDNDACKSGLADAETAAVRAMGAAGDGGDPMASMGAMLSSPELYGKLATNP
FT                   ATRGFLSQPDFIAMLTDVQKNPDKFGSYLSDPRMMQVLSVALGINVMSGEDAMKNPDAM
FT                   FTNKGEPTVPNVTKTTPPPPPAPEPTPMAVEPEPEPEPAGPKAEAKKEKELGNAAYKAK
FT                   NFDVALEHYDKAIALDGEDISFITNKAAVYFEKGDFDSCVKACDDAVEKGRELRVDYKL
FT                   VGKAMTRKGNALVKLDRLEDAIEVYGKSLMEHRNADTLKRLNETERELKERTKKAYLDP
FT                   AKADEAREKGNELFKAQKYPEAVEQYTESIARNPDDHRVYSNRAACYTKLTAFNEALKD
FT                   AEKCIELKPDWAKGYTRKGHVEFFTKQYDKALETYQEGLKHDPNNEELKDGLYRTHVEI
FT                   RKASTGQVDEKELAERQQRAMADPEIQGILSDPVMRQVLNDMSTDPKAAQEHQKNPMVM
FT                   AKIQKLINAGIVQTR"
FT   CDS_pept        complement(219822..220583)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636120"
FT                   /orf_name="MICPUN_56688"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62086.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A73E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z2"
FT                   /transl_table=1
FT                   /translation="MARGAGARLGAASPSARVAPPTSSSSSSSSSRQTSHRRVTTTRRH
FT                   APPRGASSASDAPIASWMESLADRLPPRFPDAPDTYWRGAGSPAGNPQVHGDDSILDLL
FT                   HASGAFHRPRLMVDEGGARQRVMLSLRTGTRTAGHPGWTHGGLTSLLMDETAGQAFAHF
FT                   VQPSRGLGVTANLTVDYASPLPTAKDLLVVAGVGKVDGRKVWIDVQVRDGPPRDDGGDD
FT                   EAEKHSCAGDDDDDGEVFARGSALFVVLAKD"
FT   CDS_pept        complement(<221452..222259)
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636121"
FT                   /orf_name="MICPUN_79584"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62087.1"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199A73F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z3"
FT                   /transl_table=1
FT                   /translation="MQGIGRRDPGSKPGEAVLSCSFNQDRSCLAVATRRGFKIYSCDTG
FT                   TCVYDDSMGAVRIVEMLFCTSLLVVVGAGDTPELSPRRLKVLNTSNHTCIADLTFVSSV
FT                   LAVRLNRARLVVVEERRAVVHDLSTLCVQRTIDTVPNPRGVCALSHDEDSSLLALPAHT
FT                   HAGAVVIHDCVNLHVVCELQCHNSPLAACALTRDGAMLATASAKGTVIRVHCLPHGTKL
FT                   WSFRRGVVNANVRSLCFGAESTMDEPDPGAKLLAASSEKGTVHVWRI"
FT   CDS_pept        222456..224612
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636122"
FT                   /orf_name="MICPUN_56690"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61642.1"
FT                   /db_xref="UniParc:UPI000199A740"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z4"
FT                   /transl_table=1
FT                   /translation="MVSGGEYQDVLVDALRGALGRDRPPRPPPVPDDVKSVGVQTPAAV
FT                   QNPGGLSGTDDGIPRGVCPACRRAPANWRACGECQRICADGGSSGGGDDDDDDVRPSRT
FT                   LASCLRRSKSRCLFRTWRRRVLSCAEERRDVEKATRHRSGVIFRTWREARRAVRVREHA
FT                   HAKASTFHRRRALKSKLAAWRVHARRVRHLTDLTRSRHQEKVVHGALNAYVRVRRLAPA
FT                   WRAWWRFHVTCDVARDRAEQLGEANVHNFFLVAAAFGKWRTSILHTRRARTERVAADVD
FT                   AKTAQLVERERALDELTGAIIREHVDRTDVELKRALRNEESVLEKLRLMELELRRKDVV
FT                   IEGREAQIATLTEDARAFEATLARRAVEASRAEREIIVAEHEREVAWLRAAVERAFEEC
FT                   VWYRKRYGAVDRDDDLHAFLVRIAGKDRAREMLPRGARLPWVESFAPERDQLATRLGGP
FT                   KQRRAGPVGSRVLGGVPRVPRHGRWGGAHPTHPVTAPWYPSSTLRAGGGSSVGGGSFPG
FT                   FGKGVGGSRAGLRASDRAWEAHRRGFVLASAASNARDFAASKLAIDVRGDATEHAAATP
FT                   RRSVEHEVQYTVEIPPSAAKTADSRPTPTRKSLLDEEESPDREKAWNDEARTSADDVSV
FT                   RSEREKAASVMSVAASMLDFDGEDDKDSASAAVCSDDSDDDLFAARVKPSVRVKPAIAA
FT                   AAKGGDDSDDDDDDWMFRGKGVKA"
FT   CDS_pept        join(224689..224971,225107..225282)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636123"
FT                   /orf_name="MICPUN_56691"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61643.1"
FT                   /db_xref="UniParc:UPI000199A741"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z5"
FT                   /transl_table=1
FT                   /translation="MSLTTARRALTRAVCPGTRASFSSSRVASAAATPAAKPKDGARQV
FT                   AEMTPEQIEELSVFQAVGGLTSAAIGGIVVFVIGAGATLGVASGISQVLGHTMNSKAPE
FT                   PPPPPTKDELRARLAEWRKRPRGPERDDAVRAIKDQLRELRRTEGSWW"
FT   CDS_pept        complement(225348..228875)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636124"
FT                   /orf_name="MICPUN_56692"
FT                   /product="Predicted protein"
FT                   /biological_process="retrograde transport, endosome to
FT                   Golgi"
FT                   /protein_id="ACO62088.1"
FT                   /db_xref="GO:0042147"
FT                   /db_xref="InterPro:IPR012501"
FT                   /db_xref="UniParc:UPI000199A742"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z6"
FT                   /transl_table=1
FT                   /translation="MRSSRRGGGRRADHPFPLVPRDPENLDRDPETLKRQTAYLACALN
FT                   DPTELNALHAAQTSATPDASEVLNSLGQYLGVPGFEREPSSGGARGLSAEERPPPLAKG
FT                   VLPEVARGDHDAYLRKVAGWGAFTAANADRRARDAEDEADGRRRNAFDADDDAEHSCAT
FT                   SGIPSSNGEENERRDATDRWTLQRSSDLDRHAHEDVPAMYFDDSFDLSDPAVFRRAFCP
FT                   DDDDDDLNDTAGESSRTAVRASTSSSHPTAVRRSRALFGLAAQTRLGSYLDKIETSLVL
FT                   AIGSRSESFFEASARLHELDAFVSETCETIERTRRTLLDASTYAARARESVASLHSKRA
FT                   NLAALADAFEQLATVRECREDLDVLRRAGDWGGSLEACEDVRRAIASPSLPPGLRLLED
FT                   VAHHADVTERDVVDALVCEFVRAARVQPGSVGYVQHGGERGDDGGGDSPGGDSPGGDSP
FT                   GGGGSWSPATTRAALAAVRAAARDAGMEGVEDEEEDEDEEDAYETDTGLGPGETSAADV
FT                   RESLLPPLMALTRGATDRVSGGRIADAMRAWGRTAAADARACVRAACIACIAAVQPGGE
FT                   YAVAEPGGRNASPESFSGGGRDGIIQRAIGALPPSVFAVVVRAVTVALAGHFARADIVR
FT                   SAVRSALGTAPRRGDDDVGRGQKTKNDDEKNASGTPTDECARAACAALPAGERAAASAA
FT                   ASDAVLALTDAAQGAVARAIASLTKGCTLAEFSNVCDAADDFLERAERLGGGRRCLALR
FT                   ATLAAQCKDLFAARHAAFAAKLGVVLEAETWTAATPVPPEFQRVLDDVVSFAAAGREGN
FT                   EESGDASVTTNGDASSCASADALMFPNTGERVVPVGASLALLKMLRDHVASAARFPSLA
FT                   PTAVHKTAELLRVFNARTAALVLGAGAMRTAGLRSITAKHLALATESVRLFSLVTPLLS
FT                   AALAPALPQSRRRGLLADFDATVKDLATHKRELHAKTVGIMRDRLAHHSSRLPTIWCSR
FT                   VFTGRSRKAGSSVGWRERTEEDESKGESKEDAEARGPSEFATALGKEIGTLRRVIAGTL
FT                   CARDASAVLDEVLAHFDECATGTLREARRSVAKEWMAKMGDDSGEGSGSGDGAGAEGVA
FT                   EGGAEGGAEGGDDAEIASKAPPSDEEVRALIALDGAALLECLGTLVKGGEGGDGAVGAP
FT                   TLTRFLSEL"
FT   CDS_pept        <229247..>230182
FT                   /codon_start=1
FT                   /gene_family="HOG000171086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636125"
FT                   /orf_name="MICPUN_68058"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61644.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG736998"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199A743"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z7"
FT                   /transl_table=1
FT                   /translation="IRDPEADGWERTDFPIVCEDCLGPNPYIRMQREDYAAECAISSRP
FT                   FTVFRWRPGNEARYKKTVVCREIALAKNVCQVCLLDLDYGIPVQARDAVLGKEREMIAK
FT                   SDVNLEYQTEQIARRLEEGDEVAIRDQNRAVGKVRAAELLQKMARKKPYYNKNKAPICT
FT                   FWLRNACTRADCPYRPCNGDTHMPELTSAPELRQQNIKDRYYGINDPVANRMLAKANES
FT                   KQDLAPPADESITTLYVGGIDDRVTEDALKDAFYQYGQISSVRTLYAKNCAFVTFVDRA
FT                   GAEKAAEECGSRKAISGINARIMWGKSKKEK"
FT   CDS_pept        complement(230582..231181)
FT                   /codon_start=1
FT                   /gene_family="HOG000100021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636126"
FT                   /orf_name="MICPUN_107872"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="ACO62089.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG559996"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="UniParc:UPI000199A744"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z8"
FT                   /transl_table=1
FT                   /translation="MGFMFAPRYHPAMKAVVPVRKALKVRTAFNMLGPMLNPAGTQYAL
FT                   VGVYTPDLQPLMADSLMALGMKKALVVCSTVGDLSLDEMTPCGPTSVVEVTPAGTKSYS
FT                   FDPKDVGIPPCELKDLAGGDAKLNARMLTDALGGEKGPVADCLMLNAGVAMAAAAQAES
FT                   VEEGVAMCKEAHAQGKAGDTLRSWIELSQELKLQEA"
FT   CDS_pept        232035..232694
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636127"
FT                   /orf_name="MICPUN_56695"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61645.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A745"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z9"
FT                   /transl_table=1
FT                   /translation="MSTIWRPDLLSGDHIVVKEESDDDHQPPAVDVEPPADDHEEDEKS
FT                   EDLAGKMSTIWRPNLSRLYASVAEMEGSESEEEEKDATKKGVKRKRAPPTKGPCEHGVK
FT                   PRSKCKVCSACPHGKWRRFCKECGGASICQHGRQRSKCKECGGGSICEHSRERSQCKEC
FT                   GGASICVHGRQRSQCKECGGASICEHGRRRSECTECGGASICEHGRRRYRCKECKK"
FT   CDS_pept        complement(232735..233526)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636128"
FT                   /orf_name="MICPUN_99299"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62090.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A746"
FT                   /db_xref="UniProtKB/TrEMBL:C1E100"
FT                   /transl_table=1
FT                   /translation="MHCAARAGHLDCVRALGADRERGCDVNARDDHWGTPLHAAVGEGH
FT                   VAIVDWLLANAGADVDAADRDMCTPLHESVRWADARVTAILLARGASPAKRTKRGLTPL
FT                   HVAVAGFGATSRASAAAASALSLHGFVGDGARSDSKRILRLRRGGQVEDGDWYDLRADQ
FT                   ARRDDIVDALLASGACDVDARCFEGGSTPLYLAARWGHAEWVKKLIDAGADVDAARERP
FT                   DPGLGGSVVGPGGPTPLQAARAVGHSECVAVLLEHGAAEAA"
FT   CDS_pept        join(234773..235213,235374..236045)
FT                   /codon_start=1
FT                   /gene_family="HOG000208823" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636129"
FT                   /orf_name="MICPUN_56697"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61646.1"
FT                   /db_xref="HOGENOM:HBG315851"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A747"
FT                   /db_xref="UniProtKB/TrEMBL:C1E101"
FT                   /transl_table=1
FT                   /translation="MSFGTPGAFGGGGGFGQPAQSPPGAFGAPSPTQPTQVPNPNNDFQ
FT                   VANPPNDGISSLSWSPVANFLVATAWDGDVYCYEVGNNGQAVPKASQKHQGPVLCSDWS
FT                   HDGSAVFSGGCDNKAQKWDLATNTPTQVAQHDAPIKELCWIKEVNLLATGSWDKTLRYW
FT                   DTRQPTPALQVQLPERCYALSCSHPLLVVGTAERHIQVYDLNNPNQPFKQLQSPLKYQT
FT                   RTVAAFPDKSGYLVGSIEGRVAVQHVEDAQQSKNFTFKCHREQSDIYAVNDIKFHPTHG
FT                   TFVTAGADGVFNFWDKDSKQRLKQMAKCNSTIPCGAFNRDGSIYAYAVSYDWSKGGQDP
FT                   MAQSGQNNIFLHAVQESEVKPRPAAVRGRR"
FT   CDS_pept        complement(236336..238801)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636130"
FT                   /orf_name="MICPUN_56698"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62091.1"
FT                   /db_xref="UniParc:UPI000199A7B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E102"
FT                   /transl_table=1
FT                   /translation="MATCLEPGRAAWRGPVNARGALRGDSTGRPRRAPRPAGTPGTSGE
FT                   RSRSRGARLVNRARADEDGRDAAAAAARLAPLEASTAAGSELERILKTDPVAFERALSD
FT                   QVGSRPPAPPPLLPQSLLSEFTLFFWPTRLGFWPAAARRRGRWDARTRPERAGEGYECG
FT                   CFGASSEGAGGGPRAESPRARSPLASRREEKAQRPLFSRFSARANNASSHERFTRMLTE
FT                   SIPPPIVFPRSQLRAMASDVFHPSFPGGRSGSLRDRVGGSFGAQPSSLQPGHSCDLREK
FT                   PGAGDGFPSTEYLQLEGVISSKGASSGAAEGGAEGGADASMSRLDKSSKGAKNGHPKEP
FT                   CEDERNPSSRPNADKAERVILSELADAVAFGAKVDRANELRDAMYLSVVARHCALGVPL
FT                   VPEVEAFQGSRGSSRGSALFGGSVSGRGVGGGGGRRTGAHDRKVSRLVRECLPTGADEL
FT                   IERHIDRIISDVEAFGLSDGALAGAYRKSALFGYFLRCAATRLALEHSFQATPTRDERL
FT                   PGDDEEHARHLREDGYELVSNISSLPAYPSSIGDWIAEDGDDVDDEQRVDPAVSEARAR
FT                   RRREAEATFRAQATRAKAEATSRTARSDITESTSPRTAGSDEFDADSPEAELERARERR
FT                   RERQWRRALGGAYPDRPLAAFPSSIGDWIASSSSADDDAEYDEPFYEKPIFDAVEDADA
FT                   APNLRAFVDAMEPTLRAQLATIGQADVAAVLDSHVAALFYGDVEAAPRDVRGATAGGDG
FT                   VEAEVVSFDFAGLAGLSKGLMPLDGLRYMVVEACAFGASLWSAERRCERYDLTRRSVDG
FT                   AKDQSESRR"
FT   CDS_pept        join(239434..239751,239877..240353)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636131"
FT                   /orf_name="MICPUN_56699"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO61647.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG611525"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199A7B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E103"
FT                   /transl_table=1
FT                   /translation="MSVVAASTFAPFSARVRSAIPARSRRASPSSTRRPVATARAEAEA
FT                   EAGGEGSTLSTTPRTAGRRAGLAAGAGLALAAAAFPARAIGGAAVGLPDVVELTPDNFA
FT                   KQVEVPGTTFVEFYAPWCPFCQRLEPIWNELPNRLKEKGVDTKIARMNVDTYVDYGERF
FT                   GVTGFPTLMLFKDGRPVGQKTGLTDMNTLMKYAGYKESGPLAALAGAGAEMNLVLSGEQ
FT                   VQSAADELNELRRMINGEVDGDKASALAHIDAVERLFAKRAL"
FT   CDS_pept        join(complement(242376..242924),complement(240933..242246),
FT                   complement(240489..240821))
FT                   /codon_start=1
FT                   /gene_family="HOG000201059" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636132"
FT                   /orf_name="MICPUN_80244"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="DNA repair"
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62092.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000199A7B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E104"
FT                   /transl_table=1
FT                   /translation="MLSAVARRASRAAASASSSLGASRVPRRAARDEAARHAIVLTADA
FT                   RRGFASASAHRPTDFDVVVIGGGHAGAEAAAAAARRGARVALVTPSPLGSVGEMSCNPS
FT                   IGGLAKGALVREIDALGGIMGAAADASGIQFRVLNASKGPAVRGPRAQMDRTTYKRSVQ
FT                   AMLFGTPNVEVVDAAAYDLITCAVAGVETADGRKITAEAVVVATGTFLRGVLHVGGRRI
FT                   PAGRMPTAITENPDATAARGAHALADRLYGLGFQMGRLKTGTPPRLDGASIDYSGLEEQ
FT                   RGDEPPRPFGFLHDKAWVPPMKQVSCWATRTNAETERVMKESRGFLNFEGGENGEAIGP
FT                   RYCPSLEMKVKRFPGRSHIVWLEPEGLDTDVVYPNGLSNTLDEPDQIAMLRTVAGLENV
FT                   KMLRPGYGVEYDYVDPRELRWTLETKRVGGLFFAGQINGTTGYEEAAAQGLVAGANAAA
FT                   TALSRLGMDALPPSIVGRGASYLGVLVDDLTRRGTSEPYRMFSSRVEHRLSVRPDNADQ
FT                   RLTAAGELAGLVDSARALIARRRGDATDRAIAALEDARMGAQAWAAHGVDNAPAGKSGR
FT                   TVSAAELLAIPGVGYARVTSALAEAGKTTGESTASGGIDDSRADSATVECYYAPYLARQ
FT                   RRDVETMRKEEAMELPMDLDYDAVGGLSAEDREKLKEFRPATLAAAQRISGVTPSAAIA
FT                   LFRFVAAQKLKGNNKRFSGRRGAVTNGGRDPLMESAL"
FT   CDS_pept        243095..244198
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636133"
FT                   /orf_name="MICPUN_52141"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61648.1"
FT                   /db_xref="UniParc:UPI000199A7B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E105"
FT                   /transl_table=1
FT                   /translation="MLHSWEKIPRSHTSDPEEVCQLSSPTCHLFEIKFGEVDQIAQSSR
FT                   ALPHPRSAMSLVFASALARPTPAPVAGSRRIAPGAAGKPPRPSASPVVAFAKKKGKGGS
FT                   RDGYDDWDDGFGSGSGNYDANFNSIDDDFYTGAGGDYDSFGSKSGAAKPESGKKKGAAK
FT                   RAKKAKGSDVDDGYAPVAGDVSRLIRSKAPAKPESGAIGSSLDSGDGPNFVRPLDGWKK
FT                   KGEASSYGDVFENSAAFSMDDGDLDFGAEPLAAEPIDAPRVVTVAKAVPKKEKREEAKE
FT                   AKAVDPADPGKGEKKASQTLKKWGFAQSNIDDALGATEEAAATAVGEGQTAYNKRRQVL
FT                   ALDWLLLNAPEDAIPMDYRNDAIKARS"
FT   CDS_pept        join(complement(245282..245479),complement(244436..245044))
FT                   /codon_start=1
FT                   /gene_family="HOG000259347" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636469"
FT                   /gene_name="RPE"
FT                   /orf_name="MICPUN_104768"
FT                   /product="Ribulose-phosphate 3-epimerase "
FT                   /EC_number="5.1.3.1"
FT                   /function="ribulose-phosphate 3-epimerase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO62093.1"
FT                   /db_xref="GO:0004750"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG571751"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199A7B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E106"
FT                   /transl_table=1
FT                   /translation="MSAVTNSAVFARKSLAGKAIANKRVATKARAAFNVSANAKVDACD
FT                   KNSVIVSPSILSANFATLGAEVKAVDEAGAEWIHIDVMDGRFVPNITIGPLVVDALRPV
FT                   TDKVLDTHLMIVEPELRVADFAKAGSDIISVHAEGASTIHLHRTINQIKDLGCKAGVVL
FT                   NPGTHPDCLEYILDCVDLILVMSVNPGFGGQSFIESQVDKIKKIKAMCDAKGVNPWIEV
FT                   DGGVSPANAYKVIDAGANALVAGSAVFNSDDYAKAIAGIKASKAPK"
FT   CDS_pept        join(245771..246097,246346..246711)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636470"
FT                   /orf_name="MICPUN_56703"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO61649.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniParc:UPI000199A7B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E107"
FT                   /transl_table=1
FT                   /translation="MAAFTVSMSALVGAPVKVRRIARARAQFVPSSVVGTSPAPQGFHG
FT                   RSGEKASGERRAETTRRENRERSTRARHATGARARSSLAILAARESGEAARRSQTARAA
FT                   RDVIAARAVVARKAVQQRGARLIVRAEGEEAKADSFAGLKPTKAADFKSMSNDELNAQI
FT                   VEAKKMLFELRMKQSTRKEYKGHHFGILKTKIAQIRTVKREREVTEGVNKRDSRKIKRE
FT                   ERAANIYL"
FT   CDS_pept        complement(246949..248274)
FT                   /codon_start=1
FT                   /gene_family="HOG000006282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636471"
FT                   /orf_name="MICPUN_56704"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62094.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG664087"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniParc:UPI000199A7B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E108"
FT                   /transl_table=1
FT                   /translation="MAPLRASSIVRRGLPDARDDEALIATPVVEVDEATPREDDVDEWF
FT                   PPFAASAPKLGLAGLGAGLLNTGFELDGPASTIEAIVVLATIIFVHECGHFFAARLQNI
FT                   HVSKFSVGFGPNLLSYKGPEVEYSLRWVPLGGFVAFPDDDPDCPYPQDDPDLLRNRPIK
FT                   DRAIVISAGVAANVAFALAILNFQVNTVGLVEQAYKPGVKVAQLLSTSAAREYGVKVGD
FT                   VITAIDGEALPAAGKSVNDVVAKVKAAGSNPVRLKIQRFGTNGPAPPVDIEVVPKTGVN
FT                   GEGRIGVQLEANAEVRKRVAGNPAEGLFLATKEFARLTGLVCKSLFSLVSNFSQAKDNV
FT                   SGPIAIVGVGAEVMRGSDLSGLYQFASVININLAVVNILPLPALDGGFLLLIAVEALRG
FT                   GKKLPAEVEQSITASGVLLLLGSGMFLILRDTLNLVGSLGQH"
FT   CDS_pept        249135..>249962
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636472"
FT                   /orf_name="MICPUN_79493"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61650.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020655"
FT                   /db_xref="UniParc:UPI000199A7B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E109"
FT                   /transl_table=1
FT                   /translation="MEVDPPPAAPASAEPGSPPAVNPAPVAPRRIGHWQVDKQIGRGSF
FT                   AVVWRARHAETGQRVAVKEIRLDKLNRKLRESLESEIQVLQRSRHGNIIRLHDIIKEEK
FT                   RIFLVLEYCAGGDVSEFIKKHGRVREDVARHFMRQMASGLRAMRAQNLIHRDLKPQNLL
FT                   LTVASPDAELKIADFGFARYMHPTGMAETLCGSPLYMAPEILGYQKYDAKADLWSVGTI
FT                   LYELLVGRPPFTGMNPMQLLRNIERSDAKIPSKVANGLSRECVSILRGLLRRNP"
FT   CDS_pept        250416..252305
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636473"
FT                   /orf_name="MICPUN_52144"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61651.1"
FT                   /db_xref="UniParc:UPI000199A7BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E110"
FT                   /transl_table=1
FT                   /translation="MGVRDVAAAAAAAGTNWLSTSPLSRRPGFLGGTSPGGGRPLGGSG
FT                   SHQKPPLSSSPSVARAASFGGFTPGGDGVSVEIQPVPFSLQGSKARSGSDRSLNSMDAE
FT                   YVLVEDDKSGGDKSGGLASMESSPGGSLPSGGGGGGGGLTQMAAGLTRRLSSNLGAVIL
FT                   GSSPPPSKFGNNHHHVTSSSSSPGRELYRMSSSPGGTGLGSGGSPGSFPPRPGSSRHSP
FT                   PGMLGEFRNSPSYPSSRVSSARSGGGGGSGLALGAGASLAPSQSPSEKEAAAALALARV
FT                   AQAAAAAAPGEKRFASAAQRVSVLERAATVLRDVAMERWDSGKKLDALSVSLVSLTALR
FT                   EGYKLAQAVAKEAAEAEACSNAPQGVGPLDGSRNVRLSDMSDSSRSSGGGGGGDCASRP
FT                   ASASSSSSGSPPWIPGRSSSSSQSGTIGSSAELPRLSSKTPERLRKDRERAVKTAERIK
FT                   NAFNAALTRADRAAAAVKGVGVEGSAVLPDAMDLAYDAALALGRSGAVEELMGNTRTAL
FT                   EAYSRAQTLLVFILSEGPRFVTARDEQSGDERAATDAERETAAALVSAPGRAAGDGVET
FT                   GDGSRLITPSVHPCDEFPARGRIARFVGAIGARQQACAATAMRSSSGATRRPP"
FT   CDS_pept        complement(252548..254692)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636474"
FT                   /orf_name="MICPUN_56706"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62095.1"
FT                   /db_xref="UniParc:UPI000199A7BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E111"
FT                   /transl_table=1
FT                   /translation="MASSDWESTHLVVGAPEGVVELARDLTPLCDILKPDSEVGKVDLI
FT                   RAKATRLIRVCMRTRIGRECLLRRGGLVPSLLAALAPVAKYEDAGADAGADAGADAGAE
FT                   GEEGDGVGPKDPVLEHAMVCGDLLVKLACASTQTALELVEEHGVVETFHALLRRHDADS
FT                   RACGAVGLRKFAKFSERAAREMVWRGVMDDVRAMLPTCDRYRTPPTTPLAMEKDNILAD
FT                   AFGVGAGDEARAKKVDLEALLSSRKRSSKKDETDETEGGGVVYDGPAVPNMGKPPPPPP
FT                   PFVPKANTPRVVAEVMELLGALLCHSFVADQFIGRVGGDVNKRGLLPSGKHRPTWTTTI
FT                   THQCAPAATYAPPPPPPPPPVMVRKLDEEGNPVQATDEEGVPIVDDEGEPVYEMVEEKP
FT                   KTEETEGVEEPEPEPEPEPEPEPEPLAVSEPEPVAKAEVEHDDMLEEYQPVLIEGDAPC
FT                   DDFLACSASLRCLEHAARHPRCRAELLEDDGAHCKRLAAIVRCNMPHCAEPALRILLGI
FT                   MSWAKHEGPNATGPNSFKDLREAQGRVRGGQGGALAAVKAAKAAREAEERETKGGARAY
FT                   DILRCEEVRGAVMSADLGPEDSVMHRSLRSAASHALAGYELTAILPPPPPPAPVPGMEV
FT                   TARAPLPNHKTTPLLETIEKQTLGREIAERDEMREPFFDQVLTIKERLALRYRQTRGHR
FT                   TSRSGSVKDPNELEEVVTEA"
FT   CDS_pept        254745..255992
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636475"
FT                   /orf_name="MICPUN_56707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61652.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A7BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E112"
FT                   /transl_table=1
FT                   /translation="MRLVASGFGAPASSAAATSSSVGSTTLSNGCSWRHTASTQARHPT
FT                   RCRRISPCLVASAWIARRPARRAASSASASRSFTRLSTTSVSASTSASFLKRRGGASRP
FT                   GRGVRMAFGRVDAGSTRLVPNRDRRLLLGMRAIASSGADVPGIRREFPQLRGGVRASRV
FT                   VGRVAKLLGDRRDEVGTIPILRALPRHGASRVWGAAVRIGLSVIVRHARVEKTEMRGTR
FT                   VIRARGAMGRGGHSDDEGTPYDQRLEEVEFMRSACVAAQRGDVDKLRAMLHRRPDVMLD
FT                   DGVGGDSGYTPLHYAAREGHAECVRALLASGANANARTRAGGATPLHRAAFTGSGACVM
FT                   LLLEGGADPCLRDADGESALHKASANGHADVVRALLRAGGERGIAGERDRKGMTPVERA
FT                   ADEATRAAFGDRVGNC"
FT   CDS_pept        256081..257505
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636476"
FT                   /orf_name="MICPUN_56708"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO61653.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199A7BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E113"
FT                   /transl_table=1
FT                   /translation="MPKTPASYETKDLKKLKVADLRAILESKGLDATGKKDELIEKVQA
FT                   SNDAPEPAPEPEPEPEPEPEPEPAPEKSPPAKKPAAKEKPAAKETPAAEEDDDDEPRRA
FT                   NDFFFSTAGADDDDDDDDDEKDEDPAPEPEAPVDRDDDRPATDTRDADDDADDDDDDDT
FT                   AGDEIYLGFLGENCNREFIANLLRPFFECERVHLPMQSAPGGGPKRPKGYAFVRPPRGT
FT                   PDSALAAAVEKLNGSASYPGAKHPLKIAMATRKTNDDDDARGTKRRRDGSGSGGVPQGK
FT                   SPNRLYVLGLPRHVTEVLLKEFFSRFGAVTDARVLASRDGEDDVGPRRGTVTFASADDA
FT                   ARARAETDNTRAFHGGGELKVVYSNLRDGEGGRRGGGGGGGGGGVGGGGASAQPWSVYP
FT                   MQPGMPMYTPMAAVALDPATGQPFAPTGVAAGAGLADHPAAVPPTGLSEAGYTGVHLAG
FT                   LPPSATVDAKYAHLYQ"
FT   CDS_pept        complement(257608..258612)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636477"
FT                   /orf_name="MICPUN_56709"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62096.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A7BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E114"
FT                   /transl_table=1
FT                   /translation="MATKTTIWRPNVRVSLDEYGEVEDTESGGEEVAKQGTKRKRAPPT
FT                   KGPCEHGVKPRSRCKVCSACPHGKWRKQCKECGGASICEHGRIRSVCKECGGASICEHG
FT                   RQRSQCKECGGSEICEHGRHRSKCKECGGSQICEHGRQRHRCKECGGSSICEHGRHRPQ
FT                   CKECGGASICEHGRHRYSCKECGGASICEHGRHRSKCKECGGSQICEHGRQRSRCKECG
FT                   GGSICEHGRERSLCKECGGSQICEHGRRRSRCKECGGGSICEHGRIRSQCKECGGASIC
FT                   EHGRQRSQCKECGGSQICEHGRRRSQCKECGGGSICEHGRIRSQCKDCRCERL"
FT   CDS_pept        258710..259990
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636478"
FT                   /orf_name="MICPUN_56710"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61654.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560005"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199A81D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E115"
FT                   /transl_table=1
FT                   /translation="MSREGEAPDPPGPLPATPALCRHWARRGRCDYGDGCRFRHERVPG
FT                   DDADADDPRVSAMDGRREGATRFGRRHHARNRNKAGDFRRWLVATFGFETLASGAGVLD
FT                   VAGGKGELAFELRNLSGIPVTVVDPRPMRLERYVRRFRSGMYHRNQSPAAAKLRRPLDS
FT                   TLAAPDHLRMFLHRGVFDPARSDGERRLAAIESHRLSHATRWSRRGLVDGESAPGDGDG
FT                   DGESAPGDGVRDGANLDEAYRIPGEPVRHATMFSEIPRRRDPDADDVESDVYADVEADV
FT                   EADVDDPDAAAMTPVAMDASATADACERVFRDCSVVVGLHPDQATDAAVDLALAFGKPF
FT                   AVVPCCTYSRDFPHRRLPPGPGRPRGGGAVTTHAHLVEYLLAKAAPGTTIERDELPFEG
FT                   KNVVVYSLGDGGSELLCRAVDGLGVGE"
FT   CDS_pept        complement(260485..261324)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636479"
FT                   /orf_name="MICPUN_99310"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62097.1"
FT                   /db_xref="UniParc:UPI000199A81E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E116"
FT                   /transl_table=1
FT                   /translation="MASSDDDVTRPPEEGLTVSASIGPRFGNAGVWREAVANSYYAARA
FT                   DEDEISLRVAEADREARESARWREECEKERRAIAERIKARHGAYPPKPAPATPAEMDAR
FT                   RASKKAEIMRLSKRDEENKMLRARILPPHQYDGEFPEEMRKHGRVLEHGGVYADTALWR
FT                   RHEAEWEEFMETARGMSIIRKRQIPFPEAGGAALYRHLILKSIHEFNLSEEDAEKFAFR
FT                   RCAMRWHPDKVMTAVGIRLLPEEYDEVGAKCVEVFREVQEEHKNRLRLRGTLPSGCD"
FT   CDS_pept        263002..263742
FT                   /codon_start=1
FT                   /gene_family="HOG000200133" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636480"
FT                   /orf_name="MICPUN_107875"
FT                   /product="Predicted protein"
FT                   /function="magnesium ion binding"
FT                   /function="phosphatase activity"
FT                   /biological_process="nucleotide metabolic process "
FT                   /protein_id="ACO61655.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0009117"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="UniParc:UPI000199A81F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E117"
FT                   /transl_table=1
FT                   /translation="MIDKIIQLMEIGVHVAIVTAAGYPGDSKKFEGRLRGLLDSFKENE
FT                   LTAETRKRFSVMGGECNYLLEVNEEFELEFVDPAVWRDQPSTKNLYWYAQGEAKTKVEA
FT                   FLDRAEQFLKDEAEHLELDYEVMRKEFAVGILPQSSTVYENLEEISIGAMIELSDAEVP
FT                   YCAFNGGNDVFVDVGNKNIGLQTLMNYLGFEGHQTLHVGDRFTSTGNDSRVRDACSILW
FT                   VASPDETTFFMRLLYRDIVNARVL"
FT   CDS_pept        join(complement(265668..266273),c
FT                   omplement(<264888..265283))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636481"
FT                   /orf_name="MICPUN_79876"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62098.1"
FT                   /db_xref="HOGENOM:HBG609687"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI000199A820"
FT                   /db_xref="UniProtKB/TrEMBL:C1E118"
FT                   /transl_table=1
FT                   /translation="MDVTGGPKSTGYAGATKAKAKSDGKDSLRKLFKLPDDEVLIEEYL
FT                   CALYKKILLQGRMYLFRNYVCFYSNVFGYQKNKVIPLKDVTIVRRAYTVKVVPNAIEIV
FT                   CNGKCEFFTSFIFPDRAYRNITNAWKECSQYAKIFAAADVDNSKVAAEMLVVPKFSSPP
FT                   SAEVAAMLGLRDGGDGGDDDDAGSKGSGPRSSGSDGPRSDDDVDDDVDDDVDVANEDDF
FT                   GERLVATSTPVPPRPSDMRTLEECVLECAVEDVFSLVWSDSAAGAFGAEDHASRGETAV
FT                   QTTKWSRHRHHGHARDLTFIAPVNASIGPKQTNCHQTQSYHACRGGALVVDTS"
FT   CDS_pept        <267775..>268128
FT                   /codon_start=1
FT                   /gene_family="HOG000035674" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636482"
FT                   /orf_name="MICPUN_73414"
FT                   /product="Predicted protein"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61656.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG609689"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniParc:UPI000199A821"
FT                   /db_xref="UniProtKB/TrEMBL:C1E119"
FT                   /transl_table=1
FT                   /translation="ALLESWPDFRAATDRSNRQVLAPLTRGDLVTVSALPAVAEEALFR
FT                   GCVVPALGGGPLGVIVSGMTFGALHVGGGRNAAFAAWASAVGCLYGACAVGCGDVSVAI
FT                   AAHAMANYASATMW"
FT   CDS_pept        complement(268216..268902)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636483"
FT                   /gene_name="HPF_1"
FT                   /orf_name="MICPUN_99313"
FT                   /product="Cysteine-rich protein with zinc finger "
FT                   /protein_id="ACO62099.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A822"
FT                   /db_xref="UniProtKB/TrEMBL:C1E120"
FT                   /transl_table=1
FT                   /translation="MEGSESEEEEKHATKKGVKRKRAPPTKGPCEHGVKYRSNCKVCSA
FT                   CPHGKRRCHCKECGGASICEHGRIRSTCKECGGATICEHGRRRSQCKECGGSQICEHGR
FT                   HRPQCKECGGSQICEHGRRRTECKECGGGSICEHDRVRSQCKECGGSQICEHGRQRSKC
FT                   KECGGSQICEHGRRRTECKECGGGSICEHDRVRSQCKECGGGSICEHDRVRSKCKECRA
FT                   AKARTG"
FT   CDS_pept        269255..272497
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636484"
FT                   /orf_name="MICPUN_99314"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61657.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199A823"
FT                   /db_xref="UniProtKB/TrEMBL:C1E121"
FT                   /transl_table=1
FT                   /translation="MPRSVGLDASSREALLDLIYRLSREDKDGGDEGGGDARAARGRGS
FT                   GSVEGADEDDADADPTRVRKDRVKEARRAEKERERKEKVLAKALKKDRRASAAEGANSR
FT                   DDGDAKGWASSPHPPGSEVNVSVTSAQGGGETKVMKIKRAADLKDFLSAAKSKLKLKKK
FT                   PLSARLVPSGREIRDTLRLEPMATVSVSADPPTERARERDDDDEDEKSAPGTGDGDIGD
FT                   GDTGDDPTERLREAVASRLRNAERDVDRSRLPPGGSDDATADESTRLLSLLSIDRSERT
FT                   ANATSRQALPAAAVRAEIIAACVDSDSRVSVVTGDTGSGKTTQAPQFVLEHFVAAGEGA
FT                   RCGIVVCQPRRVAAVSIARRVAEERGERVGDVVGYRVRGESRTSNRTRLTFCTTGVLLQ
FT                   RLRWDPTLEGITHVFVDEAHERTADADFLLILLRRLLRSGAAPGLRVTLMSATVDAGRF
FT                   IDYFAGEPGEPTPRSTHIPGRTFPVDEVFVEEYLPSRRRDRGGGEKNGRNGRNGDGHEI
FT                   DYDLLRAAVDKASRDVQRHGQKPLGAVLVFLPGVPEISRAEQAVSDVRDVRVFPLHGQL
FT                   APEDQRAAFAPAPPNKVKVVLATNAAETSVTIPDVTVVIDTGRVKRMTFESRTQLASLT
FT                   EGWCSLASAAQRRGRAGRVRAGVCVRLYERWAAGKSPMADHDEPEMRTAPLDTLVMRAL
FT                   AIAPGEHPAAVLGEALDPPDADAVRAAVERLRAIGAVVVDPRRGNGPGDSPGVSTTPLG
FT                   FHLSLLPVEPRVGKMLVMGCVMGCLSPVLTAAAAMSCRPMFTARGGDRADASAAKRRAS
FT                   RGSRSDHLACVNAFDEWMGSSNRRRTCADLNLSHAAMQDVARTRTQLRKRLEEAGFSPG
FT                   APAANAQTDNDDFVRCVLVAGLFPNVARVGVGPSGRTRVLNNRGVEVAVHPSGVNAAFH
FT                   RDDVDGDDGATRQGRGRRTFSGGGPETGLLVYQEEVTTSKTFIRDTTAVPDASVLLFGG
FT                   ELCVDHASASVSVSTGRSSAVGGGTASRFTFRAPPETGVLFKLLRKELTAVLASAVGDP
FT                   SGNHGTLEGSARGRRVREVLETLFPGSGVSAR"
FT   CDS_pept        272672..273619
FT                   /codon_start=1
FT                   /gene_family="HOG000046604" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636485"
FT                   /orf_name="MICPUN_107876"
FT                   /product="Predicted protein"
FT                   /function="sulfotransferase activity"
FT                   /protein_id="ACO61658.1"
FT                   /db_xref="GO:0008146"
FT                   /db_xref="HOGENOM:HBG569189"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="UniParc:UPI000199A824"
FT                   /db_xref="UniProtKB/TrEMBL:C1E122"
FT                   /transl_table=1
FT                   /translation="MAGWTKTKTYDSHHFDSGAWDVVKPRDDDIVIATAYKAGTTWMQQ
FT                   IVAQILFNGEPPAAVGELSPWVDLRVPPREVKEGMVEAIPGRRFLKTHLPTDALDYNPS
FT                   QKYIYVARDGRDAFMSLMNHYKFGNEMWYGALNESPGLVGAKLPAWEEACEGKEGDEAI
FT                   RAVFDKWLNTPWGEHPWEKDGWPFWSLFYNMKTWWDAKDLPNVLMVHFTDLKKDLAGQM
FT                   RRIADFIGVPVDEAKFDAQVHACTFEAMKGNAAAVAPLGGAMWKGGADTFINKGTNGRW
FT                   VGVLTDEQVAAYEKAAQERLGGECAKWLAAGGDI"
FT   CDS_pept        275057..275593
FT                   /codon_start=1
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636486"
FT                   /orf_name="MICPUN_93648"
FT                   /product="Predicted protein"
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="ACO61659.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI000199A825"
FT                   /db_xref="UniProtKB/TrEMBL:C1E123"
FT                   /transl_table=1
FT                   /translation="MSSLAKTRLQTERKGWRKDHPHGFVAKPRTARDGSVDLLNWDCKI
FT                   PGKAGTLWEKGLYPIRLEFTEDYPSKPPKVSFPAGFFHPNVYPSGKVCLSILNEDKGWK
FT                   PSITVKQILVGVQELLDNPNNADAAQEAAYKLFKKSGAEYAKRVRIEAAKYTEAPAGFV
FT                   AGGGATGAEDDVIVL"
FT   CDS_pept        285066..287648
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636487"
FT                   /orf_name="MICPUN_56720"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61660.1"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniParc:UPI000199A826"
FT                   /db_xref="UniProtKB/TrEMBL:C1E124"
FT                   /transl_table=1
FT                   /translation="MRLLDLLPNDSWLASKSSGSSSFALLRRPDDRPVPSVSVADMRAH
FT                   IAFLRAVHVHSTRDESSSLYVDGPPLRAAVGDYLAWLAEVSLGPSASPGPCPGEMLVTR
FT                   APTLPVAWCWHVHRLDPHAYVRDCASLVGAVPYPVPGVGFASDEDQVASPQRRIDPPDP
FT                   VSSSSHLADILVAAIGRHAPFLWQVSGAAYNDDAFLLSAASRYEEFVAMTVRARGASLA
FT                   PPLDIDLAWHTHMLRDSEYLRESARMRGVELGAMAHDNGEGMGAHGDTSRLEAPWAKTL
FT                   AAFRETVDVSETDGATAMKSAFEAAVPRGARHRGYAPAWWFARGESVVVVDDFLSPEEC
FT                   EAIVSQMPGPESAMNCPSGKKAQMYVDGDASVEARIRAAVSVGLGFEGEPEASKSSLVL
FT                   EDIVNRETGIGGTRSDQFDPHRSLTVERTTPTVKLPARVSVGTMHPHRDRLAIYTLEGE
FT                   TMFEDDTLTADGYTCVVYLKADGGTLVLEPDECPGSGDASWTPPGAKLTRREIDVRPGR
FT                   LVAWPNHAFKHCAGRRDVVEGEDAVAESRWLLGPFHFTPGRARLPQVGDCGSAGSYDTG
FT                   PSKPPPPPFELADIWPDHKVEWDFTPPEPLKMHRSGEAFQQKLRADLNRFAGTYKAVFE
FT                   KGEISLGDEPFKFFGLLSYQPLNLCLLPFMFIPFIGCTTVNVSPTYLESYTITLRPIGL
FT                   HTPQRNYEEDVMYGNQKSCYFGKCHGSYSEVRRRAGPMHVTGVGEAKDDKYKSVVRLTL
FT                   VEANENELRYRRKGKDATAVFDAEGSRAASLARTYPEDPEHKGIFQEWLEENKKRPFWS
FT                   DLSICEDSAPPDKRILDIDGEMVVRDGEIVLTESVDGREPFTITLKKQ"
FT   CDS_pept        join(complement(291680..291796),complement(287793..291455))
FT                   /codon_start=1
FT                   /gene_family="HOG000184777" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636488"
FT                   /orf_name="MICPUN_56721"
FT                   /product="Condensin complex component "
FT                   /function="ATP binding"
FT                   /biological_process="chromosome organization"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO62100.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0051276"
FT                   /db_xref="HOGENOM:HBG315927"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="UniParc:UPI000199A827"
FT                   /db_xref="UniProtKB/TrEMBL:C1E125"
FT                   /transl_table=1
FT                   /translation="MTAPSSDAGVKKPRLVIKKMVLENFKSYAGAQHVGPFHKSFSSVV
FT                   GPNGSGKSNVIDAMLFVFGKRAKQLRLNKVSELIHNSTDFRNLEYARVEVHFHQIVDKE
FT                   GEDFEAVPDSDFVIAREAYRNNTSKYFVDKKTSNFTDVTNLLKHHGVDLNNNRFLILQG
FT                   EVEQISMMKPKAANPGDEGLLEYLEDIIGTNQYVEPIEQKSKALEELNEKRTGQVNRLK
FT                   LVEKEKDVLDDARQEAEAFMAKERECLRHKTVAYQMYVKDARDNVAKIAESVAELEAKL
FT                   EEEKAKSTEYDKAVEELEVVVKEHAVKLNELKGELDRATKEFAEFERKDIKHREDLKNM
FT                   KSRAKKLDEKVAKDTKKRDDMAKECEAIEKEVPELEAKKAELESRVEKEEATLDAMLES
FT                   LKGEMAAIGAELERAQAALSPWEGKIADAKAAVDVAVTERDLLATEKEDAKRRFEEAKA
FT                   GAEAAVALAKSKTEEIADAESTLESERSRAAERREAEAAAKEQERRANEMTREIRGKLA
FT                   QSKSAADQAKSQSVIVQSLMTAKSKGKIKGVLGRLGDLGAIDKKYDVAVSTACAALDYI
FT                   VVETTADAQACVAHLRSNNLGVATFLILEKQRSLEGKMREAKKTSAPASGAPRLIDLIK
FT                   PAEPRLEVAFYYGVRDTAVADDLDAASKIAYGGNVRRRVVTLQGQLIETSGTMSGGGSK
FT                   PRGGRMRTGTAAPDLDGEGAESAAAVAQAEADLKKASVTYEEAHKAAVSAGKEAKDAEA
FT                   AVAKLERSLPKLRAEVIAAEERAADLEGRLGELEAAAKVTKEDAAELKRLEKAVADAKA
FT                   LYEKVVADAAGVRAECEALQAKMDAVGGEKLKKQKALVKDLAAGIAAAGDAATEKRATA
FT                   ASHAKATARLEKAIEEAVAERAKLSEDVKTIKAEFAALEEGAMAVLESQKELQGLVDAK
FT                   SAECAAASKARDAAVKEMAALKHVEVDIQSKLEDLDAQSKENDDKAKHWDKELNKLRKE
FT                   QESLHAECEVPVPELLTPEQLDTVDAADEMRRAGALEEELKEMKPDMSSIEAYRVKMGE
FT                   YDERNDELKSVTEQRDETRAQFDELRKKRLDEFMAGFNVISLRLKEMYQMITLGGDAEL
FT                   ELVDSMDPFAEGIVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDE
FT                   IDAALDFKNVSIVGHYIKERTKDAQFVIISLRNNMFELADRLVGIYKTNNTTKTVAINP
FT                   GAFAVGADNGSAKKAADASAAGDEENRAPNAIAA"
FT   CDS_pept        join(complement(293761..294679),complement(292157..293694))
FT                   /codon_start=1
FT                   /gene_family="HOG000223225" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636489"
FT                   /orf_name="MICPUN_79795"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO62101.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199A828"
FT                   /db_xref="UniProtKB/TrEMBL:C1E126"
FT                   /transl_table=1
FT                   /translation="MNRDLQRLYASTPAPEANDANGGEEKAAFAPPHVVAAAAQRALAA
FT                   EGKAGGGAPSGGSGAHPAAPASRREESADAAAATHVAAIALARARRLQEAERGNRRNRR
FT                   DNRRVNNKKNRRNKSEFGDDFLEDYLPGGSKYKPGGVGNGPGDPFGPGGGDGVNTFQPV
FT                   PPRDVTLADLGGIEESLRAIRELILCPLTHPELYSWLGVDPPRGVLLHGPPGCGKTTLA
FT                   HAIAREAGVPFFSIAAPEIVAGVSGESEAKIRQLFAAAAAAAPSIVFIDEVDAIVPKRE
FT                   SAGRQMESRIVAQLLASMDNLNDGVVRGHVTVIGATNRPDGMDAALRRAGRFDREIMLG
FT                   IPDEGARARILAVQAKKLRLAGGLDLAEIAKKTPGYVGADLSALAKEAAASAVARIFQQ
FT                   LSGEESQSVVEKENVGPVEIGPEETLMGSGRLADRRPFDASELANLSITIEDFALALTK
FT                   VQPSAQREGFTTTPEVTWEDVGSLTEVREELKFSVCEPIAHPARFHAMGLAVSTGVLLY
FT                   GPPGCGKTLVAKATANEANANFISIKGPELLNKYVGESERAVRTLFARARAASPCVLFF
FT                   DELDSLAPRRGNEGNQASERVVNQLLTEMDGLEARSSTFVVAATNRPDMIDSAMLRPGR
FT                   LDKLLYVPLPPPDGRAAILKTLTRKTPLAADVDVGSIGTSARCGGFSGADLASLVREAC
FT                   VAALKGNLAAATAADAEREKIRKAGAAAGALPAPPAPPEVTLEHFEQAFERVQPSVSVA
FT                   DQKRYDELRRKLRRDVGALKPKDERPIDAGTESDMGGGAMEESGRATPSLYAGAPGGGS
FT                   GKKRKM"
FT   CDS_pept        complement(295336..297216)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636490"
FT                   /orf_name="MICPUN_56723"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62102.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniParc:UPI000199A899"
FT                   /db_xref="UniProtKB/TrEMBL:C1E127"
FT                   /transl_table=1
FT                   /translation="MWAARAAHRGARRVAQRTESLSVASALRSNLPSRSTTSGSIVTAS
FT                   SSRVRSFVGPSRHVSFAPPNPIIPAAYVAGSIASRTVLATARMNAANRVFNAVTTPSAR
FT                   ARLRDALLGRTRSGSVTRVAVVATGAGVVAHVYTEEVPATGRRRLMLLDLGDEERLLRA
FT                   ATAAQFERLDGSFLPPSHPATQRVAGILWKLVNRLDPALVVGTNPKNLSHHPLLAEGAT
FT                   WSLHVYDSPEVNASVAPGGHIFVSTGLIRACGRDDGRLAFVLAHEMGHRIARHVAEHAS
FT                   IEMLRTMGVAVGWALAAMFGADFLGGAVTASAMVGAEAAAELAVSLPYSRTMEYEADEI
FT                   GMRLLTGACFDPDAGPRMMSTLEAFAVEQRRLAERESSSTRDGSFNGVQRRSTSFNGDD
FT                   ERARKEMERYLSTHPLNEERIAAMRERIMPRLFESASNSDCGAYVAALQSSMGLRHRRL
FT                   PPNAHDANKGKVFIPTSKWRARYVRELDVTHSTERGMNRVLDRRNKMSSTDAANAGDHG
FT                   AMTGPLGRFDDRRMRALLARPDTEAGAKAREDAAALGSKGMHSRGWRGPVRRKVELSKA
FT                   SASDGVEASPGVRDEASRGDAEEGTELGELVGMYWSGSGARRAVRRAAAA"
FT   CDS_pept        297318..299243
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636491"
FT                   /orf_name="MICPUN_56724"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61661.1"
FT                   /db_xref="UniParc:UPI000199A89A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E128"
FT                   /transl_table=1
FT                   /translation="METPSREVSDAGSAARRNPRSPGVSLGRGLDSFLDDLTPEATRQA
FT                   TTEDRAALLQLTKFRERLAAMGDGAGDGDEHDPPATPSDSPRTMDTTSRASSPPSPDEN
FT                   APPGTGIPGMTPRKVHPSFTLPPHEQQRRDAAAAAAVRTRGTSPSLITSPSGRIEVGAT
FT                   ATTTARSSPLGREPTTPTDLDDAGGSQRRRRARVLEDGTDVFGRDDDDVFGRDNDDGDG
FT                   LTETRGSAAADTTARPPADDPRSLATRSNDDPRIVGRLLGSVEAALAEAVTPRAALGAL
FT                   RADVDECRAAIDALRESHVALEREDGALTEAQGQMREELDDAWRTRLPRLERLMFRLAD
FT                   RLDRVVDEAVAASEAVNVRRLEEELGRLRVEIAETIASIGDGTGEAVGEATLEAIAHVD
FT                   SSVNALRAETAAAVESVRVETLARLERMEAAQLAEEARRKSAVESAVESTRGSRHWSSF
FT                   AAGLEPCVDVITALAARVLGPGRRSGKDERESYPAVTATGSALDDEASGVINRGLRRQI
FT                   HRCKTIGGVEGVAWDDDAGADLLGASLVVLAAEAAHAIAPRGPCRVATRVVRAAVWTST
FT                   AALASGAVKSWCHRVANEAMAERRRRLEGGAKEGADVDDDDEEEERFETPPARSSADPE
FT                   LFVDTH"
FT   CDS_pept        299356..300531
FT                   /codon_start=1
FT                   /gene_family="HOG000250278" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636492"
FT                   /orf_name="MICPUN_56725"
FT                   /product="Aryl-alcohol dehydrogenase related protein "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61662.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199A89B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E129"
FT                   /transl_table=1
FT                   /translation="MKPATVLSSSVAPVGVSRSRAAPRRAAVAARASTDAAATTPAAGV
FT                   GNTFRTATDRVTLGTSDLSVAATGAGAWAWGDRSGYWGSDWEGDRAKNLDAYMTLLAGG
FT                   VDFIDTAEVYGFGKSEELIREFMRDTAADATLAPPLLATKFAPIPFRFRAEDVPNALRA
FT                   SMARMGVRKVALYMQHWPAFGLPGVTEACNDAFLEGLCLCYERGLCRAVGVSNFNAERV
FT                   KRAAKKFKERGVPFASNQIQYSLAYRAPETDTGVIDACVECGVTPVAYSPMAQGLLTGK
FT                   YSAASPLGEGVKATGPRARILSEEKLASADALVDLMREIGRNHGGVTPAQIAVNYCMTK
FT                   GTVPIPGAKDARQAEAVVGCLGWRLDEAEVAELEAAAALVPSTPGAPFERW"
FT   CDS_pept        join(300990..301088,301244..301690)
FT                   /codon_start=1
FT                   /gene_family="HOG000163282" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636493"
FT                   /orf_name="MICPUN_105248"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61663.1"
FT                   /db_xref="HOGENOM:HBG609692"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniParc:UPI000199A89C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E130"
FT                   /transl_table=1
FT                   /translation="MDAKWRLDFADASTSGNNAPVNPPGYASLRELGDVDAPAKGKADA
FT                   PKGGVVAPGGALTSAARQQKAYQFAMSQVQAIGMTGFMMYMAGSGVQIFSMMVVGNGLF
FT                   QPIKAIASSGKIFEPYADASTDVTGPRALFCAIQLAGLAMALYKLNSMGLLPTHASDWV
FT                   SGMKPPTPVEHAYGGTTL"
FT   CDS_pept        301973..302530
FT                   /codon_start=1
FT                   /gene_family="HOG000100022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636494"
FT                   /orf_name="MICPUN_99323"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61664.1"
FT                   /db_xref="HOGENOM:HBG560012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A89D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E131"
FT                   /transl_table=1
FT                   /translation="MRYIPHKRGKPSRWVREAAGNDDVEGIDAALDAASNKDEALNKGD
FT                   IMGRTALHWAAGRGRVDAVRHLLALGARVKISGMHHTPLHDLAESGAAAAPTLVQELVE
FT                   AAPWQLTYKDNTGAMPVDRAKSAGQRQMVRALESAAMMVTGAERAMMSRHTHSFLPSCL
FT                   SVATISLDSPGSSVTRPLLEGA"
FT   CDS_pept        302802..303365
FT                   /codon_start=1
FT                   /gene_family="HOG000100022" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636495"
FT                   /orf_name="MICPUN_56728"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61665.1"
FT                   /db_xref="HOGENOM:HBG560012"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A89E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E132"
FT                   /transl_table=1
FT                   /translation="MSYARPKRGKPERWVREAAGNDDVEGIDAALDAAKDRERLLNKGD
FT                   FVGRTALHWAAGRGRADAVRHLLALGARVKLSGNQASPLHDLAASGSPNAPALVQDLLA
FT                   AAPWQLTHRDNMGHYPVDKARDVGDKSMALALDALMMTVVGKRGPTAKPRTPSSWMPSC
FT                   MSAGKARGIVGSDERPLLEGAARA"
FT   CDS_pept        303500..305074
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636496"
FT                   /orf_name="MICPUN_56729"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61666.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI000199A89F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E133"
FT                   /transl_table=1
FT                   /translation="MGALEDLVASHLGGFSPEGGVHLPNTPGYDACLLSAGAANYACLH
FT                   ERRRPPVALQPARESDVVLAVRFVTAGIERGLWPEGGRVDGSPDGGDGVPLTLCGGGHS
FT                   ELCVRHGAVLIHFGRMASVSCDPAAGTVTIAPGALLGAMNEAAQNHGLAVPTGVFAGVG
FT                   VGSILAGGIGRLARARGLSVHSVVAMRVVTADGEIHVLGEGTHMDGLARDMWWGCRGAA
FT                   AALGVVTSVTLRAAPIAPTVSHGRRIYPTFADAPDAAARLRRIETIARALPEATQVDVC
FT                   VTRAAGGGGGGVRIGVFPCATDGGDVPADVVASLELTPRHVTRSRYCDVPYHSMLPDDE
FT                   LDDESAPGDDESAPGDDGTPSQATPGMFSYVRQWFVDELGEIGAAAVAAAAAAAPTDDS
FT                   LVMMQHAGGAVRRGGRPADDDDAPADDDLSFPHRQWEWSVVIIALWTDPSSRARTTAEA
FT                   WADDAFESLRGCGVGCYAVDIDRFRRSGADAEEEVKLAFGEVNAARLRELKRRVDPMNV
FT                   FAAAVPL"
FT   CDS_pept        join(complement(307345..307471),complement(305298..307177))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636497"
FT                   /orf_name="MICPUN_56730"
FT                   /product="Xanthine/uracil/vitamin C permease "
FT                   /protein_id="ACO62103.1"
FT                   /db_xref="UniParc:UPI000199A8A0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E134"
FT                   /transl_table=1
FT                   /translation="MPVGTGIKREKVPLQQVLLQLSPFYWQGDASWAWNFKVPLWTGSG
FT                   EMEAFCELFFDNLATLLGVTGAAMDVGRIGGINSYSDATDLYKATVTGEWTRIYYDWNI
FT                   PACGLALLFGNVWFAWLATRLATKENRLDVTAQPYGMNTTVIYITIYAISLPAIQAGFT
FT                   KFNPGTGASDADSIAMGKKAAEFGWKVSVATNFIIGFMEILGCFLGDLIRNTVPTAAVY
FT                   VPLAGVGFVWLAFSPMLTIAKAPMMCLLPFMVVVFGFFGNVRYPVYGKVTFPIALMAIL
FT                   LSVIFGWAGACKRSTEVIGGAYGDVSVSDFYNGFRAIQGTGASGTCQGTDGNAAKAAWK
FT                   TYAFKGDIFGGFGSGLAGLSESSLMEDFAAPALLFGMIGFLGTMTCVESAEAAGDAYPM
FT                   SEIMIVDGIGTCMAALAGGMFGTTVYIGHPVHKALGAKIGYSIANGVLYFIFLSTGLFA
FT                   CLYNVIPECANGAILVFVGLLLARQGFEETPERHYPCLLLGLMPFICNWAWLESDGAAS
FT                   KNMGVLSLGPSGGIVQGIILAALTAWAIDRKFEEVTVFSIIVAFFSLFGIAFSHNDLVY
FT                   SYGVWGAEHQTLKVYADGSGVDKDTGTPEEAFNGWRWCVAFFMVAFFAACHIPFQKGNK
FT                   YTKFEAIPPRIEDDAEDPYDYSVHAAKAAEIPK"
FT   CDS_pept        307809..308090
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636498"
FT                   /orf_name="MICPUN_56731"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61667.1"
FT                   /db_xref="UniParc:UPI000199A8A1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E135"
FT                   /transl_table=1
FT                   /translation="MRKETAFLLVICYVAFHLSQLSLEDLVAHLESGKQIVAGVLADPI
FT                   GKGQEYYDRLVQTGAAKFLAFAAASKLISWHFKRSATSRKIAADKKAK"
FT   CDS_pept        308170..309591
FT                   /codon_start=1
FT                   /gene_family="HOG000012473" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636499"
FT                   /orf_name="MICPUN_56732"
FT                   /product="Cysteine hydrolase"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61668.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG412077"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI000199A8A2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E136"
FT                   /transl_table=1
FT                   /translation="MSRVASAKPYAWPYDGSLAADDVALVLIDMQTDFCGLGGYVAQMG
FT                   YDVSLTRAPIEPLRSVLAAARAAGVRVIHTREGHRPSLADLPDNKRWRSMQAGAGIGDP
FT                   GPCGRILVRGEPGWDIIPELYPLSAEDVVDKPGKGSFCATDLDLILRSRGIKRIILGGI
FT                   TTDVCVHTTMREANDRGYECLLLEDGCGATDAGNHAAAIKMVHMQHGVFGATATCDAVC
FT                   AALDALPRVPDASALVRTTMTAGLKSSHAAGEVASAKPYPFAWRVGECALVMVDWQRDF
FT                   CDDGGFGASLGNDVTSLRRAIPAASRVLAAARKAGMPVIHTLEAHAPDLSDCPPAKKAR
FT                   CPAIGEIVVGGIEGSRVLVAGEPGNALVPELAAAEGEVVIRKPGKGAFFGTDLHTRLES
FT                   LGVKSLLFTGVTTEVCVQTTMREANDRGYECLLVEDATESYFPEFKAATLAMITAQNGI
FT                   VGWTASAADVVAAMK"
FT   CDS_pept        complement(309825..310541)
FT                   /codon_start=1
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636500"
FT                   /orf_name="MICPUN_56733"
FT                   /product="Cysteine hydrolase"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO62104.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="UniParc:UPI000199A8A3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E137"
FT                   /transl_table=1
FT                   /translation="MVRRGVEAAKPEALIAEAQVACFHDREFPVSSSDTALVLIDMQTD
FT                   FLSKDGRLGKNYSDPRVKQLAATEAKVATLLAAARRAGMTVAHSRSHRYGADVRRDLCV
FT                   PTIDPTYDLVDSCRPLPGEIVVDKWTFGAFASTDLETQLRRRGVRRILLAGILTNVCIM
FT                   ATAVQAVDRFFRVCLVEDACGAFDARWHQHAVELINGPQTLKENHHNSVGLYFGEVAKL
FT                   SDVETALAKCGGGAAV"
FT   CDS_pept        310782..312593
FT                   /codon_start=1
FT                   /gene_family="HOG000230085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636501"
FT                   /orf_name="MICPUN_56734"
FT                   /product="Cytosine deaminase/metal dependent hydrolase "
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61669.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG582647"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="UniParc:UPI000199A8A4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E138"
FT                   /transl_table=1
FT                   /translation="MKTKHVACTTERQYQTQTHSFVRAEISDFGGSCFARSLRPRSRRS
FT                   VGLFGSKDTCFSFGHEIRFENERKTRLIQWRFLARNDGTVTRHFCQRETGRGVTTVQHN
FT                   PTSRMLPRKAAVDALKGGEETLVLRRVTVPLACLTDESLRAAADAEGAVSCDVTLAGGT
FT                   ITGVAIHDPTPLPGTGRLDARGSMLWPAFVDAHTHLCKTHAVPRCRNPSGSINDALACE
FT                   VTDQPRWIEPGDVERRMDFALRSCLHHGTRAVRTHLDGTNAPDAAMRQRIYDVFDAKRA
FT                   EYESRGIVLQGVANLYLPLYADAPEMAARHAEDAASHAGVVLGAYCGDVSHGEPGATDK
FT                   HLDALFALALKHGLDVDLHIDENNNPDCCGVRVLCGALERARERGYDGSVVLGHVTSLA
FT                   LQTTEVQAEVVARLAKLAPVHVVCNPFTNLGLQDRRGTAPPIGKLVARDEPRTPLWRGL
FT                   TLLQELRAANVPVAAASDNVRDWWHPYGDYDPLQVWREAVAMGHLDTAPSEGAWADLVT
FT                   AAAADAMGVGGGVIAVGEPADLVLFPGARRFSELLARPHHDRVVVRRGKATETKLPDFS
FT                   ELDDLVDGREAVVDTSQDILRGATKKE"
FT   CDS_pept        join(complement(313412..313733),complement(312717..313291))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636502"
FT                   /orf_name="MICPUN_56735"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO62105.1"
FT                   /db_xref="UniParc:UPI000199A8A5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E139"
FT                   /transl_table=1
FT                   /translation="MGEVTNRATTAAIAVGAAAALGLSYLAHGWYRSRRSPRVLVLVSG
FT                   TLQDGFPLRRNLDAPGAPAEFVGWALVRGVKMYLDPKPRGCREWVDPESGERQRVNPAL
FT                   VCTGDPKDANVYACYAVSEGACLRALLGEPRMLGMTPDTALVDLRAEETSRALASFLAG
FT                   QARRWWENSTPAFGDVAVTERGTLDEGRVAMLTVVAHRVPHGAVPVEPAYVKDDGTRVT
FT                   SFAPCLKRFGGGFELGTRAHELGLEEAIRKWQRRMDPGDGTRGDSLYGAAPETFRMNYA
FT                   VTAGEVARTFSSKRVAA"
FT   CDS_pept        join(313886..313952,314069..315024)
FT                   /codon_start=1
FT                   /gene_family="HOG000276736" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636503"
FT                   /orf_name="MICPUN_56736"
FT                   /product="Dioxygenase"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /protein_id="ACO61670.1"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="HOGENOM:HBG749762"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199A8A6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E140"
FT                   /transl_table=1
FT                   /translation="MSPPDADTSAGLSEVDLERSLKASGVGDKAASSYAVPIVDLSNPD
FT                   ETAVADALWDAATTVGFFTVVGHGIDEESIDAQFEASREFFEQDLAVKEAASPFESALN
FT                   SGFEHMKQVRPSTGLPDVKESLQVTARADAMSGRWPPKPADFEARTRAFMTKSHALAAR
FT                   ILTLLEPRACPGQARGTLADAHTLWGPDGQCTLRHLHYPPMSAERVAALPPGSWRAGAH
FT                   TDWCCVTLLFQRTGEFGLECAANPRTNSTEWAPVDPVPGGVAVNVGDMLSRWSDGRLLS
FT                   NLHRVRMPAPNPGTGEVPVRYSLAFFMQADKSAMIQCAEQPPITAGDYILGRIRSNFEK
FT                   "
FT   CDS_pept        complement(315132..316502)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636504"
FT                   /orf_name="MICPUN_56737"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO62106.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199A8A7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E141"
FT                   /transl_table=1
FT                   /translation="MAASLLPTRRWALVMLSCVEVLTATGVMFGWSSLSIALRREGTYA
FT                   ELCDDDRSGCDAQALRLNAVYTAGAFCVPLGGMIWGPLMDVKGAKWTRAVGMCVFSAGC
FT                   LLFAFADSKTFDAYVPAACLVSIGGMANFLSHFVLAEYFADDHFGLVHSLINCSFDAST
FT                   VTFTVLELIHREGASTQSLFLAMAALGLVYLALTNETVWAGHLSPPLKKLNTSSAVGGE
FT                   GNEDGLVGAQSPQYGARLDESGKPFRRQVESRAFIALAVWGLFTVYRTMLVLGSVTEQM
FT                   LYNADGRDASHAERLVRVFNFLILISVALTPSFGRFIDTHGMAAGLALVNALGVLTFGL
FT                   LVTRPDWSLYVAFLAFGCFRAWNYSLMTAYSMGVFGGASFGKVYGIGVGTVSCLAAAAQ
FT                   YPTMAIVLGGSNPNFEGLDWAMLGVGVVMFGFPAFVHSRTVEGKETGAAAAAAANAA"
FT   CDS_pept        316675..318186
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636505"
FT                   /orf_name="MICPUN_56738"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO61671.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560020"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI000199A90A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E142"
FT                   /transl_table=1
FT                   /translation="MMGEELAKWVLLAYGLFMTTLVAGVVYGWQSFRAVFIAEGVLSEG
FT                   CDANSADVECPSQAKELGLIFACGAWSVQACRMVTGLVRDRYGTRVCVVGVMLTVAVGI
FT                   VLLAVSPPQSLAMFCVGYFLLGIGAGVQLCMQSISMLFGEYQGAASATLSGAFTLSAVI
FT                   PLACAEAIQSVARSDGGSASSYADARAGVLTAWCVTVVVFAASAMWLMPRGGEFRESVR
FT                   YLVGERGGDENNEKTKDDDDKDDKEDRDDEPPRVPPANAPKAANGTRRAPHEGKSAREQ
FT                   LLSLDFILLAAWFTVMLLPTNYFIISVGDQLEGMGDDDGEITRGFQLVWVVSTILSPIA
FT                   GYSADVVGRGSTMTFAMGCYAASFVMLGFGGDGWGGLSLEAQWLNFVCFNVGRLWVFSM
FT                   YFVSVGRLFGFRHYGTLAGAGLLLSAMSTPLAVPMHRSGVDGNFGESNLASAMICLGLT
FT                   PYTVGWAWRREITEEGMRGFPARWGIRREEEAKEEAKEEAGANAV"
FT   CDS_pept        318500..320269
FT                   /codon_start=1
FT                   /gene_family="HOG000250646" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636506"
FT                   /orf_name="MICPUN_56739"
FT                   /product="Metal dependent hydrolase "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds"
FT                   /protein_id="ACO61672.1"
FT                   /db_xref="GO:0016810"
FT                   /db_xref="HOGENOM:HBG668170"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniParc:UPI000199A90B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E143"
FT                   /transl_table=1
FT                   /translation="MDLTLDNSVGKFSPSPAPPAGPPTLLRGALVPNDASEPGTYTRRD
FT                   VLIADGVLKRVAPGGTLSLDVDCPPGTIEEDCSERMLVPGFVNGHTHSVEHWARGLIKP
FT                   LPLEMWVLQLIRHEPRGEEGWAGPESWIKTPAAAIAVSAMHCGVEALLSGTTAIMDHLL
FT                   CRDIKDVEAAVFAYRALGIRAYIAPMLGDDLEPYVNYVPLARDAQGRNGAICGPAGPAP
FT                   GCPDCGGLGAHGSFRTEVGERDPAKTEANLALWREAAQKFHDPKNGINIVVGPVTAYSA
FT                   STELLRGAAEIRKEFGLCGHIHLLETRAQALMARQFLPSGSAVKHLRDTGFLQVPGTTC
FT                   GHCVWLDDEEIAIMAECDATAVHNPFSNLRLGSGVAPLHKYARLGMNVCLGADGACSSD
FT                   GQDMLEVAKLANILPCVATPEYRDWPTAHHTALVLGAANGYKGILLEGKPGQVGKGGVL
FT                   EEGALADLSSWDLTALSMLPRTDPLSLLVQGSRTQAPGAGSALDCAWVNGVRVVQGGSP
FT                   VNVDVKALREVLRAAQGTYRDPAITDPSTHEKTARAETEYRAAMDLDPAGATGLRPAYE
FT                   WPEHCVLYPASQN"
FT   CDS_pept        join(320782..321776,322138..322363)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636507"
FT                   /orf_name="MICPUN_56740"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61673.1"
FT                   /db_xref="UniParc:UPI000199A90C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E144"
FT                   /transl_table=1
FT                   /translation="MWTPGHGPELRRARPTCGVDDVDEARFNPLCRRARGVEDDSDPSE
FT                   SDTGFDDDDDDSHSSECDLVENVRQARLNALRRRRDDREEIRRQNETLDRIHRARHAER
FT                   EMAKELSSMRFEAERRHTLAWGDDAEVRDRERAAERAAEAIGDAMDEEELIESTQRGAG
FT                   GDGGVARAAEEAHAWATHDEAWAAFEASVRDGARVRTRDVPWPPGHDRGGDGGGGGTLL
FT                   ASLARCELVERGGGGGAGSCRGGSEDKRLAAFRRAFKRASLRWHPDKFEGKFGGALCDD
FT                   VCGDDDDGMVRTGGTGGTGGEGRGETHAQHIRRRVRCIAQEINDAWSAIVAFAQRRNYL
FT                   ILSLWANVPIDFKARWIAIAVWIEEIGFQFFGLDSREPFAGYFPFTADSLYDGDAGIDP
FT                   HCLSLIA"
FT   CDS_pept        join(322778..322940,323104..323165,323539..324423)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636508"
FT                   /orf_name="MICPUN_56741"
FT                   /product="Myb family transcription factor "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61674.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI000199A90D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E145"
FT                   /transl_table=1
FT                   /translation="MAGLSELVEAATEGMRKTQSADPIEENSNQPPPPTKDDGHLSDSA
FT                   VAPTRERKKGVPWTEDEHRLFLLGLQKLGKGDWRGISRHFVQSRTPTQVASHAQKYFIR
FT                   QNNLNKRKRRSSLFDIVSEAPAEPAKAPEVASKPPAGIPGGLSMAFAAGMPAFPGFNPA
FT                   SMPMPPGFGAHGAVPAAKKAGAGMDEGEKAAAATIAALAGSPIAAAGFAQAAAAAAGSK
FT                   GPNPWEVKHAPMGASPPGQHNAQQAAAAAAAAAAANPFAAMMAMGAMGQMGAQMPAPAA
FT                   WMQGYHQFMQQMAAAGAAHQQAQAARPPMPPPPAGVTFPPNFQGFTPGVFPGAHNVFGN
FT                   FMNGAMAKPAGEKPETVAKKEGSATAVTA"
FT   CDS_pept        325610..329869
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636509"
FT                   /orf_name="MICPUN_56742"
FT                   /product="C2 domain-containing protein "
FT                   /protein_id="ACO61675.1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="UniParc:UPI000199A90E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E146"
FT                   /transl_table=1
FT                   /translation="MSGQVVTGTPVFSMSPSNPRSAQVQPGMAPATPPPFNGSSSMSAP
FT                   GYGAGAEGPGASSSPAHTALDVDDQGNRGGDFVTRTWQPARAPDAVALAEVTSQMTSAA
FT                   NVAEVFKATGLGQQDIQSSASRTTEDDGLIVRQRPRARADNIAVRKARAAREARPGDWF
FT                   DPNDGGILCQADPVPPGVERARPARWFDPEAPYLQTVPATDSRIDLEIVDAAGSDRTYR
FT                   FDISVGRLEFSCHPLMSKEDFLAAQLEESFRSYKRREASDLVTLYTAKSAAAAARARAL
FT                   RQEMAAGAALWLAGVSPSDRLIALEEEAEEAQRLAIDEGDRMKASVQHMSELHDAIERE
FT                   RIAYGCRSTSIRFAVRQKGNGESEPVLLAGAARDEGAHVPKPEQQRRAKATSTRFCVAL
FT                   EVNGQQVPGTSRPVTLRSSGGFSTEVAHAFSLSVQRWPDSVRLALYEKGTIVDTFLAVV
FT                   PIAVPGSNPGEPLQDPAPRQYQFSAESPHAPTWRGAQPGASQVQYTSGSLFVTCAWTPN
FT                   AAEAINMGAYGRQHTADVERSVPVAPPPPPSTAAKRAAAAAKVGYADAAGGFGRAVPRP
FT                   APDAVPGGSPSKTSAAALRASLDPLNPEDATLLETLATREALRNAGGGGFRLNLNDETM
FT                   LGVNAKATKRQQLLKLRAEGGVEALPEGGVPLSEGDIPDHLLEQNAEVQSQSKLLSAQL
FT                   PGLAEADKRATRIAEFLAKVKLNVAKGRRDQKMGARASKGVMHTDDVVKDSPLPDITFD
FT                   LTGVFEFFQPRRKLRPARRRAAPPESHPDYCELVVGIQKAFNLPTRAGMQGGAMGGVGG
FT                   GRRSMQRGGGGGGGGYGGGYGDGYGGGAALVASGELNSFVEVSFQGQTLRTRLANGSAP
FT                   SWQESLQLPFRPPGGDFSPAALQGCEDVVTISLFDEATEPAERTYGAGAVAGGTSTTQH
FT                   FLGSIDIPVAALYRGDGGKIEGVLPLDAPPVLLGYSGAGGGGGSGGGRASLPGGGGLAQ
FT                   QPKPSMSVYIQFAPALAKPEPTLSDPGVGEDESVLRHAKVWEKECRAASRHTKQRPYRA
FT                   VATDGMGRSVHLCRYIASAQLPPGFQGAVADEPTLRQLMRFCHLVPHVTDMSAFNLPPG
FT                   VDIWTTSQEFLDMCAGDSEEHALLLCGFLVALGVEAYVVLGVSATDSDAAMVFTPGGQG
FT                   KRPGNPPTYAPMLEDSLIWDPMAGTIFSVYDSACSACLGEIGVVFNSDNVWANVQAHGR
FT                   PHEMNWNLNDTHGWRPFFSAGSFPHRAMPTVQTAITYESYPPAFYERLGAAVEREAMDA
FT                   IVKKRARQHTPFNRRASRALKDLLRDLEGQILISPDDQGGGLNLGGGMRVGSLTELHMS
FT                   QLAGICEGYTVTGCPMNLPFTDAATVRDVIDRLKIADTTRSDVEFAVATHVEPYGCTFV
FT                   CSVWVYVVRLTKISSYQ"
FT   CDS_pept        join(complement(330791..330895),complement(330612..330660),
FT                   complement(329947..330491))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636510"
FT                   /orf_name="MICPUN_56743"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62107.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000199A90F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E147"
FT                   /transl_table=1
FT                   /translation="MLCALVMFLGLIIAPTSAYPTGKVVEVTEVDFDAQVAKGPTLVDV
FT                   YADWCGHCRQLAPVWEELAKELEGEVYVVKVNGPKCRSLQQRLHVKAYPSILYLRDGEM
FT                   RSYDAAQRTVQALAAFARKGWRRTKPVPFYMAPNNWYGRSVGWVYKIPAIAREAHGNLR
FT                   KAGWGDVSIIFATLAVPVAAGMFAIFVADVWVVRTTRAQGAAARRRDDARRLLREQQEA
FT                   LERMNRVHAD"
FT   CDS_pept        331059..332345
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636511"
FT                   /orf_name="MICPUN_56744"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61676.1"
FT                   /db_xref="UniParc:UPI000199A910"
FT                   /db_xref="UniProtKB/TrEMBL:C1E148"
FT                   /transl_table=1
FT                   /translation="MPPAGDDYEPTMGAVQLLVHRRLRTVQKRVAKIAKAEEKRSAGGE
FT                   IDDQQKELIDGKPLTMALLEEFTKLSQEVEKAVEEDRLAVLREERAKVAAKAERSAARR
FT                   AAAAGDRPDEATKANEASAAPPVPPVDGGATRTTGKKPGRRGGGRESPADGAAPPAREP
FT                   LASTPNQPPPAEIPQVVDAPAAAKPRRERGGRGKNRRREGDIGDADTRAAPAPGPGAGP
FT                   GGPPGGVFPGHQQGPFQQGPGAPVATVDGVSLRFGSLGVNGPPAGQSRPPDGSVATEEE
FT                   RARRPETVAATLPKPPVPVEMTPAEINLADYGFDDEYGAPDDLVDDNVFHVAPHVAPRF
FT                   DDVGGAPRVDSRARGDRSSAATGGQRPAGTRAAGHSSREKVGGGGERRDAGGRGRGGER
FT                   RDGGGGGGNRGGGRGGRGGRGGRGRPGVE"
FT   CDS_pept        complement(332425..333078)
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636512"
FT                   /orf_name="MICPUN_56745"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62108.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A911"
FT                   /db_xref="UniProtKB/TrEMBL:C1E149"
FT                   /transl_table=1
FT                   /translation="MSTIWRPDLNEDPIVVKEESDDDHNPPAVNVEPPADDHEEDEKSE
FT                   DLAGKMSTIWRPNLDRLYASVAEMEGSESEEEEDASKQGTKRKRAPHTKGPCEHGVKWR
FT                   SQCKVCSACPHGKRRCHCKECGGASICEHGRIRSQCKECGGASICEHGRQRSKCKECGG
FT                   GSICEHGRHRQYCKECGGGSICEHGRRRSQCKECGGSGICKHGRRRSRCKECKK"
FT   CDS_pept        333290..334597
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636513"
FT                   /orf_name="MICPUN_56746"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61677.1"
FT                   /db_xref="UniParc:UPI000199A912"
FT                   /db_xref="UniProtKB/TrEMBL:C1E150"
FT                   /transl_table=1
FT                   /translation="MRPARAREEGRGGGARPPRGREREDMSRRPGGGGPGGRPGGRRGA
FT                   DGRPPRMPRQGPGGRGGPPIRQRYKKPPGLLSWYKPRVSHGFIAAFSLGILLMLALWTF
FT                   PSYSAYVDRAEMVKQYCLVHGGDNSTGCVKVEIVHESVCDPAVPELYGHLTTDNCTDLC
FT                   VYSDEERTVGNTTAAERLAFVDSFIPGAEVPCFYPPGDSNFTQATFTVPYNPNEQMFLS
FT                   LVWLSPLFFCLLVSVHCALRKPREALELEDDQMLTGLFNEVVIQRNHQEKFVNDVEMRV
FT                   KHLKSAVDGEQQKRLDVVLEVEKERRDRLTSEDNLKHALHENMRSLESKLVREMAQRLA
FT                   SIPIPSKLKEKMMRKADKYREDRDPLLGGRRSKNDRPDSAASLIFEDHQRNAERRRAAL
FT                   ANDLDAQRGAFKQRLEERKSKGKRSKSKDPGAKRRD"
FT   CDS_pept        complement(334707..335657)
FT                   /codon_start=1
FT                   /gene_family="HOG000007498" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636514"
FT                   /orf_name="MICPUN_79549"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62109.1"
FT                   /db_xref="HOGENOM:HBG560027"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199A913"
FT                   /db_xref="UniProtKB/TrEMBL:C1E151"
FT                   /transl_table=1
FT                   /translation="MGTGSRHSKNAGTMGSENLTYHEKKALGFGTVKERLGKETVKDFD
FT                   ACGLGLQHALDPVVTPEGVLYDREHILQCLLHQKKDIARKMKTWEGEQARDAEKASAEE
FT                   EAKRLAELEKFELENKGGFVNYSASAGTSTATGTSDARIASSADVAATQDDKERMKTMK
FT                   AFWLPSKTPTAERKAEKPDTDTKCPTTLKKLRLKDLLAVKWTKVRKGEEIGGARYMCPV
FT                   TFKTFTNATKIVVLKPSGHAVSEEAWTKVVKDEGTYDGHRVKGVIRLQRGGSGFAGSGT
FT                   QVESKTEFMLGAGSGLADGRGQNRGATSKFGLRFN"
FT   CDS_pept        join(336145..336249,336409..338073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636515"
FT                   /orf_name="MICPUN_56748"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61678.1"
FT                   /db_xref="UniParc:UPI000199A914"
FT                   /db_xref="UniProtKB/TrEMBL:C1E152"
FT                   /transl_table=1
FT                   /translation="MSRPGGVSRSRPANEGERDPKRPRIGGAPQNVETEDDDLQVICPP
FT                   VNPVQSEVNAIVAMAVAGGADPVAVEQMLAATLGDPTQVQATLAVLRAVAAGAQNRTTA
FT                   GITAAALSAMNAASGPNGQGNSLAANAVTAVLTRPPHADRPAIIRRCQVDACNKLDVGG
FT                   GKCTAHGGGKRCQVDGCNAGDRGGGKCISHGGGKRCQSDRCDAGAASGGKFCVTHGGGL
FT                   RCTEEGCDRVRKVRGKCAVHGGINKKKLCVVAGCSSKDLGGGLCKTHGGVRLCSHEGCN
FT                   KRAKARGACVQHDSREKICSHPGCAFPARARGKCKDHGGVVMKMCASEGCAAKAATGSD
FT                   RCRAHGGGKRCSHEGCEKMDAGRGFCVAHGGGKRCQVPNCTKGATRSSFCVAHGGGKRC
FT                   TFEGCDKPGHFKGLCAAHGGGKLCQAPDCKKWDAGFGFCRSHGGGKRCSVEGCTTPVKL
FT                   RGLCIKHGGGHTCSVEGCNRSAKTRSLCIEHGGVKLCKVPNCTKMDRGRGFCSKHGNLL
FT                   GLGGLKCTHEGCNKCAVSKGLCCEHGGVRRCQMKGCQKMDRNGGFCNAHQPGGPVPDAL
FT                   PPPGMTQLPGIMA"
FT   CDS_pept        complement(342440..344125)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636516"
FT                   /orf_name="MICPUN_56750"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62110.1"
FT                   /db_xref="HOGENOM:HBG560029"
FT                   /db_xref="InterPro:IPR006968"
FT                   /db_xref="UniParc:UPI000199A915"
FT                   /db_xref="UniProtKB/TrEMBL:C1E153"
FT                   /transl_table=1
FT                   /translation="MSAAARPAAIAPRDAARRVASTRARRVVSAPLRGRTERRRAPHPA
FT                   RATTRASTPREGRSDDGPTLVETSSGGQQLRRWGRTPTGGFDRQPPRRPEEELAGQGEA
FT                   TSGRSGFARWDPRLSPRLRAVFLPAGYPDTVSPDYAPFIRWHLGSLMFRNVLEVITAQS
FT                   LLVALGMGSTPGALPLTAATKWVLKDGIGSLATLAAGSLGGQKCDEDPKRWWMVSNAFE
FT                   DVARVIELVTPAAPALFLPLAATATFVRTAALTGRGSLVNGSLMQHFARNENTADVRAR
FT                   LEVQGRWLALVALPVGIGIFRTVSQSFASDPEEPARDVAIAVALYGGVVCAHLVCIWNA
FT                   AKVLRFETLNRARLVRQARAFRDGGAAAIADYNAAGDEEGVFRARFSPGDPVLGASLPD
FT                   AARDWAHLERLVGHARDGFISPMELPPGSSGRTDVGRRFALGWNERDGGCPAVLLDADA
FT                   TARDVFAAALAGVHASRGVRGGDDAEGFGRAYAWGDARVDEFIVAMAAKGWRVDFVQLG
FT                   TAPRYRLGSLLGTGSGGGEVGGGTRGGKGGSVGVDASVDDVLAT"
FT   CDS_pept        344602..345435
FT                   /codon_start=1
FT                   /gene_family="HOG000200395" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636517"
FT                   /orf_name="MICPUN_56751"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61679.1"
FT                   /db_xref="HOGENOM:HBG560030"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI000199A97D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E154"
FT                   /transl_table=1
FT                   /translation="MREARDAEGPRRSFSLHRVSEHDRLVGEGRDVRILHVVRHAQGTH
FT                   NVDQKYRDPRNHDARLTGFGEQQCEALSRTPAAIEAQRSASLVVTSPLTRCVQTALLSF
FT                   PDIARREEVPFVALECIRETVNFACDGRRRRSEIAADFPRVNFSADDGVGDEDELWARY
FT                   ENLCGPTSAHDGHRESCDLPSVADRGRAFFAWLRRRPEREAIVSSHSAFLRCVFSWGQD
FT                   GGVRAAPDQALGESVWGELVDVNVPVVDYRGDVKLEYDLRRDWENCEMRTFLVAF"
FT   CDS_pept        complement(345588..346661)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636518"
FT                   /orf_name="MICPUN_56752"
FT                   /product="Predicted protein"
FT                   /function="GTP cyclohydrolase II activity"
FT                   /biological_process="riboflavin biosynthetic process "
FT                   /protein_id="ACO62111.1"
FT                   /db_xref="GO:0003935"
FT                   /db_xref="GO:0009231"
FT                   /db_xref="HOGENOM:HBG735778"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="UniParc:UPI000199A97E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E155"
FT                   /transl_table=1
FT                   /translation="MSFAAVSTHAGAVASSRRAPVGMGASTLGEQRQVGRLVDHVAGRR
FT                   YRHRRFDVRWTASAGDPNNESRRRSLNSRNAPGHAHRRGPKPPSIDRVLRAMPELTPES
FT                   PKDKPVSTNAMSFDESSIGDTEFIAETKLPTGSGFYRLRGYRHSVDGGVPSEPVAICFG
FT                   DIEGREKVPVRVHDACFTSEVLGSLKCDCKQQLQLAMEYIQENDGMVIYLHQEGRGIGL
FT                   ANKIAAYALQDTQGLDTVDANRALGLPDDVREYTAVANILEDMGIRSIQLMTNNPRKVA
FT                   TLERLGVKIEGRIPCIVKANLFNQGYLEAKEGRMKHFLDGSWCYWDHSGNTFDEDDAAA
FT                   SGEGGGAEQGEPAAEEK"
FT   CDS_pept        357736..359223
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636519"
FT                   /orf_name="MICPUN_107881"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61680.1"
FT                   /db_xref="UniParc:UPI000199A97F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E156"
FT                   /transl_table=1
FT                   /translation="MAVTSTFGVTSDFTVNTDKFIVNATNGNTKMTGNLEMSGDTATLT
FT                   HSGSTGGLAISSAQHVDVESVRFTTNQIGSTGDPDLITLTDNKVSISGQTLEMSGSTSR
FT                   LQHTGTTSLAISSTNGHITIAGGSGDYVDVESVRFTDDYIGISGDTDIIRLTSTGSQAT
FT                   VAMVADVDVTGTMDVSSDFAVNTNSFKVTGTNGNTEILGSLTMKAVSGIITHDGASGSL
FT                   AISSSTGPVTIAGQSTGGYVDVESVRFTDNQIGINGDADIITLTSLSGTSTVAFANKIT
FT                   TGDLATLNSATVTTTLHSGGDLTVGTGPKLTVAASSGDVVTAGKIAVAGSHGDATKALY
FT                   VTGSVYATGAVTSASDSRFKRDVRSIHDPLAIVRSLEPVTFTFKRDAFPTRDFPVETQA
FT                   GFLAQDLERVLPHLVTEDDEGYKGVAYERLGVYAVAGVKALDESMERLDESMERLDESM
FT                   ERLQNDTVARLEARVVELERALAALVSRASGPTPAGR"
FT   CDS_pept        <359714..>359944
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636520"
FT                   /orf_name="MICPUN_74755"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO61681.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR015465"
FT                   /db_xref="UniParc:UPI000199A980"
FT                   /db_xref="UniProtKB/TrEMBL:C1E157"
FT                   /transl_table=1
FT                   /translation="YSVFVGGLNFDTDERTLRDHFERFGEVDSVRIIYDRETGRSKGIA
FT                   FVHFAEKESIAIAAERTHGVEIDGRAVRCNPA"
FT   CDS_pept        complement(360631..361968)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636521"
FT                   /orf_name="MICPUN_56754"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62112.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A981"
FT                   /db_xref="UniProtKB/TrEMBL:C1E158"
FT                   /transl_table=1
FT                   /translation="MGVDPGDLLSLVPRDVLVKHMFADFAPIELLICSRVCHSWRTVFI
FT                   ESGLLPLPDRCELLDSIQVLVRSVSLLKWARSNARSWMEGERLQQIMILAAAEGRLDTL
FT                   RWLSSEGYRIHSKCLSDLVFAAASGAHQETLEWLWVVDNMRSLAIPESFKGTPEFNSDE
FT                   YDEYDECISLDHWRDIWFIVAVQGSGSSGNIEFAVWVRNFAASVGHTIDLHLEEDCLVR
FT                   AIHEKHVHFIKWRRGMFEKFNDQTRRTLCWEAAREGSVEILTFLLEECRWNTVFDDYGD
FT                   LYRAAIFYNPDVDHQPILSYLYEKGHGFDSRATVAAAFVGNLDTLEWLRARGCPWNSNV
FT                   VENAAEKGHLHILEYALDHGCDGGAWVFCYAARGGHIQVMEWAMARGLEWDERTCFSAA
FT                   KRGHLDALKWLRARGCPWDRWTRVYAERGRHTELLQWAIDNGAPPP"
FT   CDS_pept        362071..363294
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636522"
FT                   /orf_name="MICPUN_99342"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61682.1"
FT                   /db_xref="UniParc:UPI000199A982"
FT                   /db_xref="UniProtKB/TrEMBL:C1E159"
FT                   /transl_table=1
FT                   /translation="MRRLHVQRLLLCCALLLLPNARALWFSMPPECDGRCWEEDVKHPL
FT                   ASCDLEVVEGAITPEEADDVVAAAEAHAAVHGWHSQRHIAYPTRDLPWTALPSVARVFD
FT                   KLWGAMEESVRRRCGVRPIDRLTPNDIFVVKYTPEGQAGLDRHRDASSFSFNAALSDPT
FT                   SYGGGGTRVWLDSAVRTLREKYLRAELEGVVRDGTAPGASAEARGAAARAEATLDRPPG
FT                   TLDVDGYVVRPDRLLPEDGETRKIAKGSVMVHGGRNVHEGTAIVSGTRHIVAGFVGLNR
FT                   HCCTLRYSGWRGVMALVRVTAMNNSARGGVRDKVGGRVPLWDYVLYEEWRGVFRWIRGA
FT                   SLVLALLSLAAYAAWHVATRLSPRFNLAARRALAVVAGYESSFFRGLARKRRRAMRSAL
FT                   PTKHSLDD"
FT   CDS_pept        complement(363422..364594)
FT                   /codon_start=1
FT                   /gene_family="HOG000012606" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636523"
FT                   /orf_name="MICPUN_56756"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62113.1"
FT                   /db_xref="HOGENOM:HBG407194"
FT                   /db_xref="UniParc:UPI000199A983"
FT                   /db_xref="UniProtKB/TrEMBL:C1E160"
FT                   /transl_table=1
FT                   /translation="MASALVTARSTAPAVLAGALSRPPPRRVDRLPRSVSPRTAAARPR
FT                   EAPSRRRLAAAEEDGTATTATTSEGDDEEEIPQIEIPERPEHVRVVDAFLPAADAVALR
FT                   GVFDAHNDDPRRVHEYRFVWDYWHVPGQYTQLRTPAADYFPKEQFEQLEDALLTYAKET
FT                   LGCSAMTPVWLSNYVDGMRQEIHADVPHGPFAFVLSLTNWDKRRFTGGETFLLRPETLD
FT                   YWRGFETSSVVERGAVVQTVEPEFNRLTVFDPRIPHGVNVVEGTRDVREGRLVLHGWFR
FT                   DLAPHFSGALTEAACEPALGEILPRLYEALGALPRARGVVVIRVNVDANGAVTGTEWKA
FT                   DTLVPAPAPNLPDPTEVRDAILLEIAGTFMDAEFPAAGAPGAVTMPFEFD"
FT   CDS_pept        complement(364807..365370)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636524"
FT                   /orf_name="MICPUN_107882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62114.1"
FT                   /db_xref="UniParc:UPI000199A984"
FT                   /db_xref="UniProtKB/TrEMBL:C1E161"
FT                   /transl_table=1
FT                   /translation="MRNKGRSRRLAAAANSADAASAEATSPTSPGAGADDDEVRQPFAA
FT                   SDRVGSRAGSGAGTGPSDADTTSGDVRLNMFASSEHVGGEGDEGFRGDGATTPVEARGV
FT                   ETLAVLDEQQLWAMGLLGDEQIETKNMSREGSAHSEIGYEPAAWVDSETCQLVPELRNE
FT                   LLELMHQKRARSTEPEDVDDYLVL"
FT   CDS_pept        366970..371157
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636525"
FT                   /orf_name="MICPUN_56758"
FT                   /product="Predicted protein"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61683.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR006955"
FT                   /db_xref="UniParc:UPI000199A985"
FT                   /db_xref="UniProtKB/TrEMBL:C1E162"
FT                   /transl_table=1
FT                   /translation="MRRLFGGLGARGASGEKPKKPIRANLGDESSFYYDEKLKSWVDRN
FT                   DKSGAAGGGGGDGDASSLPPPPTSAPPTPAMPIRPSSTAASSTNGGDGDGSTAPGSNPL
FT                   SRSNSLSHVRNRYVDVFAGAASTAVSSGASTPGMTPATGSAANLLAPVLPGSFVPAPAG
FT                   ANGGATSGATAATQSGGTAGAPKFFVPAVPSQSSMTETSAEDDDDDADGVGGQVSGAHA
FT                   GGPRGGATGGAGVGRLGLDRLIVPDEGTTMLRGEGATVSPKAAKGGHHHARGPTLTAIA
FT                   TGGGAREEDTDPRNGPSGVGGDALGSSEDASGPFGSPPRRRGDDARDSKSRLGDWAQAL
FT                   GRVSEGMSSPKAAASARVSENFAPDEPAASAFSGSGGGFSDAVGGGAGSGDEPRVAPGG
FT                   FFVPTSGGSGGPSTTDDAGTSNARSLLGGDDGLLGEPALLQPAGDGGGGGKRRGGGGGR
FT                   DSVDAGAAPEELPDVPADLTYSERRERERLARLSGNAGYGVPDGTSTSPVKAPTYGAGA
FT                   YGGAYQDEYREYSDGYGDGARFGYDAATAEPSLDYQQGYEQQQQQQQQQQQQQQIQDGD
FT                   VTWSQDEQGNWWYQYPGQEAAMYVDPSVAATGGGGEGSSETVAAFDDAAGAILGAETID
FT                   PDPVALPGAETIDPPPSSGVLEILPDPEPEARVQPTTAEPEARDPSATAPAFAASGGGG
FT                   GGDGTLEPPPVVGGSDLPPPPTRAAPAPGAPPNPEDFKTDEDYDRAWQEALDAAYADAN
FT                   EAERREKIASAALEDAEAALASAKSENEAFRRELETVRAAAEASAAGAREDATAARSEL
FT                   EALRLELEGARATIEEARAEAASSRERQKQVVSSDDAGGDDGMPGGDGGDAAGDAAQSA
FT                   RAAGYRAGHADGYREGHAAATADGDEQMEDLLVCLGQEERKTERLRELLEANGVDTAPI
FT                   MAELEAEAEANMAAQMLGGGDTTAADDEETQDEVEDGPAQLDAGGEPPVREVTRSDADV
FT                   HVDDTSFASSVAFMTDASALDPPGAAGVRGFGFGPTRGVGGANGEGLTTTPAPGYGYGD
FT                   VSIDGSIHGVEVSGMASVPDTPTAGGAAVLRDISLPDIPAFRVGDEPEPEPEPEPEPEP
FT                   KEPDLPSAFGGDDDGWRDGDDGWNRDDEWNISGEIARDGEAAQNISGWDLNSPMPPGLE
FT                   AAPPPTAPPPMAPPPVAVAAPPPMAAPPMAPPPMAPPPMAAAAPPPVAPPPMAPPPMAA
FT                   AAPPPMAAPPMAPPPAAVATVPFGSPFDDAVDAGDDVAFFNQFNADVQPMVPAQPMVPA
FT                   QYQQHQQPHHQEHQHQHHHQQHHHQQHQQQADVYSFAPVQPQAHHYYGYDQAAQQQQQQ
FT                   QQQQHQQAGYYQQHQPPGQAQVQTPVNDSAMHAHTPGGLHYQAYPPAPGKWD"
FT   CDS_pept        complement(371270..373858)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636526"
FT                   /orf_name="MICPUN_56759"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62115.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199A986"
FT                   /db_xref="UniProtKB/TrEMBL:C1E163"
FT                   /transl_table=1
FT                   /translation="MPNTRKTEVIKQEANGTAGDVASVKKVDSVTNLLSPLPSIEKVAS
FT                   FGLTPNPSGNPPLNPAVNAMKKSGSGLATSASPSADAAGAGGRPVDSGVTSSGATGSDA
FT                   NALGSGFRPIKRSRRSSENHDKDVNVRDFEGVDLAGISRRFPQEKRVQLAQRIDEHAEK
FT                   VAGAWAALLLAQTGMRYAEWATTASRVEQTKQNTLRIVKAIVDYLTTASQAKLRQTISY
FT                   IVAKRRRQGFGHEEVITSMLLLRRSFEKGCGPIDGEAGFLIDAVTRVMVGEVATYLHAI
FT                   NPHEESQLDVCVATEDDDELGVEHPEDLNLPPQRHLQQDLEDVRPPMHLFIVPKVPAQY
FT                   VRAREGGTPIMLAPLWSRAAHEPSGLWTWPRGTEPLVGAIVNNRFVVEAYIASGSYGHG
FT                   WKAVDLHSKKPVFLKTPRASHDYMPSDMMGELARELGTMRRILHTIPKHPRLVNVIEVT
FT                   PPHAPKPCATSCGVTAPIHYFACDLCEGGDLFGYISTQPLEPMREPVVAHIFRQLMEAL
FT                   EFLHGRNLFHRDLKTENMLVSREEGRYSLKVADFGRTVFVPPQPSETGEGPTNIHEQFS
FT                   YDNGIFPAEAVRGGMIGDEVMAAEDGMYRLPSADVWAAGLVLLLLTGVGRMSKIKHNIA
FT                   DALRGRGERFAPLSKDETPIDRLYRLIGPGWQVSPELDQLFRAMVHKDPMMRPSAEEVL
FT                   ACDWMKKADEVTEAEVVAAFESRRPVSEEAHNTMSVTCAPRLKDTATAFDALIEALQSL
FT                   EWPTAGNDVRAEVHVDRDRLTATCVMDEMRIRAILTPVEGLLEKNPTVNMFKEGEGEAD
FT                   PVAAAKRMEAARRERENNQTPIVRLVWIGGSAGAMQLVNVYMAVSAMLST"
FT   CDS_pept        374641..377124
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636527"
FT                   /orf_name="MICPUN_56760"
FT                   /product="Annexin family"
FT                   /function="calcium ion binding"
FT                   /function="calcium-dependent phospholipid binding "
FT                   /protein_id="ACO61684.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005544"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="UniParc:UPI000199A987"
FT                   /db_xref="UniProtKB/TrEMBL:C1E164"
FT                   /transl_table=1
FT                   /translation="MSGHCPSDKWFFGSVFVFLIAVGLLVGGAVNMQSAADDPRTPRVK
FT                   TYDGYVDAWQSTHFDEYSGKYASTTPTISVARGASAGNGSTTTVSVWTKLETATIVLKD
FT                   SRSDYKRHNKHFALFTDIPNFHATGKKSEKQSEDVTLTIGSNTMKFHVTECKVTKHNRK
FT                   KKVKNANGEEVEVDDPYWTIAPTFLNRINFVESINGGSGVSTLSREKCDDVWWPVDVNN
FT                   KYTSSVAAANGCTTNLAPPSNKALEIVIRSPMDPVIKAMSIDDTGCERDFGPTADEFRF
FT                   RGIMFYSFMGVALLGAFYLLERSRRSHGWKYPMQDAIYWQIFGDPNDFRERQTFPFCCY
FT                   RIDPPKVFDTPIEKICYDISEALKNGKTKEIMGALLYDITAEANNEGMLRDEYIRERVV
FT                   EEFNRLGYGDLRAEIADKIPKANPLRDVLDALLTEQFDFEAQVLHRAMKGWGCDEDTLT
FT                   TILCTLDEADIFKLQNAYSSRFEKSLEQAMLSETEGKYKRVLLLAGCDGIAEAYAKVCR
FT                   SAIEGAGTDCKALIRLMVTCTHQVMYDTRKAYGRLYNLDLARDMSGEWAISGDFKNILC
FT                   ALVKKHPDNIETDPDYDADIQILHDAVEGLGTDEDAIIGVLRNKTEEQLQMLQRKYDAT
FT                   HCEDLKLRLKSETTGLFESEGFRNTLMGLLTNREEQIAIYLKEAFEGWFSNDDWGLISM
FT                   LVHRTPQEMELIRNAYTRVHGRDLIADIRKNCKGDYEKALVALVAPRARTYARGIKATA
FT                   KGWISSTNKSGLIALLTHKDMLMNEIRVEFQKESKGGTHLIQFLRRECSGEFERALVNI
FT                   AEYTPPASYTASNAV"
FT   CDS_pept        join(complement(380306..380458),complement(377344..380199))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636528"
FT                   /orf_name="MICPUN_56761"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62116.1"
FT                   /db_xref="UniParc:UPI000199A9EB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E165"
FT                   /transl_table=1
FT                   /translation="MGSEGAGAPPAPLRPEECLDLDLWDHIFDDAAVAKRSPLRTLARD
FT                   MRAQLEIAEKALPRTAERDALLAKLEDIAEAASRDVTLLVADWRGIEGSVVADDDETNG
FT                   TPAGKGLEHLPLQEGLPPGVNVVTRVGTVTRAALADADALALILDEHQAASAEETTTPS
FT                   VAAPYSSDAPRADETPEREEGSRQTPASSTDEGAIEGEAREGEGDDAAVTTVTTAGADA
FT                   AQLARECVKRAGEFSVFIAVEADQRPPELRFDRAAGPPTADQPEEPETPPPLDAAAAEG
FT                   SGEGHSGAGDEEPGANPLESFEAFGSWFNKMVETAADQFTGNNDDDGSSDDDGEDLSDG
FT                   GDAAAGMVKSSGPKSPEKKPAAKREKRDSESERKERERKEREAEALRRYKPKRPRDAAN
FT                   GLAARCGVRAGRILSVATMHLVPPPGGFARTAGGAAEGTAGGDDDSDAGPDGDGSKPLQ
FT                   REGGEGETEAEKAERERNAAERARAMSELYRKMMDEQDRGEGPSDDGDKTDGGDDRTGG
FT                   EGGDLTNYVDDAEIEAMLGETEAANNWSKVTDREYAWVKAVGKTCQAIMVEKTLGLIER
FT                   YAPLRAYVRYWAAVVRADETLSNHADAAEQAKAVAANTLGRILTSAAEGMPNVGFVGAA
FT                   ELAALHRRRDPSISAGWLKALIYGDSTMSFTGGTILSLGGPAAAPVTAPPALAMYFTIR
FT                   LRLCLAIAALGGCDVLGPEAGAATLACFFGTDARELLDARPRVEELDALIAAANDAAAG
FT                   GADGGNGPGRSSSWLPDVSGAMSRVFKAGASAQRVAQRCAAGYAARASAHVARRAAMGR
FT                   ETFQSGTGDVDADCTRAYEVAYQRALPREMVRAMGEHVFTAANMVVVAAELVPFVSSYL
FT                   TVRAANAAIKCHLPHLAPAAEAELENAKDSADANAAAATPSGGWTKDITDGASKVANSV
FT                   GAAASEAAARTSAAAAAAGAGIASLWSKASETAASSIKVTGLVREGGTEPVPRLSDPDA
FT                   LRTFVSTGSGGVV"
FT   CDS_pept        complement(380608..381921)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636529"
FT                   /orf_name="MICPUN_56762"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62117.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI000199A9EC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E166"
FT                   /transl_table=1
FT                   /translation="MRLAHAMRASRGSPGRGPGAARAAKGETRRPGEGPAPAKASPHPR
FT                   THRLGRADRGERRRLGDSDLRVSLASLDASTWTRIGDEVEAHAQLSLAVDNGVNLVDLG
FT                   SCDHLGDGMPRSASSSSSSSATIFELTRGRADAYLGSWLRRSRDTRREDLVVAASVPFG
FT                   AAAGAAEGGAKGRRRRIKNLVERTLMAADTDHVDLLQLHYPRRDSSAMGNSDAPDEDEV
FT                   AALLDLVGDGKARFLGVDDDTRWAALETARLFANPKILVPDGLGSFVKSARGEYNLLAR
FT                   DGFECVWVEGEDAYADALRNVGLVAHSPLANGALRSRRTAVHKSHADATTAKMIQTRGE
FT                   RGARDESVWALVDAYEEVAGQFGMCLGDLALGFVRSRWFVTSVCVRARTSDALGTTLAQ
FT                   LYDIEVTEEALAEVERVARLGRVAEEVDRGRRRWSQEL"
FT   CDS_pept        382228..383127
FT                   /codon_start=1
FT                   /gene_family="HOG000265292" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636530"
FT                   /orf_name="MICPUN_107885"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61685.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG319334"
FT                   /db_xref="InterPro:IPR006992"
FT                   /db_xref="UniParc:UPI000199A9ED"
FT                   /db_xref="UniProtKB/TrEMBL:C1E167"
FT                   /transl_table=1
FT                   /translation="MAMASSGEAARPSVIDAHLHVWPSPSAYTYAEGKAPPDSLAEVSS
FT                   AESLLEQFAKAGVDGALVVQPINLKFDHSYVSSVIDKYPGKFVGCCLADPTEHGGGVDE
FT                   LRRLLDGGYRAVRFNPGLWPSGTKMTDRVGREMFALCGERNAPVGFMCFHGLDLSIEEI
FT                   ETLCTDYPETPVLMDHFGFCKGVRDPNWQKLLGLARFPQVSVKASAQFRVTPEGANGAS
FT                   WPYVSTGEQLRELIDTFGAERVVWGSDFPFVLEQCGYSGETPAAGIIRECGARLSDEEM
FT                   AAVMGGNLRRMFPGAWSR"
FT   CDS_pept        complement(383200..386064)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636531"
FT                   /orf_name="MICPUN_99349"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62118.1"
FT                   /db_xref="UniParc:UPI000199A9EE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E168"
FT                   /transl_table=1
FT                   /translation="MQAPWVRPSTRSVGVTSTPRARCAVASSSTRATGEPSPRRCAPDR
FT                   RGGARDGRTTTIFSATTAIVPLAVAPPRRSTGRRGADFSRRGPVSLRARRARFAVVPDA
FT                   GDGETVPGGGDDDGTSDDSDPSSANQGDDRGGIVDEATEETEEEDEEDEYEEVEVEVDY
FT                   TVLDHARDAIDSLGTWSDVAGWGDDQSVTNRETSRGVGGAAGTSSFKSAATAPVSAAPG
FT                   GKLGMAPTDGVVVALAFTIGALFGRRQAEAGGASRGLAELVKSGNGGAVPGGVELRPMT
FT                   EEERIADEKRRAERRAEKERREAEATKKRKEDEAKFLAAEKKRLEKEAAEAERVRVAEE
FT                   ERRAKVRAELAERAEIERAIREEKEAKEREERERREREAEEELRKRREEEARVAAERLA
FT                   AMNAEKERRGETLKGFDVAASVTYEYRAGAGDVEVEVRARCGISSPATISDAFPTSEKA
FT                   RRGALEMCSAVAKSAVANFASDQRVRRMTGETDRCLIGVDPVTGAGFDDAEFDHWMRVS
FT                   QARTDAELRTLVMRGGAAMELKIRQPGGASNNQRETSELEFRPERASLPSADADNVANR
FT                   LTAAAAAALDNAYGVATEDLDWVARYELSALHGLDASLCFPAVSEGDGDKNRLKGTVTA
FT                   TMLTLSHWIARAKMNLASAGDAGPGLAAVSALEELASQTLSRVANAEGASWKAMYLDGF
FT                   SGDAVTRIAATARALLEEDDVIRAILERTEEEHLRKLMNQPTLDEEQFPDREEARRMRY
FT                   RAEKDAEPLAERLWAMRNSAAQLAQSGARAQARTMLEEAYTMRIDDVAKRREASGLDPA
FT                   PPGSVAPEALPELLALEECFRGEPSWDKELAGVRGQVLKAVRAAAARSLAMNDAKRAAA
FT                   LLEGAAREYGSDRKLGATHVSVAKTRDAADEAWRAAGIEADDEEAKDAALAVVAGTPVP
FT                   RGQGGGIVMKLGKTYLEELEIRRK"
FT   CDS_pept        386448..387974
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636532"
FT                   /orf_name="MICPUN_56765"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61686.1"
FT                   /db_xref="UniParc:UPI000199A9EF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E169"
FT                   /transl_table=1
FT                   /translation="MSDPIGFGELGELGRTLDEDMMMNSAVFDGALDAIYSKFDLGNPD
FT                   DLASLYGVSPGAPDVRDVRVPAQTGTGTGTGSGDGSGDGSGAFNPKIDGKAETTSTAVG
FT                   KRGRANLNQAEVQKRYRERKKNRMLDLEKQVEDLREKVKELEREKARRGDGTDLKEASG
FT                   SGNSTPPDAATTTTEGGRSSDDDTTTLLRPFAVAPGDGDPEFTERMLREDAARRSRDSK
FT                   GLKTDSGDGSGCEGHLTFIIEASEALKRGVDGPSATGKFKNYTEAEIWWGGVTEVYNKA
FT                   VRNIRDLVDVGANDSNLRSAIDAISNVVSVARESRSELAVISTMTRSAENMEKDAASKG
FT                   LDLRAACRTSCALLAKSVVDASMQSQNTQEVLTKLQNELPPKDLEIIVDWFESYTDEFQ
FT                   RIGMVRYSMIQKYEHTKLTADVPHTVYGIPASEVTKEEGPYAEDSRVIMDSLRKEMLMY
FT                   KDGIQDLLQQLPVRSAAQLYLSAFPSAPDPLSLALELKKKLRPESKATSE"
FT   CDS_pept        join(complement(390489..391526),complement(390246..390311),
FT                   complement(389410..389981),complement(388071..389274))
FT                   /codon_start=1
FT                   /gene_family="HOG000250411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636533"
FT                   /orf_name="MICPUN_93660"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO62119.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG402483"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="UniParc:UPI000199A9F0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E170"
FT                   /transl_table=1
FT                   /translation="MRDSEEEKRATEEKRATSTTLNDDDLWSRVNAAPVSAFLAVAEAE
FT                   RRRNGVAPPLIREETVARAKRGGRGGGRKKGRAACRCHGLEQLDVDAFIAHLTIGPDSL
FT                   GGKGQCEHRLDVPARPTRLAPEGSPPPALRPATVAALVASGVPLHDADHARLRLFSHQH
FT                   EGICAALRGKNVCVATGTASGKSVCYNAPVLDSLLHDPDATALYLFPTKALAQDQIRAL
FT                   RVMLDGAATYLGDHAAPIDVGVYDGDTPETERTRVRAECRLVITNPDMLHVGLLPQYKR
FT                   WARVFKGLKYVVLDEAHVYRGVFGSHVSLVVRRLRRISRELYGSDPRFIVTSATIANPR
FT                   EHAVDLWEVIDVDGSPSGEKTFLMWNPPAPRSSPIVEVAALLAECVRHDLKCIAFCKTK
FT                   KLCELVLRYCREILRDTGAGHLADSVAAYRGGYAAVDRRAVEGALFGGALRGVAATNAL
FT                   ELGVDVGYLDCTLHLGFPGTVASLVQQSGRAGRRGRRALGVYVAFDGPLDQYFMRDPAR
FT                   LFERPIERAAVDPQNFKIMRAHAQCAAHEIPLDPRVAEDNRPGGGGGGGGGGPAPDARL
FT                   VWCGGLVSDGERGPANGVSIRTIEEERYRIVDEASGRVIEEVEASKAFWEVYPGAVYLN
FT                   QARTYLCKSLDVESRTARVRLADVKYFTGTVDATTVTLVQHGSQRHAYPHRPGPAHRRP
FT                   QFPGTTAQCAECEIKVTFSAYHKIWQGTGRVFDTVSLNLPDVTYKTRAAWIRVPDGARR
FT                   ECEESGVDFRAGVHAATHAMINALPLFLMVNQSDVGAECDDPQRGHYKPTRILIFDRQP
FT                   GGVGIAERAAPVFPRLLRAAIELIEECRDCRGDRAGVAKGTGPDPPGDGSRGRREADGE
FT                   GGPDSASQTPASQTPRDQSGCPGCVHYLACDVYNVSLDRLAALVVLRSIVNAEEGTFGS
FT                   FEDAAGSDLTAAGDGRGCCANGRHGNVGA"
FT   CDS_pept        393339..394739
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636534"
FT                   /orf_name="MICPUN_56767"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61687.1"
FT                   /db_xref="HOGENOM:HBG560044"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniParc:UPI000199A9F1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E171"
FT                   /transl_table=1
FT                   /translation="MAKTSATSTAPNDAPASSPAAGGDGWTQRVLTLNPKRRGIFIWTD
FT                   ALRKNVPEIASCKAGVLNLFLRSTTAALSVNENADPDVRTDLENALDRVVPGTDVLDAT
FT                   ARSAFVGVSLDVPVQGGKLALGTWQGLYLCEWADGAEPCQVVATLVDASDDVRCTRNVT
FT                   VRAPRRGCHLVQDEVDDAFKPARDRTFKPDRTNKPGLANLLIRHTSASLTLNENADPTA
FT                   RGDLENALNRIVPEEWHSTLFSHVEEGPDDMTAHVKSTLLGCSLTVPVDAHGAMKTGTW
FT                   QGVYLCEHRNVGGMGVGHAREVATTLIDGAGVANTAGQTTVTLTAPGRGCHDVTAEIAA
FT                   AAKAIGVGSNVRTGWLNVFVQHTSASLAVCDSTLAGAGDRLERALNETVPESWNDEFFV
FT                   HTYEGPDDMPGHVKASIVGCSVTVPIVDGELGLGKAQGLFLCEHRDAGGYGCNLNRKVV
FT                   LTLQGVDK"
FT   CDS_pept        join(complement(395293..395436),complement(395142..395215),
FT                   complement(394850..395063))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636535"
FT                   /orf_name="MICPUN_56768"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62120.1"
FT                   /db_xref="UniParc:UPI000199A9F2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E172"
FT                   /transl_table=1
FT                   /translation="MPTYGTHTPDVKYVPSSLMAFGYKGVKPVPGVPNMYLKDYQDNLF
FT                   EMDIKDGAAGVSNCNFHWNDCDIAPRFGNHEDRVADKDIKYRPNVANICPRPKDWKPGK
FT                   YQSKGVDGVDVNYPRIDERNRKYWGSAGGSHAKTFPSDE"
FT   CDS_pept        complement(395586..398315)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636536"
FT                   /orf_name="MICPUN_99353"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62121.1"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="UniParc:UPI000199A9F3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E173"
FT                   /transl_table=1
FT                   /translation="MKRKAPASPPPGRDDVTVETFVHEDFAGRYDGEVDDEGRPHGAGI
FT                   LRLDDDGAWYEGEFRRGARHGQGTLHFPPDDDDDDDEDEDEDHDRKHGPMPETSLEGLS
FT                   TRGDRVVGSFADDAIEGYAEYLSSDGTRRAGLWHDGELSGLIEEFDEDGECVFGGEMDA
FT                   DGNKNGRGWFSFPDGGCYGGQLAAGKPDGKGLYLFPLTYGVCPPESKLAAATFAFWGMY
FT                   QSETKEWEAWDHRRDQAELEWQKVADGKRCPTSLAAKPDLEKDWRDEEPGPWSESPEMC
FT                   GDDPEPPAGMPERMCMYGEWVGGKCVRAGFYEGFGFWKEHFWAQPHLSPLLADIFMCFF
FT                   ELGHTEGHGEERYAIAKAAGLSMRDEIEKFQLYSTEQGCHMPNNSEGPWGVVKAGADSY
FT                   SGEKPRNHEPGELLGFVSGRRRALRGGWGERRWLPSDKIFFLGDDDGAPDPPAEGSGAD
FT                   PDGGSGAGGVFIIADDTDPVPGEAKVPDYDSEGDEKTFLTNIDVPLKRKDGSRRRIYTT
FT                   LGEHAKVVVRDPPNCERRPYVHPVLGNILALVATRKITRDEDITVPPCYDTGWRLNPRT
FT                   EAGYYYHLKNSPPAELFESGRGGEAGVGKVYVRAHGPWRALWLDKVEQGLAYDFNAGKA
FT                   YAEDPAFVDFKHDPAVLGFEYVRAMATAAVAAIGANALNARTRALCVGLGAGALPAFLS
FT                   RVVGLDVLCVEIDADVADAARNFLGVDFRETNPDDAFDVFNERSTLNDDRLSAARGSGF
FT                   GLVIEDIADFLDRDECAGSFDVVLLDAYDGEGRVPAHLRDPENKFVQKVLGSVRPNSGC
FT                   IVANLWNSEDRAEFSRERRELEEFRKQLAAGGASARADVTVSGQENNVVVLAASGAAGG
FT                   GHLASGALRRSLVEIVKAHPGVGASLVPPEHFAATEPY"
FT   CDS_pept        398943..399830
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636537"
FT                   /orf_name="MICPUN_107886"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61688.1"
FT                   /db_xref="UniParc:UPI000199A9F4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E174"
FT                   /transl_table=1
FT                   /translation="MWRRMAWEKFGREWFDACETDESILYYEHPQPNHDKWYLRLRDRE
FT                   TVVQDNGMYEITTITEYGHEAEEYRASKKMPAGATECEWAGRKYKLHNYSPPPICVDST
FT                   KEISFKLHLKCIWDVVEAAWNMMCDEVDVPSYADVRRFFYRPGQIMSMSEPECWYDDED
FT                   GEPNDRKYDRETTIQAAKEFCGNLLGLMMKHFEGADHVLRKCDWPEGEDWTDMRKEEYS
FT                   EAFKEVVDKQCEVRDGRSWSLIPLLHDKRTRVVDMLVDRIGGFRYKEGIVRTLKVLDGF
FT                   KMIDGVVTNTSIHG"
FT   CDS_pept        400211..404140
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636538"
FT                   /orf_name="MICPUN_56771"
FT                   /product="Kinesin-like protein"
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="ACO61689.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI000199AA56"
FT                   /db_xref="UniProtKB/TrEMBL:C1E175"
FT                   /transl_table=1
FT                   /translation="MPTRGAGARKVRPEGQNMRTVVQLLTAGNKNLRRDVSVASRHVSL
FT                   IRPGYTEAQTDDTYEVDDCFGSDLGNTEAYKRVLHPAVKQVIDGFNSSCITIGCSGSGK
FT                   TTLLHGRTSGDGIVRLAIKALFEGLHNKAAQVGLLLSQHKAQGGGGQSMEFAVDASFCE
FT                   VYEEKVRDLFAAARDAEAAGGKDSVKTEYLEVEETADDGWHVAGLSHRSAPDAASLQTA
FT                   YAGALNHRVTGLSEYGHSKHDRAASVLTLKVSQYIPGLPNATGEIAPAQHIVSTIVIAD
FT                   NPGAEPLAMDPAVLRLREGARLNKAITALAGVVRALATQRREFAGHGDSVLTKILSEPL
FT                   GGNCATTILGTLKLGEWERSSAVMDLVGHARRAPCFPVVQDDAARGLQQRLRSRLLQIN
FT                   DARETYRDQIQSTGADGIDPNNIGLQMAKLHELEGQLLNERGDKAELLAEKEALIERLQ
FT                   RLNGMDKANLAEKEELQKALIASEEDRLEIARALVEAQLEANEAALQAEKTRHELVERV
FT                   HELEARAIASEVRVKGAEQSYGELQNKAGSLNVENQRIKEELDQTRQELEKELKEIRTE
FT                   HAEVSGEVSSLKAANEDLSAELEDFRRKINVERRRAEDAESERDEFRANQEMYQSNMQK
FT                   KVEAAERMAEEAVKVAEETKNRLVQAAKAERDEAVAAARASKDKAVQAAQEERDEEVAK
FT                   ARSARDRAIDEMRMEKEKAVFEARKEKDEAVALANAEKAERTAYLENDRDTRVAKAEKD
FT                   KDEAIAKALRERDEAVTEAKRRSSEAIAAAQEDKDAAIAEAHRLRDLAQERLKFETERL
FT                   GSIANEANGSIQGVTRAMEEARSAERMARREADRAVGEMTQLREKLENVRAEFSQRLKE
FT                   YMLQVGDLERGAQVLATDPNADHVLRPSQLYEAAQTLALDLHRASADQVTEYRRVTEDL
FT                   QQRLTRAQRDVRALHAGYRTLRHRFEDVAPETVDEKGKAAVPHEDDLVGTPPTPAEARE
FT                   MDARGLAQKLADLRDENAALQKELRMAALDGRGPLAPHNVRAAKEAAARGGGSRPGTGE
FT                   DGEIAYYNDGNKQDRDGGFGQVGKGEIVVKKNAPDDSFGGAMAGAGENARLRAENARLQ
FT                   KTIDELKHRRPSTTEEDMRAEVSKLRIQLHALSNQDNTRAKLTQEISVLKIQLQERTQE
FT                   LKEHKNHSQREAFKQQKAAIKEFTDRVQSELEKENRALQTRAAMAEEQIKEINAYMAQS
FT                   TLAYQKEIMRLRTIIQATAPERLRSPVNPGLMGSKTQDRSGAGGAQPHQREGRGDKGGG
FT                   VRASGGWDRSTKPSEPLRPRSNNGA"
FT   CDS_pept        404237..405268
FT                   /codon_start=1
FT                   /gene_family="HOG000100023" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636539"
FT                   /orf_name="MICPUN_56772"
FT                   /product="Predicted protein"
FT                   /function="ATP-dependent peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO61690.1"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG560049"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="UniParc:UPI000199AA57"
FT                   /db_xref="UniProtKB/TrEMBL:C1E176"
FT                   /transl_table=1
FT                   /translation="MIATPMTATAPTRAIVSSTSIRRAIRPARVLGAPARRCRHTTLAT
FT                   SDSSDPAEGKGKEGAEEGDGISLDDLRILQQRVESIREREAKMDVLQLLVLDASVPGQV
FT                   LPLQFDAGGDPRRPLNGGTYVGEDVNLGDRFGMLGQAPSNGQILPNGVEVTVTRVLLKP
FT                   DGSSMVELTAGRRFKVHGQPFEDPDNDDAPSGRVVWIDPDLGAGEQTVEGADPALVHPE
FT                   APAPRDPATYDEESERLCRELPALVSTWRALVRDTGRERQPNQLELIEKHLGPQPGVSK
FT                   PARLACWVAGLINPIPALGVAYEIRPAMLMATTVGDMIGVAHKGISLSIKGLRKSAGDV
FT                   DAE"
FT   CDS_pept        405419..407098
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636540"
FT                   /orf_name="MICPUN_56773"
FT                   /product="Predicted protein"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="ACO61691.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniParc:UPI000199AA58"
FT                   /db_xref="UniProtKB/TrEMBL:C1E177"
FT                   /transl_table=1
FT                   /translation="MATSATPAGLRAPSAGRARSSRTRILAISRATSATATSQDVIARG
FT                   SARRVQIPVVDLSEPDAVCASIVRTACDSCGFFHVVNHGVDDNLAFDVIRWGATFFDRP
FT                   WDDKMALVRGDMRVSRGYEISPEHIEALDRDVTREEELAAREPSAARRIISERFSVGPF
FT                   DVPNDSYHTDEEGALFFHPNAWPEDSIPSLRPAMEAYYREMESLCARLHRVLALAMGAP
FT                   ADFFEDKIDKHCSNLQVANYPSLDPSRWRDSDRIPLRKKSHADSGTLTVLWRSPPTEGT
FT                   KGGLQVLDDTAGTWVDVPVLPGGNERESGALLINLGNQTQRWTDGKWVSTKHRVTNPDV
FT                   HAPGYAPSRRLSVAFFHKANYDAVIDHRDFVPGRERDAPSVSYPPVRSGDVSRVGALRR
FT                   LGRGVDAREASMRYHEELMGGRDRAERAAGESTAVKIDASAETEGEPPKKGEPPKKAEP
FT                   EADRWASLMDPRGQAGPISAGDLGLDRGASAEGAGAGNDNPAAGCPVCRGTGWKPCGQC
FT                   GGTGINREDLFGGKFKEGDTCWLCSGKKKTMCGNCVDLTDSF"
FT   CDS_pept        join(complement(407930..408135),complement(407540..407869),
FT                   complement(407212..407473))
FT                   /codon_start=1
FT                   /gene_family="HOG000029463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636541"
FT                   /orf_name="MICPUN_79669"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62122.1"
FT                   /db_xref="HOGENOM:HBG560053"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI000199AA59"
FT                   /db_xref="UniProtKB/TrEMBL:C1E178"
FT                   /transl_table=1
FT                   /translation="MLVREDDRQNRRGLRCFGWNKYGQAQGWDAPIDVVAVAAGERHSL
FT                   ALSAKGTVFAWGDNHTGQLGLGGEDPLPMDVPTTSLGRDVVIVGVAAGARHSVMVSATG
FT                   DVFTVGWGLYGQLGHEDAEDLFAPRRVEHLAGITVVSVAAGSAHTACVTRDGALYAWGS
FT                   NRKGELGTATGDVTKARESNDGAGSLAVAVACGSSHTVALARLESGEAGLFGFGWNNMG
FT                   QLGLGDDKDRGIPARIPLPANEKGKVTKLRCGWWHTVVGVEEY"
FT   CDS_pept        join(408660..408788,408884..410521)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636542"
FT                   /orf_name="MICPUN_56775"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO61692.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AA5A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E179"
FT                   /transl_table=1
FT                   /translation="MGKIPDTAAARKALKVAEIKALLEEAGLATDGTKPTLLERLEEHV
FT                   AKTDGDDGAEVAAPAAEPAPAPAAEPEAAAPEAAPEPVRDVPPPPVREVPPPPPAPAVA
FT                   KDDAKHEEDEEDGGEKWVLVAPAPTPLESLREMCAGCVSVEPLGGGPADGASTMALVEF
FT                   PAERDALNAVAALAALGHEAEIARRTLWQDDEDDADVTSTIVRVEGVSATIHESIVASV
FT                   FGTYGTCIAATREEGTDAFAVRMADRRGAETATAALSGVYRFEEGQEFPVRVTWCPCPS
FT                   KKSGGDRSSAAGEKRKRDEDVANGEGATLSAKQLLAVGLPATTQSGEQVAGWFAAEGGA
FT                   CTLFDKDRRCAILAFPTADAATEALDTHGGTLRPEGNPCPVTLRRIACDLDARPKKRSA
FT                   VQGPPPGVWPPVPKPGPEYGEPSAKIYIGSIPQEYAEDDVRRIFSTVGEVREVKILRNP
FT                   GDGRHKGSGFVTFSDIAATERAIHFIDNKYTLIAPAHPLQKPIYMKYAKIGRPSAAPQQ
FT                   PMVYQQPMAYQQPYYPPQQAYGHYPQHPQQAYAQYPQQAYGQYPQQGQAPQGPTHQQQQ
FT                   MWQQGFGGGAQQ"
FT   CDS_pept        join(complement(411957..412022),complement(411640..411669),
FT                   complement(410691..411245))
FT                   /codon_start=1
FT                   /gene_family="HOG000208465" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636543"
FT                   /orf_name="MICPUN_56776"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62123.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AA5B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E180"
FT                   /transl_table=1
FT                   /translation="MPRGKKKEPEPEPEENEVMEDAAVEDDDEESAELEEMKKRLAAME
FT                   EEAQKLKDEANAIGDDMNTGDGASGAADADRAEADSRSVHVGGVDYATTPEELAKHFEA
FT                   CGTVNRVTILTDKYDNPKGFAYVEFLEADAVQNAIKLTDTEIHGRKLRVSAKRTNVPGM
FT                   KQGGRGRGGRGGRGFNPYGMMMMPMMMPHMFGGRGRGRGRGGRGGRGGRGAPY"
FT   CDS_pept        complement(412297..413073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636544"
FT                   /orf_name="MICPUN_56777"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62124.1"
FT                   /db_xref="UniParc:UPI000199AA5C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E181"
FT                   /transl_table=1
FT                   /translation="MTLLTANSSIASRVRAPRASVRSRASSLRESLSGGWNIRRIVRAD
FT                   IAARDRRGGRVATAVRAADDGNFLDKLNPFKAMEKAKEKNAIAKREKEANQVINDDMRK
FT                   QLFGDGLGGRMLQGMVNNVAGALKEQMGAAAAASQETYDAAERAVRSDPKMRAALGDGI
FT                   RCTPPMSQMSSSQNVNGVQTQATTIVFIAQGSNGRQAQVQATGTGGGDQELRLDISGML
FT                   DTGEVVKVDGMGGGSMADGVFDVEAKTIDDDDVIDV"
FT   CDS_pept        413551..416436
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636545"
FT                   /orf_name="MICPUN_56778"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61693.1"
FT                   /db_xref="UniParc:UPI000199AA5D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E182"
FT                   /transl_table=1
FT                   /translation="MEEAIAAAEATLEALVKAAEDFAVPLIAEQRAVLAAADAKAADAA
FT                   SPARDAFETVRAEFEKKIDELDGALTSAVEKERAEIAVVARAAREDPFAEDEDADVATI
FT                   VASVFDPAREHLGERLRNSRSAAEKMLQWLERRAPDLDRAATDAASKAADAGDGIDDDS
FT                   GKHEDWAADEESDLEDLPPLGGDWAEDDEDDLPPLEGEWQKDAEAGPSPTPPSPKKKPA
FT                   AFKPRDASPPRGNAWGHAPPAHGRDRSDAGHRMGPAAGRDVDLRDRLGGGGSRDYGGDR
FT                   RSSFDRGGDYGRDRGGGGFRDSWGAPGGGYRDDRRGGGGGGGGHRSEYIERMERKYGRV
FT                   DDGPPPRSTMRDRSPPKPPPEVHYPTRDEQRAEAKAREERAAWRLATRPLKEFFANAKK
FT                   GEGISPSTIRELLNELSEPPFAEGRLAPNARKAFELVAASAKETGSKRTFEEVEELVRG
FT                   VVNPLYHLLTYGVKAPGAEGGGPPSSVAETIAEQMHTAAVKLLAASLDILSKGDATKKA
FT                   VESAKGIVIVREQVAAKLAGRAPGGGRGDKETTVTRRDSVDGRGHGKGSAANKPAQASG
FT                   TDADRWDRKKDGRPTPSPEVYRAPRGGEKGVGVMARLGDKNDSSSPANGVKPRAVPKVV
FT                   IHRPFSEGKQRELTPSPAQQGQGERGGKPKPSPTPPQQGQKLSPFERGPASAASQALGK
FT                   SPPSARGGVFARLEGKPKLQGLGKSDLPAPKPDAAKELPHPKSTEKELPHPKRVVVVHK
FT                   PNEPNDHKELPHPKPAPKPRDPPAPPAKGARGDKEKPAKQRDALDDALDEELAKATKGK
FT                   KGGRTKGGSDRQGAPSEPHKELPHPKPAAPAPGSEKPHPVPAPRPVSAPDSESAKQLPH
FT                   PNKPPVPKGNNGRSPIPAPKPATNTNTGGSSVGGRPGSGKARNESASPPPPKERDELDD
FT                   VLDAELEKAMGGGGGGKRRPRGGRGSRGGGK"
FT   CDS_pept        complement(416531..417379)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636546"
FT                   /orf_name="MICPUN_107887"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62125.1"
FT                   /db_xref="UniParc:UPI000199AA5E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E183"
FT                   /transl_table=1
FT                   /translation="MAPRMMHPRVGTGEPDPEEDESEEEKKDGILIPLLTFFGFVFVFI
FT                   PITVMLMGAIFGLILAEVEGWKIKDGFYYIISMLCGLPTPLTEVDPDTDEGKLVDVIVA
FT                   LWALALAGTIIGVVGGLSVINRLVDAAESFGQRFKRAARKAVTGSDEEAPAAADEDGEE
FT                   KPVSLTLNVLTFLVFIFIVIPIVIILVAVLFGFILAEVEGWKIKDGFYYIISMLCGLPN
FT                   PLTDVTPDSDEGKIVDIIIALWALSLAGTIIGIVGGMSVINTLVESAEALGERFGKKKE
FT                   N"
FT   CDS_pept        complement(417583..418845)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636547"
FT                   /orf_name="MICPUN_56780"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62126.1"
FT                   /db_xref="UniParc:UPI000199AA5F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E184"
FT                   /transl_table=1
FT                   /translation="MAPVPPALFKARGTTLRADEYLRGVNPVGTVHRGPLSAFGRQEIS
FT                   ALRTEPSVAFSRTDRLEAIRPFSIEYFLPGEGNRAYAASHAREYLARHEAEGLDRFARP
FT                   AVSEPPEPRWKTFGRSGTHHDFAKTQARGGHLPLKPDWPNKNESRWGAAERLHRPLDGG
FT                   HDLVQYSSFARQRLSTHANSPKAYVDIGAATTRAERGRQTLGRAHDERSAALGACSPGP
FT                   QVPRDRDGFALGAVGRQIEAGRVTEPRAVVGSNSRVTAPTWAPAGVKGGDWTRPVRPDP
FT                   SVPGPGAYHETFDFRRTRGERGNGDGSGRRSTGRRTHRQLITGEAAIADERERRLASSF
FT                   NPKDAGAYWGSSGRGTLPSLSSSSSPAVPPLGSLGGGSPARTYPVSGKEIRARTRSGRW
FT                   TPRDEQRGRARRLLGRASPAP"
FT   CDS_pept        419146..419886
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636548"
FT                   /orf_name="MICPUN_56781"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61694.1"
FT                   /db_xref="UniParc:UPI000199AA60"
FT                   /db_xref="UniProtKB/TrEMBL:C1E185"
FT                   /transl_table=1
FT                   /translation="MALVVTPTLASIAPAGRPSLGRSRGGTGAMTLPRPSTSSPRQPAK
FT                   PVGRSGRSSRGSIQVAASPLPIADVAALFDNPFSKAAEEVDSSLPGWFPALSFIAYVLV
FT                   LREVRRIRQREERKAREKMAKAAQEAAQRKVESMGPEVWGKLIVCLVIDALGDSSFLLP
FT                   GLGEGTDIAYAPLEAFLLSQLFRSNVVSGVGFVEEALPFTDVIPTATLAWMTETFFSDT
FT                   WPGRALGLGGDKPVEKEKDEKKDK"
FT   CDS_pept        join(complement(420044..421005),complement(419946..419955))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636549"
FT                   /orf_name="MICPUN_56782"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62127.1"
FT                   /db_xref="UniParc:UPI000199AA61"
FT                   /db_xref="UniProtKB/TrEMBL:C1E186"
FT                   /transl_table=1
FT                   /translation="MRTRPAFGRCDCAGSDRGWEVAGGYTSEASHVRRSPTPDGNSLLG
FT                   GVAQLCHAFFHCSPTPELSSHPDELCLRVACDPAGRKCETKGVVVVAALRDRAGDLRFL
FT                   SRYSNCPLSSHAEEYVVRDEELVRAVMEMAPEDDARSSTKTPGSAGTLTLYQRLQPCHG
FT                   SSDNRGPLWSCSDALVAGLHRELLGPRGVSLRVAVSYTYRAHWDVRGFESERERRWWGP
FT                   KVEAAREGIRVFAAAAKDGVTLEALNAEDWAFLVSLCDEDVARDYAAAFGEGGEGFGSK
FT                   GCGVFTAPAVAHRRAMDEFVAEQIRRHSASGPTNGRATNAAG"
FT   CDS_pept        421185..422681
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636550"
FT                   /orf_name="MICPUN_99363"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61695.1"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="UniParc:UPI000199AABF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E187"
FT                   /transl_table=1
FT                   /translation="MGLFHEGDVVSAIAAAKAKGAPLLVFILGDDPSSAEMVRALEDSN
FT                   DGGGATLRSEAGDEGWVALRLAEGGTDAANFRALCPAGNAPVAVAVDARTGAKIGEASG
FT                   ADGADVLASKLKDLREAHESDLRLQTMAALARLAGAQTPANPAPATQPPPANPAPATHE
FT                   PPAQPAPAPRADDPSRDETSRGDASFAAADADAIFAKAKAEAELNAARAEMAARIKADA
FT                   ALKRAAAIEERARMAAEAEKRREDEAKRAAEEKERKAVEARERLGVAARIQLPDGTSVT
FT                   ARLPAGATIGDVRDFLVADAPEVDWKNLEIWNAWPRRVVDESDPTATVAEDLGLGARPS
FT                   LLAIYRVGGGNGGGSVTHRAGPGGVTAGGGGTAGGGALDALLGILRKIWALVCSFLGMD
FT                   LFAARGGGAAPRGDPVSHRPTAVPRGDGADGSNPVRRSGAGGGGNGNVHTLGGLRDDDD
FT                   EGDDGRNRFWNGNSTQFGGGPADADAGDAPMDGFYTSRNE"
FT   CDS_pept        complement(422784..423821)
FT                   /codon_start=1
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636551"
FT                   /orf_name="MICPUN_56784"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62128.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AAC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E188"
FT                   /transl_table=1
FT                   /translation="MSLLARTSRAAFSFLGSSQGTRALRLASTAAPPRGHHLHTAPRHL
FT                   PASHLARPSTAPSFATRAMSSGNDQATTHVPPAPGVSKLYAAEPVAGRCALITGASSGI
FT                   GQATAERLAELGCRLVVAARRKDRLDALATRLANDFGAKVHCVALDVTDVDAVMSLPSA
FT                   LPAEFADVSILVNNAGGALGTAKCTENNMDDVATMLDANVKGVVACTRAFSPGMVERGC
FT                   GHVVNISSIAGVEWYGGGSVYCATKAAINAFTYASRKDLHDTPCKITSVSPGFVNTEFA
FT                   TVRFKGDKGKADNVYAGMKYGGPLLAEDIADNIVYALTRPGRVQVCDMLVYPTCQASAR
FT                   DIARE"
FT   CDS_pept        424141..428529
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636552"
FT                   /orf_name="MICPUN_56785"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="catalytic activity"
FT                   /function="cofactor binding"
FT                   /protein_id="ACO61696.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI000199AAC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E189"
FT                   /transl_table=1
FT                   /translation="MVVATASGDGFAPHKGALDTAARAAETMWWWDPADRADRAKDGGG
FT                   APGKTKGVVASGARAGAWRTRDELVPAGSGVKTPTPARDRARWTPWDELVDCSEAPYFR
FT                   WFAGAKTNAAFNAVDRHVLDGRGDDCALTTLPEEEDPKAGVDGARLSVTRRELLGAVAA
FT                   AARDLRDRHGVKPRDRVLFHMPTDATHFAYMLACQRLGAAYSATAVDSVEGVLASRTAD
FT                   LAPKLVIAYAEPVVHGGQPVDCAAKLRSALDALNREGSEGSEPTGRGNEQSKGNKRTKK
FT                   ASSNDVDPKSKVPKTNVPAPALVLLPRWGAKKNVASAGAAQFRSLRDEDAFKSAQKICA
FT                   CEPCDSDHPLFVSYTSGSTGKPKGVVHGHGGYVSGVLQSMTTVFECAPGEGGDGVKGGI
FT                   LTVGSAGWITGQSYMLMGPLLAGVRSVVMVGSPVYPTPLRMIRAVESEGCTLLKTGSAV
FT                   VRQLMTDPSNAAKVDAIDTSTLRCATFCAEPVSVEVHKYSHDHITDKFINSYWATEHGA
FT                   MVFSRDVAAPNGLTARGVIKSDARTWPLPWVSAALDSESSDVVIAGPYPSLALTVFGDV
FT                   QNVYDQNWRGDFAKYKETYWPKDGGGFVQGDVARASGEKGGGFTFHGRSDEVINVNGNR
FT                   VGTEQIERCLWNLEADGYGVKDCAVVGAPDFVKGTTPVAFVVFEPLARGGKKRKVGAGA
FT                   PDLAAFKSAAATAVGDKVGSYAAPDHIFAVNALPKTITNKTARKTLQMLLAGGEPPSGN
FT                   LARAEVLPPIAEAVAEWRLTAATTTSTIDLGKYWRRYTMDDHNIQGRAIVPGAGWLALI
FT                   AHEAGTSKLADVAFMRGVFEPDTTIRVVKRRRLMQATAGEETILKASLVSGDAAPETIG
FT                   PDVFGRGVALGSPSKKKPARGKENGVEENSVADNGVEQSDASRNKNAEAVGVKITDDSN
FT                   HEQHYRRCSALRLEYGGAYRAIERVAWSGHAFRAECFPRTHLAAVLDAGLQVVCASVRA
FT                   NTFIPVAVADFQITEGVDAFDESRRCVVHGEILEQYPEFLVADLRYEYEGVQGSSGVQG
FT                   SKSGGVQGSSGKKKKKASVVSSSSAAAATTGNGVFASMGRARFARVEGTKPRLQPTKAK
FT                   EANPTASPFGSQTLDPKTALARLRQLTTEQRVDAVRSVIGSIVSDLTDADVDFSKTVFD
FT                   NGMHSLNAVELLSRLNQTLGTGVTTKLVVNDAPMADFAVAVAEHATTFESTADDPNAKP
FT                   FPNVDYANLNEIVRRRLAGKTVGNTPYWFLFKYITYNFWKKSFQFFRIGGHKFLMNPPR
FT                   EIDLSLEVRMDRVVEFRDVDMNQHYTVEMIVARSVDGVEQLMAKSGLTHIEHYYRRNLF
FT                   AAKIQSTFHKELAHGDRYVIKTKITKVTGSLMDIRVAFLDPDDVLCFEILWTILIVLDS
FT                   NERLLLDWENVDLMDSGRRLIAGPGKGRAEAPTSASKGLKSSSKPSSVAGVESGRTIHT
FT                   K"
FT   CDS_pept        join(complement(430109..430266),complement(428644..429982))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636553"
FT                   /orf_name="MICPUN_105259"
FT                   /product="Predicted protein"
FT                   /function="NAD+ or NADH binding"
FT                   /function="oxidoreductase activity, acting on the aldehyde
FT                   or oxo group of donors, NAD or NADP as acceptor "
FT                   /function="protein dimerization activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62129.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016620"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AAC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E190"
FT                   /transl_table=1
FT                   /translation="MHSSSSGELETQRPVCRICWENTCEVNGSEEFLSPTPCSCRDERS
FT                   NVHQACLERWILEARSQGRFDAGTICHACGDHYSHPALSLTVLSDEAVRDAKISTASGG
FT                   GEGVDHREPLAIIGGTGYVGRSLALHLLGHPTFRLGAIVGSSATVGKPFSAVFEKKEEA
FT                   LAEHYGADLWKPMDFPTELMSARVCGVEDVIERGECRTALSFIAPEHGEIEDRLAAAGI
FT                   KVFSISPHARFDPSNPLSVPEANPEVLKDAVDKAAGEGFEGDCHSLVKSPNCVTCGVVV
FT                   ALKALDAAFGVEDVSVTTFQSLSGRGDAKYPRDVVMGNVYPLHGTVERTGEYQHGELKR
FT                   IMPDVKRVSVAAYRVPVQRGHLVDVRVRFRCETKPTARAVERALSSFDPLRDVPLPSKP
FT                   RRVIYVKPLDEEETGPRIGTPRPKDDHEYEGGMSVCVGNVVCEDELYDVRFCLVVNNVV
FT                   RGAWGAALLNAEYWHWLKGRKTAAPGEEPAAPSAAARIEC"
FT   CDS_pept        join(430660..430722,430821..432005)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636554"
FT                   /orf_name="MICPUN_56787"
FT                   /product="YABBY like transcription factor "
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61697.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR006780"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI000199AAC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E191"
FT                   /transl_table=1
FT                   /translation="MTQLELDIVGDSAAKARLEVSGYFGDPSEQSVAFRCFLKDMKFTY
FT                   DGKRRVWDGECTVLRARRLLAGAKQEGFYFLTANWDMASAKLHSLFGERLHEVFEEEAD
FT                   DQWPSYDHSCDHVLSCDDDPAAANAIAGGDSDNWTSRYRRVYFVPIVRNKMATDVAGRR
FT                   SEKTYVSLEAIGRGAFNVKDGLKACKFRWDGEVWHYDRDTDARARKSFRQTARDVRAQF
FT                   ALHHRDGIPVRLTPASDEADEMYERMRKTPVEEAEVKEEVIEFGVKEEEVEETPVGTSL
FT                   KKKKEKRDPRAPTKFNEFMRTKVAQVKSDNPTMSPKDIFAMCAAMWASAPENPKNRNMA
FT                   PPPNRKRAAPAASHAGTMMSEARSRPRVRREPDAEATSVKREQSPEPSEATAQFAAGAP
FT                   NTPGLATRTRRRSSIA"
FT   CDS_pept        complement(432175..434082)
FT                   /codon_start=1
FT                   /gene_family="HOG000201154" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636555"
FT                   /orf_name="MICPUN_56788"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62130.1"
FT                   /db_xref="HOGENOM:HBG560065"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="UniParc:UPI000199AAC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E192"
FT                   /transl_table=1
FT                   /translation="MMTRIALFLVTLLPLAAASDVGNEGWTVPPFKCFGTTAVNKYEMT
FT                   SVPSDLSGITWNPSTKTLFAVNNGDRMIYEIEYPNKLIQKWDVKALTLDLEGISALGGR
FT                   KFAITDENPVKITEVTLNTDGTYSGATTLVQGITPKAASNLGFEGVTKIGTTYYAVQEV
FT                   SPAKLWKLESGATAYTDLSGDLEKHATYQLKSIGGLTRGGDATDELFLMAKTYTGTGRD
FT                   GSSKYYQKGIIRYKISDGTILERFGGEMCNMGQPEGLTFWKDDTSGKIRMLMVGETHEA
FT                   RLYEADPSCTDAIGSITNNMATCVEKKVSTATCEKTKADGGCPWTRCDKDITDHNKICT
FT                   DDTPGVTDCTETQCFNRCNNTLVKGNKCTHWAYDVAEKECYIFAGCKNDKFDADYTTYA
FT                   MEDPTCEKTRAKAPLGCEKRRCDKDISKHNKICTDDTPGTTDCTLDQCEDKCKKHTDFT
FT                   CTTYAYDVKEKECYLFETCEGEKFDEDYSTYVLRDPTCEEPRNSTGGGGCTQRRCDKDV
FT                   TPHTKICVDDCPEAQCTIDQCEIYCAQTTFTKEHAEAYCTHWAYDEVDKECYLFYGCKG
FT                   EQYDDDYTLFTQSYGERTKLQGKHGKTIAKTPTCPAKSGAASNVAGAFTFLAAAALVAV
FT                   "
FT   CDS_pept        join(<434836..434949,435175..>435906)
FT                   /codon_start=1
FT                   /gene_family="HOG000200793" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636556"
FT                   /orf_name="MICPUN_71524"
FT                   /product="Predicted protein"
FT                   /function="UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine
FT                   deacetylase activity"
FT                   /biological_process="lipid A biosynthetic process "
FT                   /protein_id="ACO61698.1"
FT                   /db_xref="GO:0008759"
FT                   /db_xref="GO:0009245"
FT                   /db_xref="HOGENOM:HBG482342"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199AAC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E193"
FT                   /transl_table=1
FT                   /translation="QQTVRRSFTLIGVGLHSGEWETVRVCPARAGEGRYFVRVRIPAAA
FT                   ALAQDNLRLSMRLAVDDDNGVITCEHLLSALEAIGVDNARIELEGSGEVPIVDGSAYQF
FT                   AYECARVGLVPAHADGSTAEVPRMAWRPSEMITVRDGDAFVQFIPDAVTKLTYGVDFTY
FT                   KSTAIGKQWESWTPTEDGDYVDLIARARTFGTMQDYMAYFRAGYIRGGLEQCALIANGD
FT                   KFWNPPMILPNENARHKILDLVGDLSLMAEPGMAGVPIGHVLAYKGSHRLHAKFLAALA
FT                   A"
FT   CDS_pept        complement(436333..436485)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636557"
FT                   /orf_name="MICPUN_56790"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62131.1"
FT                   /db_xref="UniParc:UPI000199AAC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E194"
FT                   /transl_table=1
FT                   /translation="MPCPMCASALVANILGASAVGTAGGVAALKMKDKARKVKSSKPKP
FT                   KPKAK"
FT   CDS_pept        join(437213..437412,437529..437638,437773..437831,
FT                   437995..439098)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636558"
FT                   /orf_name="MICPUN_99369"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61699.1"
FT                   /db_xref="HOGENOM:HBG560067"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199AAC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E195"
FT                   /transl_table=1
FT                   /translation="MLLEKLPAHVLRDVFGFLSAGDVARAACACKTFKQVARSESLWRK
FT                   LLSEKLGSQASIVLPKTLPNERYPHGDMVVEPAWKEMFQFWMNPGPNSYSWMEHAKGEE
FT                   LENRGKFAARYLHRCTAIGDGNKILLFGGQGSGADFFNDLHLLDLRKKSLQLEQLDAAG
FT                   DPPFPRCSGTLTAVSVTGIPGSEVVALFGGSQGFFEGFSNSLCILQGDENVSISDAASQ
FT                   HKGLTWREPLVVAADPEDGVPDARWGHSAVSWNGKLVLFGGSNTQHCFNDTWVLDVGLN
FT                   PREPESRRLLATWKKLKLGNDARPPSRAGQTVSLVGDALYVFGGCHISDVFNDLWRLDL
FT                   GVRVPTWERLDVAGTPPAPRVGHAAVVLGDRIVFSGGRGSPTAGASGTYATADQGLATM
FT                   QGLTFFEGGFAMLDISRGTWMPIQHPNRNNHVYLRGEDDGAVDMEDAAMEDEVWEHRTG
FT                   HVMVPAKDGLLVIGGLAYNGEFQNDVQHIRVF"
FT   CDS_pept        join(complement(440268..440663),complement(439986..440123),
FT                   complement(439299..439901))
FT                   /codon_start=1
FT                   /gene_family="HOG000265463" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636559"
FT                   /orf_name="MICPUN_80065"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62132.1"
FT                   /db_xref="HOGENOM:HBG635246"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="UniParc:UPI000199AAC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E196"
FT                   /transl_table=1
FT                   /translation="MQECLTHPEFGYYMHRDVFGEAGDFVTSPEVSQAFGELMGAWAAW
FT                   TWESMGKPSTVRIVELGPGRGTLMADLLRGTKNLKGFADAVTVHMVDVSPANRKAQREA
FT                   LKCGPKTDDAENGDDNTGKNPTRHGLGKWHETMDAVPPGPTIVIAHEFFDAMPVHQFTR
FT                   TERGWCERLVAISGDMVLSPGLTPAGALMVPRRLEGVEASRRDGLRQLEISPRSLAIWE
FT                   RIAARLEEHGGAAIAIDYGEEGPLGDTLQAIRDHEFVDVLTDPGRADLSAYVDFGAMRR
FT                   VIETRKNSGVECHGPVTQRDLLFGLGIGQWLEKMVEKCATEKEVDKLIAGCERLVSGEQ
FT                   GALGEGGRTEGAGKGAGMGFRYKALAMVSKGLGKPAGF"
FT   CDS_pept        join(442341..442805,442950..443651,443853..445088)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636560"
FT                   /orf_name="MICPUN_79939"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61700.1"
FT                   /db_xref="HOGENOM:HBG560068"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="UniParc:UPI000199AAC9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E197"
FT                   /transl_table=1
FT                   /translation="MSTARPHLQLYETLVDCGRLHNALELLRALKTAGLNTVGGRVSNK
FT                   AFLRQCARRSAVAVAFDFVSFVDYPDVRLYNMLLSVCASAADSRSAFAAFVMMYDNGVQ
FT                   PDVMAYTTLISACAKAGELEKAFETFRRMEMDGLEGNVVTYGALMDALSRRVAATLRRC
FT                   FDLREEMDDAGVAPDGTMINTILSACGRAAEVRALSADALQKAFDLYDEMESSDEADLA
FT                   PDAYTYSALIKACVNAGQSMRGLSLYDRAMDPSAGIEPSIMVFQEAMIACSHLADLGKA
FT                   WAIWEDMRVERVAPDAMLYATLIAVAGRAGKREEAERVVFEMERAGVAPTPEVFASLAG
FT                   IAARAGDGAGVESAIAEVASRGLAVPLEMYNALVTAAARRGDVDAAQEAMFEAEAEMRA
FT                   AGLEPDEQTWCELLSSCARHGDASLTWDTYKRSRKAGQPPSEVALNILIGVTLLKIRAL
FT                   TDPDDRRNIKRMSQWDQDDDSAGRKKEEPEWTEWADRAIAAYHEATVAGVRPRLATFSA
FT                   MLACLRPPTLPSLRAVDRETRPGSKAESLARAVSHEDSSHEDARKYYPLRALIMYEEAQ
FT                   AIGVVPKFATETDSVYDIRKFPPAAAEVAVLTMLRVFRRRSDAHAGAGDDELPNVTLRV
FT                   LSDEEHEEMIASGDDEGRRLAQTGDRVIVLLRRLRFNYGGSLSAGRIELSGHVIKRWLQ
FT                   AKPPKDERAPGVEAGLRQNLQDQARNIRMQSFDDSDGSGYGGGATDWGAIFGRRGGGAG
FT                   GRLGVGRRPLLPRRRLVKGEKRTEDREERGVAREITSVPLARASHLL"
FT   CDS_pept        complement(445152..446276)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636561"
FT                   /orf_name="MICPUN_56794"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62133.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniParc:UPI000199AACA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E198"
FT                   /transl_table=1
FT                   /translation="MGGTDGSPGSTTGRHHRDEEERSWLEMLAADDDVEGPSLLRAPDV
FT                   LTRNGASPDAPVLDDDGLLLRPLGSLGDDDDDFACGGDVCDLVHRAPVHGGIARGVISA
FT                   LRRSATDVGGELGRRRADVRAAASPRGVAPRGEARRRPPDRGGGGHTRGQHSPLAGGPG
FT                   DASLVERLRDSLCPDRAEDLSERRGARGGLRRARTLPTNLHAHDDDLPLDPRAAQADVV
FT                   AARAVEAAAQAASPRPFGYLGVTRPPWTTRWEANLVDEHTGGHVFLGNFDQKESAARAH
FT                   DAAKLKLALGDDEPVPQDQLNFDASDYREELSAMTECTFEDFVKTLVTHSYGGSRSAGH
FT                   SKFRGVFAREDGLWEAKLDAEDAGGAREDRRWKK"
FT   CDS_pept        join(complement(447390..448301),c
FT                   omplement(<447183..447359))
FT                   /codon_start=1
FT                   /gene_family="HOG000225685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636562"
FT                   /orf_name="MICPUN_79518"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62134.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG746084"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018934"
FT                   /db_xref="UniParc:UPI000199AB35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E199"
FT                   /transl_table=1
FT                   /translation="MKFDVEVFRYIEKDAWRVLVSVEMGMKNHELVPVELINAISGLKH
FT                   GGAFKFIRDLLKHKLVHHDNSKYDAYRLTPLGYDYLAIKAFVNRGAIEGVGRRIGVGKE
FT                   SDVYEVVTEDGETLALKLHRLGRTSFRAVKSKRDYIKKTTTHTNWLYLSRLAALKEHAF
FT                   MKALGDNGFPVPVAVDVNRHAVLMSIVDGYPLTQVGPSRLETGAVGRVYKQCVDQLENL
FT                   ARHGLVHCDFNEFNIMVNPETTNITVIDFPQMVSTKHPNAEELFVRDLKCLHKFFLRRF
FT                   DYRASEDPDGRRDPVFFEIAGGGKSLDVSLRASGFTQKQSKELEEYQAAKEAEENGGGG
FT                   GGDDDDEDDDDEDDDSELDDDDD"
FT   CDS_pept        448719..449285
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636563"
FT                   /orf_name="MICPUN_107889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61701.1"
FT                   /db_xref="UniParc:UPI000199AB36"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A0"
FT                   /transl_table=1
FT                   /translation="MLRDDAERQLQERREASQSTSSSSPRSERSFFRPMARNDGTLAPV
FT                   KPAEVDVQKMVGEKDQTLVKRMDQLAGGISMSRLEISGHVRAREIAQKRRTAQEGRLRI
FT                   KTANARDILREAAVDPTRFDPASSARTHGTDEATVVELMRWYEDADVENLPNESEGAPP
FT                   GSMLKVKRTREERAADDEHAKRGAS"
FT   CDS_pept        complement(449400..451874)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636564"
FT                   /orf_name="MICPUN_56797"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62135.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199AB37"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A1"
FT                   /transl_table=1
FT                   /translation="MSWVFAGVRKSVASKYSEDDDTPPRSRKPGPSSEELREKYGKASR
FT                   EEMEGGRHESDTDSGEDVERKREAPQTPKSPSKMFTNLSYNKLTKGIVNYKFRRNKQRM
FT                   PRKAGVYYHPDGSEYDNRMRWYSINPYGNFRKNWDLAQAIILVFVSITVPFRVGLKQPA
FT                   EGPSYWVELLIDLYFWFDIAFNFCTGYEAEEEEGVIVYHPKLIRAHYFKTWFTIDLLAC
FT                   LPVDLALRATEGTLKCSMEVDGCDAREEDGTGQLFKLFKLLRLFRLVKLLRLFKIMRLF
FT                   ERYQDDLFKYMHIISVAKLVVFMLYLGHLFGCFFHYFSVSEWRTAEENAQVADGTLEPW
FT                   LKSYFGDDHPTGREVWDRYIASIYWAFTTMTTVGYGDISATTRVERVIACFGMIVGGFV
FT                   FSGVIATMADVMANANPSKKAHSEKMDKVSAFVRDNNLPREFLKDVLGFFRKQSTHPYD
FT                   QQQILMELPYNLRRKLLMHQYGHIIYKVPLFDVDGDGSLDDHVFVTELCMRMTLVSFMN
FT                   EQMIYQMGEIGRHMFIISSGKVEVLDNARKDVMCVLEAGAYFGEGCVLGDVRRRENLRA
FT                   LGGNVQLCTLLREDVDVLLDSYPHMQRLLHDSYYKRKELFKRFEQARTTQPKLTMNEFI
FT                   SSQRGLMSPLSKKRILGEDAPAPAEDTGGDEDTVGDLPPSKPPPGRSLQRLESWNVKKG
FT                   QEAKSEFLSETELEAQASIQAKMDPTLSFVLSEEGEREKADHMETFRSSKAGGGGWAAA
FT                   EGKALARRVREVEETQRRMEGKVDQLVALLTERMAAEGTPMRGEQSRAEVTPERRGAGA
FT                   SAAPVDDMTPRL"
FT   CDS_pept        452045..>452964
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636565"
FT                   /orf_name="MICPUN_56798"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61702.1"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="UniParc:UPI000199AB38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A2"
FT                   /transl_table=1
FT                   /translation="MWRRLLRGAEVWEDRQRTVLVTEASPGRWIRPVHEEDDLANPCVD
FT                   PCVECELLEDRCVGWVHVRDLQLSAPEPETHALRASRRYRGHRGLLHVPSVVAFVEAHV
FT                   ARTREDRARYKRGGTTGPSLFDASGFVQAAFANASSPRPVFIPRRVHEQHHFAEPVDDL
FT                   NEATPGDLVFFGVQPPNAFKGCVDVRHVGIITAVRCISGSSASCVELAFASVTDPIAGR
FT                   GIVARDSVIVPSRSSTPGARGGNWSTTWEFGRARPGPEHEGDAASERLAQTVLSVGRCR
FT                   RGVEGADDLPRGRTASSARCGGSSR"
FT   CDS_pept        complement(453141..454427)
FT                   /codon_start=1
FT                   /gene_family="HOG000074814" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636566"
FT                   /orf_name="MICPUN_79467"
FT                   /product="Predicted protein"
FT                   /function="translation release factor activity, codon
FT                   specific"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62136.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016149"
FT                   /db_xref="HOGENOM:HBG629764"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniParc:UPI000199AB39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A3"
FT                   /transl_table=1
FT                   /translation="MNRGWTAERAPPFTSRAPTLLARASADWDGETLGVLRRRANALET
FT                   RVKDALDVVDVERLAATVADLDAAASEGTLWDDPIKAKAVMAELADAKEQLATARGFEN
FT                   LLGDAAVALEMIDAEREDDSLSGAAANDASAGPDPTILAELSDACDNLERQLDKWEVRR
FT                   LLGGKYDAMPALVNVYAGAGGTDAQDWAEMLERMYRGWCNSRGFTWRTVERSEGEEAGL
FT                   KSVTFEVQGRFAYGYLRSERGTHRLVRQSPFKKDATRQTSFAAVEVTPVLDEGSVEELT
FT                   LRDSDLEISTMRSGGAGGQNVNKVETAVRIKHVPTGITVRCEEERSQAANKAKGLARLK
FT                   AKLVAVAEEQRAADVAAIRGDAVRAEWGQQIRNYVFHPYKMVKDVRTGKETSDVDGVMS
FT                   GDLDEFMDEFLRWKRKTEAEEEAALAANT"
FT   CDS_pept        454797..457436
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636567"
FT                   /orf_name="MICPUN_99376"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61703.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199AB3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A4"
FT                   /transl_table=1
FT                   /translation="MDGAYESARARLKAQSKREPGADPGATRFGATRSRSLLSGGTKPK
FT                   ASSDGRERATTVEVVQGADDNIVDAQGRMTRALLHDATGCRDLSSATVADLHNADLTAL
FT                   ASGDLDACPNLVSLDLSFNQLVDIDGDALAPLTNLRALIVYNNRVASVKAVARVGQSLQ
FT                   TLQCQNNAITSLDGVEHLRRLAVLNASGNPLGDCKLIGRCTTLTRLDISRCGLEKLEGF
FT                   ATLHALEELNVSGNALTEISAVAKCAKLQELDVSHNALPPSALRDLKALKRLDVLNLEG
FT                   NALDHLNSMPRMEELTELNCAKNPLRTLPDDFPAKCPELQILDLGECQLAGDVASVVKA
FT                   LCGLDTLTELRLKFNPCAGGGSGGGHRPGRTHRRSSAAATAGRSTAPAASRPPARSAPT
FT                   AAGRRIRTAGPGTTGATMSARPPAPPPRAPARPPPPPQPDVSGDVWTPAADPWRGLDRA
FT                   AAAAATLGYRREVIRALPRCLYLDDVAVGDAERGGEEGGAGPRTRPDVPDVTDVTAGDD
FT                   GDERDENDVDALLKRRPQSARRPKAADMSAKAATADGHYEDVAVKFIKEMEDYKTKMSG
FT                   LIGKIRDGLKETRQEAVAALRSDGTLEAESDAVPSGRLPSAPIVGSVPTKKVGVLNKVD
FT                   EDKVGREAEAADSALRRGAEPPAAAVVQASPSPGKRPASARAKLVEAQDATRAVLEQFD
FT                   RLFSDKLFLDDVDGVGSPEGDEGITRTPEDRRRWIVRPPSARGGRPRSARGAGGIAEKV
FT                   AAAVAAVDAQLAAEVRDQKRAASEEEGTRATALAGTSKARPRSGGGNGGAGLGDDKDGR
FT                   RLRPPSLAGGSTGTLGKVLERTRTSSAAVAASRRPPSSGRLSTSGAAGGRGVPRATFRK
FT                   PPASGERR"
FT   CDS_pept        join(complement(458803..459027),complement(458436..458529),
FT                   complement(457689..458161))
FT                   /codon_start=1
FT                   /gene_family="HOG000211098" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636568"
FT                   /orf_name="MICPUN_93665"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="ACO62137.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG749295"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniParc:UPI000199AB3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A5"
FT                   /transl_table=1
FT                   /translation="MFEARLVQGSLLKKVLESIKDLVTDANFDCSNNGFALQAMDSSHV
FT                   SLVALLLRSDGFEHYRCDRNMTMGMNLSNMSKMLKCAGNEDIITMKADDTGDVVTFMFE
FT                   SPDQDKISDFELKLMDIDSEHLGIPDTEYAATVKMPSSEFMRICRDLSSIGDTVTISVS
FT                   KDGVKFSTTGDIGQANITCRQNTSVDKEEQTIIELQEPVTLTFALRYLNSFTKATPLAP
FT                   TVQLQMSKELPVVVQYLIADMGYVRYYLAPKIEDDETAEAA"
FT   CDS_pept        459532..459873
FT                   /codon_start=1
FT                   /gene_family="HOG000183826" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636569"
FT                   /orf_name="MICPUN_80228"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61704.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR008111"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AB3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A6"
FT                   /transl_table=1
FT                   /translation="MDDDRGGRFESIPENDSGAPGPAKSVEGWIVLVTGVHEEAQEDDL
FT                   HEHFADYGEIRNMHLNLDRRTGFVKGYALIEYETKKEAQAAIDGANGSSMLDQTLEVSF
FT                   AFSKGPINK"
FT   CDS_pept        join(complement(461189..461536),complement(459947..461014))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636570"
FT                   /orf_name="MICPUN_105261"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62138.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199AB3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A7"
FT                   /transl_table=1
FT                   /translation="MVEVGAPGAAAHAVAFCRACTCAFPVVLLVFLAAFTSLPGRYDSH
FT                   VVVRSYAGYLPVVKDEPAVFGPRVPADGVTARLEEASPKEACEALTNKYEGRWIALVQR
FT                   SFGTEKCDFVTKVRNAEMAGAVAVVVFDNVDGPLIPMAKKNEDNDVNVPSVFVSKESGE
FT                   ALETLLNDPKHGKTVVVTLESPDSPFDDWPNVATSACVTFGALCVLLSVVLVLKRREQA
FT                   HLAAMAAQRPPETRLLSAEEVAAVAKTAVFSSQERVLSFLRGATCGGAHASAGDGDGED
FT                   DKLVVDNGTGDTCAVCIEDYESGDELRALDCGHAFHKDCIDPWLITKRACCPVCKHVIA
FT                   PPPPPENVPDSRRRRRSRWSVLSNASVATVGGAESADESDLEAPLLPASSPARSLRRGV
FT                   MRWLTRRTAAGHPDASPAVSPDSDADDSDPGGVDDGGDESTGPGGGEEGPAGGDLEAGE
FT                   ARAGGADGTDGEQ"
FT   CDS_pept        461794..462027
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636571"
FT                   /orf_name="MICPUN_107890"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61705.1"
FT                   /db_xref="UniParc:UPI000199AB3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A8"
FT                   /transl_table=1
FT                   /translation="MFSTRLFLVALLAVFGALTLAPAPCEGKITYIRPLWQPTSEWSPP
FT                   EEREEPAELHSAAMKLYSEYVEKSGIQPCTYC"
FT   CDS_pept        join(complement(462554..>463203),
FT                   complement(<462361..462445))
FT                   /codon_start=1
FT                   /gene_family="HOG000265856" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636572"
FT                   /orf_name="MICPUN_70927"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62139.1"
FT                   /db_xref="HOGENOM:HBG635664"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="UniParc:UPI000199AB3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A9"
FT                   /transl_table=1
FT                   /translation="KPAVVVLPGLGNCTEDYDEFASELELRGFSATVAAVGRPDWLRNA
FT                   AGLTQLAYWQGTLEPRPTVDWYLSRIADAVAAAKEKSGADRVALVAHSAGGWMSRVYMQ
FT                   DFGVDDIRCVVTLGSPLNAVPKDVPGVVDQTRGILTYVEANCAKPTELGVPVTCLAGKW
FT                   LLGVETLGGAGDAAGFLVGQGYKQVCGSAAAWGDGITPVATAHLDGADNVTLEGVFHTP
FT                   IGSSDERPWYGTPKVLDQWVDKL"
FT   CDS_pept        complement(<464529..465057)
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636573"
FT                   /orf_name="MICPUN_79707"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62140.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199AB40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B0"
FT                   /transl_table=1
FT                   /translation="MRTKLTVLPAAVARLSGLRTLILSDNSLTSLPAEIGELSQLRVLE
FT                   AERNQIASIPDEIANCKNLENIRVGYNKITDLSALADCDNLVTLVVDGNALDSLESLNL
FT                   REKQRLVTLSAKKNGIESVPADLGKCQLLAEIFLNDNKIGDLPMSMGELKEKKVRAIEL
FT                   DGNPLNDPKVKKM"
FT   CDS_pept        join(466161..466238,466379..466948)
FT                   /codon_start=1
FT                   /gene_family="HOG000243523" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636574"
FT                   /orf_name="MICPUN_90229"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61706.1"
FT                   /db_xref="HOGENOM:HBG560076"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniParc:UPI000199AB41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B1"
FT                   /transl_table=1
FT                   /translation="MALCMSTSASVAKVARPAVRASAEEKPASVPRRVTNALAAAALSA
FT                   SIALAGPVSSANAEIRLPPLDPDPERCERAFVGNTIGQANAVSDRILDLRQCNYVDKDL
FT                   STKTLSGALMVDATFKGANMTEVVMSKAYAVNADFTGANFTNAVVDRVTFDGANLSNAN
FT                   FFNAVITGATFEGTNLAGAQFDEALIGKEDVKKLCENPTLVEETRFQVGCRN"
FT   CDS_pept        complement(467081..468481)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636575"
FT                   /orf_name="MICPUN_56808"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62141.1"
FT                   /db_xref="UniParc:UPI000199AB42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B2"
FT                   /transl_table=1
FT                   /translation="MAAQIRAATATGIAHARRRRMPSRCARAFRAAASGSISGARSESD
FT                   ERTDAVRARLMRELARGRTGSVPRVMGPIVSEPRPDDGVVIDRLTLAPESRNEGLEHAV
FT                   PVAVVRPHGDWDDALPVVAFLHGTGGDTEGLMPQLMSIAARGYVAVGVDAPCHGRRLEP
FT                   GSAAHVADGDDDERSHHPSKSSAGAPAAEGLGHGSGNSRERTFERYGAALVAAWRRGNI
FT                   EGENGTGSGGNEGSRRGDARPFLFDGAWDALRALRFVTRGDEYGDLTDPSRVGIGGISL
FT                   GGMYAWLAGAADPGLVTGAVAPIVGVQHFAWGLLNDSWRARADSLPPALFAAAAEELVG
FT                   DPSAVDAGIVGAVYRRICPGLIDELDGPATLPLISPRPLLVVNGELDPRCPFPGLMNAV
FT                   TETRAAYASVGKTSLFRTLVQRRTPHRCTPEMVDVVNRWFDETLRPARPDVALPTRGHL
FT                   DPNTWIEL"
FT   CDS_pept        468580..469839
FT                   /codon_start=1
FT                   /gene_family="HOG000251397" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636576"
FT                   /orf_name="MICPUN_56809"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61707.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG527018"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199AB43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B3"
FT                   /transl_table=1
FT                   /translation="MADRKYDIVLFGVTGFTGKLACEHLLSKGYPVRWAVCARTEAKAR
FT                   SVLASIASRLGVPDDVLPPILVADLQPSNSDPEHARLRGVVRDAAVVITAAGPFEKYGE
FT                   HLVRMCAEEGTHYADTTGESDFFRRCIDLHDATARATGATIVSHCGNDCVPWDLAVLAA
FT                   AELARDRFGPRTTLSAASTFTELPPGVGASGGTLATAIYQLGKKRGGSRTAFDPLLRLP
FT                   DGSKSKEATKVRSPKSDVYYEEFGAYAGPWIMQPVMGNCVRRSNALLGYNAGEEFAYSE
FT                   AQLRHPSFIRWIADSSYNALIGAAIYVPPLCALLPAPGEGPSREEMIAGYLKLHLRAEG
FT                   KAPDGKKFKVKGLMTFDEDTGYLCTGRMLAESGMELLEAAKAGGEKKAGVLTPATAMGT
FT                   SLLRRMERELPMKWEVEIAD"
FT   CDS_pept        complement(<470440..>471108)
FT                   /codon_start=1
FT                   /gene_family="HOG000200794" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636577"
FT                   /orf_name="MICPUN_69262"
FT                   /product="Cytochrome oxidase biogenesis family "
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62142.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG317219"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI000199AB44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B4"
FT                   /transl_table=1
FT                   /translation="HLAHDMEWWAAIMATTAIMRVFVMPFMVMQQRVAARMHIAKPEIE
FT                   ALNARIKGMGGDQQVMAEAQKEIFAIWKKHNCNPAYMMLPIAVQAPLFISFYFAISEMA
FT                   KGVPSFASGGPDWPLGPISMHDLTAADPTYIMPVLSSATFLATVELGGAGNPETSGAAQ
FT                   QTMMTKWGLRALSVALIPMTAGFSKGVFVYWITTNMFSLGQTLAFKVPLIKKIVAIPEI
FT                   P"
FT   CDS_pept        complement(471802..474087)
FT                   /codon_start=1
FT                   /gene_family="HOG000201060" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636578"
FT                   /orf_name="MICPUN_80021"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62143.1"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG284774"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="UniParc:UPI000199ABB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B5"
FT                   /transl_table=1
FT                   /translation="MSLANLARASSGPGASVRRPATVQRHAASLSGTAPAKASASKIWR
FT                   RRAPVLLGARAASRDDAGPTGTSPTSSVAGSNDATGAAAASDARIPTYHLHEEEHDFDV
FT                   IVVGAGHAGCEAALAASRRGARTLLLTLSLDRIAWQPCNPAVGGPAKSQLVHEVDALGG
FT                   EIGKMADKCYLQKRVLNASRGPAVWALRAQTDKWEYSREMRLRLERQPNLMIREGMATD
FT                   VLVGSNDEVAGVRTFFGMEFRAPAVVLTTGTFMSGQIWVGRKTLAAGRAGEAPSEGLTE
FT                   SLCDLGFETDRLKTGTPARVDSRSIDYSLLEAQPGDEDERWFSFDPRAHVAREQMACHL
FT                   TRTTAATHQLIRDNLHETPTYGGWVGAKGPRYCPSIEDKIVRFADKESHQIFLEPEGRS
FT                   CPEVYVQGFSTGLPERLQLALLRTLPGLEKVNMLRPAYAVEYDFLPAYQCDNTLETKKI
FT                   RGLFFSGQINGTTGYEEAAAQGLLAGANAAAVALDGAKLVLPREGSYLGTLIDDLCTKD
FT                   LREPYRMLTSRSEYRLVLRSDNADQRLTPIGRECGLIDDERWGMFTDKMHAVEDELERL
FT                   KNTRVKSDSEVVQAILNAGAGGAKKPSRQSFTLEELLRRPEVDTAMLDGFGLGGGLTRW
FT                   DAEAVEVKVKYEGFIKRQEGQVAKVAGKMNKKIPEGIDYGAITTLRMEAREKLAKMTPR
FT                   TVGQASRIGGVTPADISSLLVHLEVGNRQKGVGKDARRAAKADRKAAVEAAEKERSETQ
FT                   SQSVAPPR"
FT   CDS_pept        474231..475892
FT                   /codon_start=1
FT                   /gene_family="HOG000264644" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636579"
FT                   /orf_name="MICPUN_56811"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61708.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG560078"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniParc:UPI000199ABB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B6"
FT                   /transl_table=1
FT                   /translation="MNTTVGLPTASVSSWRCHDRSRVQPIPSTSPRCAPRAGCPDPTFR
FT                   NSRRRVEFNTHRGGRDVSAGAKPGKGGVGGPEGPRRPSRVGSLSNGDSKRMPNKDWMEE
FT                   LSKMFPAEMAETRKKVRKEVERSIKAAKFLVAAQVCFVLAIVLVKQCIDHFTPAGFTAV
FT                   RALVSLPFILALAKSDAKSWREFVGSWRELFSSGYLVFLGILVSLGQMLLVLGLERVSV
FT                   GNTVVLGQLVPVYSATIAVFQGVESPSVGKFTAIAAGVIGAAVMLDPSQMWLSLGNMLL
FT                   LGRAAVFAAYLALQAPVLRAYLPVTVAATCQIVGAVIAIAVGIPLALTGKGGAVGVMGG
FT                   MRGTPGVAWIMAIAVAALSAAGYTLTARAERRTTPVVTACYNTLQPVIALTIMIALGES
FT                   PGIRNLLGSALIMIGGFAAVALSTNDKKRWKQSYPPGDVGVDRNFKPEDAKLATGKTGG
FT                   FGADGANVDDDGSSGTVRIKRTRGGERGFDPDTPTGTVRMTKLPGSLGAGARRPVKVGS
FT                   VVWTVAWASVMSLCALAGGGYLTWFLVYLHWKYFLG"
FT   CDS_pept        join(complement(476028..477390),complement(475970..475986))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636580"
FT                   /orf_name="MICPUN_56812"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62144.1"
FT                   /db_xref="HOGENOM:HBG560079"
FT                   /db_xref="UniParc:UPI000199ABB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B7"
FT                   /transl_table=1
FT                   /translation="MPPSRRSKGIRGWSLVIFVLAANVAYQGTRYLWRPTTGATPVSGH
FT                   QREKLEIRHRDDRRGGALLHHGHGASHGHGFHDAGVHRNDDDVEVIEEVVYEDVVVEDE
FT                   GHHGSSRGGASSGGGEGGGDPEPSGIHVMATSNGSPYQNWQTRIMYRTFLDAAKGSDMK
FT                   HFTRLLHRRTDDELMAEVPTVRVDSLHAECDRWCEFPVADRPDAIKKWLATADSRRGEW
FT                   ILMIEMDYVWKKAVPMPEPGSPAVAFHFNYINPNYPRLPEVMRSLMPPEKRDEIKMEDI
FT                   PCTGPAPTMIRRDDLVPLMDEYERIAAAIEADPVAKNRLGWVREMYAYDLAAAIAGVIH
FT                   VVQDPGETIMIAQPPADAKMGRASMYHYTWGAEYFKNGAKVWSWDKRPYVETKHVRQPA
FT                   KFKPELPPADGSEGVYNLQDGKKVSKGTDELLRDMLTLIRGAIDRLDELPHQPGCARKA
FT                   L"
FT   CDS_pept        join(complement(489271..489355),complement(485735..489198))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636581"
FT                   /orf_name="MICPUN_56814"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62145.1"
FT                   /db_xref="UniParc:UPI000199ABB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B8"
FT                   /transl_table=1
FT                   /translation="MKGPPLPHVRDWLGAQSLYLFGVWATIVGIQSGSSQSVIRTLNVR
FT                   DSSAIGTPTATTVGSEGARMLVRAGRRVSRESGGVIRPWLAPWFSASDSVRSGGGARVD
FT                   AAGAAGSIRPGAGDGFLGGPTTGTIAGPILATISPRSFWRSALEALERAIEPSATPTPG
FT                   TPVTVSDDAQRDDSHDATDAVSADASDDFLAHLPNRKSRYESDARWPRPLSAHPKVEEL
FT                   LKRKGLFAKRTGSGAISSWWPKRIIKALRRCGEDRSQADRWNRDDVLWLLRNAKGHPRL
FT                   SSREETEKCWKDKSTVHEYIAMLSLFAGRGSPLALAKSMGSDEVMEAVRQVPLGWTGLA
FT                   FRDRSGHGPERVPFGPKELSTERWRKYEKDGTREMEEPTHRPVLTERLSYASRFRKNRK
FT                   VDINEATGDNLRAYRFRWWDATHLVAITRLWGTISRKHDFIPAPQAAVLGSYTHLALAA
FT                   DAAVALSRHIEIDDGIDDDGTRFVSDEKTNPPQTVFIRKLSEPFDQYTNRGTQDGVVKL
FT                   IQYGVRGWLDMATLWGPEEPWPNGFGVDHTRSGAPGADAASRQTFHAMVPPVELAAMTN
FT                   AFIHFAGLDPKLDKDQLSTWARLNSLWSRCTRASGTNWYYANLWYPGGQGKQHYPGTHL
FT                   TRNVGIDKRKGPVDVWDACAVTAHPSGKQVTVRKSRTLEALLGVTRETATAWQATDILC
FT                   GAADAYCFAYFGGYTYPAPMSALASHVLGVADHLGTLADAGALKPPDALRSLVSIAQFQ
FT                   QAMAMAGGETSGAAGTWLKIMDVVVEAAAADGLSPTELSRALLCWGKYLEARGVEKVDG
FT                   TVPLDPIADDEGDLRRLNALVDAFARSVTEATPEDLHGVAVALDRFIDRYSDNPHALAF
FT                   TDGGDSIRAIAREAAARIVPTMAREATRRKSAHELVKTIHRGFGRRLGELPQFRQRPLP
FT                   IEFKHAMNHARDQLALHAAATADACALQAYALRFLGEDASGTPPPAPEEFLARSSAVAA
FT                   AARDGLLPTIVLARAMRAWARVRAATAGGLIADEADVAAVHEALEASSSEGGLHEETVR
FT                   MLEEAEALFRQTIAIETNAGGGTGDDVEDEDPEVEVEVDEEQDEEQDEDHDANPDLSDD
FT                   AAIEFEAVKDDWLARLPKTKAAKLLEAIDACADDLEVMEAVAASAEEDATKVRAGARAR
FT                   VLEATAKLRVARSLFR"
FT   CDS_pept        join(489452..489505,489994..490830)
FT                   /codon_start=1
FT                   /gene_family="HOG000227586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636582"
FT                   /orf_name="MICPUN_107893"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="ACO61709.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="HOGENOM:HBG292342"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199ABB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B9"
FT                   /transl_table=1
FT                   /translation="MATEAQKGTFAVKVGLAQMLKGGVIMDVVNVEQARIAEEAGAVAV
FT                   MALERVPADIRKDGGVARMSDPTMIKAIKEAVTIPVMAKARIGHFVEAQVLESIGIDYI
FT                   DESEVLTPADEINHINKHNFKVPVLCGCRDLGEALRRIAEGSSMIRTKGEAGTGNVVEA
FT                   VRHCRAVMGDIRRLQSMDDDEIFVYAKEIRAPLELVKQTKTLGRLPVVNFAAGGVATPA
FT                   DAALMMQLGMDGVFVGSGIFKSGDPAKRARAIVQAVTHYNDPKIIAEVSQGLGEAMVGI
FT                   DCKEMHFTSYAARSE"
FT   CDS_pept        join(491157..491222,491319..492827)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636583"
FT                   /orf_name="MICPUN_56816"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61710.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199ABBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C0"
FT                   /transl_table=1
FT                   /translation="MTVIPDTEDKVINAELSYAGLEITGLTEESIAAKRAATELRDALA
FT                   VSYSFKNICKIQYLGAFEKLTKLKLDNNFITRIENLDHLVHLQQLNLSFNRITKIEGLN
FT                   ALTKLKDLSLFNNEIQKVEGLDAQVATLEHLSLGNNKLDSLIDAFAGLRPFHGLRILTL
FT                   QGNPIHDDPDYKLYALGRLPWLKYLDHRRTKQDELEKARDLYVDEILEIEDRENDQRLK
FT                   AEDAAKAEAKRVKIEASNLTGVPDLFERMLAADPEYEKLRYIPNKEAPELCNGLELFKD
FT                   KYQQRCEAFTELMDDQLERKKNERAEWQAVVDGELRQKDVEAREWVTEFETLKKHALRD
FT                   CDKSEAGVTPELESRLRDLLDKSEELYNKLMAQEQWTAVVIDDLVTNYDLQLGEIVDES
FT                   KKHVMDYFEYARGLEETYFDGFNEAVGSVLMRLGQDELDEADEEVKDFLGDKDRFMNSC
FT                   QNHHDSHVNTIDTAEETMSKEEKRRHEAEVEELREWQATRNRGRVAEMLAMRKRYRGEI
FT                   EEYLEGE"
FT   CDS_pept        complement(492895..494346)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636584"
FT                   /orf_name="MICPUN_56817"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62146.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199ABBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C1"
FT                   /transl_table=1
FT                   /translation="MGSSVNAEKKAKKEKKDKKDTKDKKEAKSDAGKKDASKKTAAAAA
FT                   QPMGKAAKKKALLDWFHGALKGDTDGARADFLKARDYVAVANVIRKHARDPKLKGAHAD
FT                   AIKLLDNKGHFLNIVDVVVKDGAADASTHWDKIKAHHRAKFEKAGGKDGVAEKKRAARE
FT                   AKEAFKVLQKERAEREAKQKELAADRKEYRQKMDEVRLKGACLDWCNLGKCKFGDECQF
FT                   KHPDELKGTLVALANKIKAKDVGGKKGKEREETERRKKRKAAKKEKERDGEGGGDSDSD
FT                   ADDGGGGDSESEDSFDRAAQAEDEYDSEDFDSDLDVDVDKSTGAKTKRKKRKDKVLSVL
FT                   PGDDGSDSDGDDEDLPRMVRLRKQKQREEAEWAKAERAAKKAKQAKILEKVKAARAAKG
FT                   LEMPKRQGSRDRSGGRGGGGRGGGGGRGGRGGRGGRGGRGGRGGRGEKRSFDGQASGEK
FT                   RKKKPRHADGRHAKHAAAHAARTAA"
FT   CDS_pept        complement(494473..495027)
FT                   /codon_start=1
FT                   /gene_family="HOG000264638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636585"
FT                   /orf_name="MICPUN_99389"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62147.1"
FT                   /db_xref="HOGENOM:HBG609069"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniParc:UPI000199ABBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C2"
FT                   /transl_table=1
FT                   /translation="MAIYVKAFSLVLKTVSKPLAKQVKEMAKSHPFLRELSISMALKAD
FT                   SLYQTIMSPTPLNEPIISSGGRRMKIPKKPPVMTEDQALQAAGDFLAEATVFGIAGGLV
FT                   WWEQSKSAEKDEKKAAAAKEEREQLTTMIALQQRTLQDVTEVLKEFEQHRRETSAALEE
FT                   MQRRARERDSRRWWGWAAAVS"
FT   CDS_pept        join(495435..495616,495760..499306)
FT                   /codon_start=1
FT                   /gene_family="HOG000166737" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636586"
FT                   /orf_name="MICPUN_56819"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61711.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG330902"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015016"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199ABBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C3"
FT                   /transl_table=1
FT                   /translation="MVSTRRSPNPPPDEEEAAILALQEERKQAEAAAKEQKIAAENAKA
FT                   AAKAAAAAAAKDEGPRKAKLTSFTAPKEVLDDLPVADFQDEEGVEQFGASKRIVDRESD
FT                   YSKRRLNRSVAGDASTYAERVKEAQLEREKDNTMKQIAQKRREEAERAAADARLAAARG
FT                   DDAGGDERDALPSASAEPAAKRAKPAEVEWEDMPVAADAPAQPKPARRNRWDATPVAGD
FT                   VGGTGSWDATPKIDAGAGGGVGPTPKRTRSRWDETPLIRAGAAGDPNATPLGAGAFDGG
FT                   ATPGPGQLAGMVTPDIHGLAAQHMAAANVPMTPEQYNAMRWEREVEARNAPLTDEDLDL
FT                   MLPSEGYKILPVPDSYVPIRTPARKLMATPTPYGGATPGFYAMPDEDRGQAFDVPDTPA
FT                   DLPTMKPEDYQYFAPLLKETEEEELSLEEQKERKIMKLLLKVKNGTPPQRKSALRQLTD
FT                   KAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEP
FT                   LLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDEYVRNTTARAFAVVAQAL
FT                   GIPALLPFLKAVCQSKKSWQARHTGIKISQQIAILLGCAVLPHLKSLVEIIEHGLQDEN
FT                   QKVRTITALSVAALAESAAPYGIESFDSVLKPLWKGIRAHRGKVLAAFLKAIGFIIPLM
FT                   DAMYANYYTREVMVILIREFASADEEMKKITLKVVKQCVGTDGVEPEYIRTEVMPEFFK
FT                   NFWVRRMALDRRNYNQLVETTLEIALKVGASEIIGRVVEDLKDESEPYRRMVMETITKV
FT                   IEKLGTADVDARLEELLIDGILYAFQEQTADDGDVMLTGFGTVVSSLGKRSKPYLPQIC
FT                   GTIKWRLNNKSADVRQQAADLISKIAKVMKICEEEQLMGHLGVVLYEYLGEEYPEVLGS
FT                   ILGALKGIVNVTGMSRMTPPVKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEFVP
FT                   AREWMRICFELLEMLKATKKAIRRATVNTFGYIAKAIGPQDVLATLLNNLKVQERQNRV
FT                   CTTVAIAIVAETCSPFTVLPALMNEYRVPELNIQNGVLKSLAFLFEYIGEMGKDYIYAV
FT                   TPLLEDALMDRDLVHRQTAAVTVKHLALGCAGLGCEDALVHLLNYVWPNVFETSPHLIN
FT                   AVMEAIEGARISLGPGFVLGYLLQGLFHPARKVREIYWKIYNTLYIGAQDALVAQYPAL
FT                   EDEGERQYRRHELDVFI"
FT   CDS_pept        complement(<499470..500141)
FT                   /codon_start=1
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636587"
FT                   /orf_name="MICPUN_72415"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62148.1"
FT                   /db_xref="HOGENOM:HBG627010"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199ABBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C4"
FT                   /transl_table=1
FT                   /translation="MAEGGKTSVSNYDLDGNSFRNTMHSLNYGNVMEAAARNYMKEVKA
FT                   EEAAAANVGPIQYDLEDLEDDPELHQLHKERIQQMKEEQEKRREMQRKGHGEYRDIDEG
FT                   EFLPEVTGSFQVCVHFYHQEFERCRIVDKHMAILAKKYFDTKFIKVHAPDCPFFVTKLN
FT                   VKVLPCIVFFRNGVAYDRIVGFEELGAKDDFPTSRLENMLLTAGIIAVPEKGEDDSEDE
FT                   EE"
FT   CDS_pept        500533..502227
FT                   /codon_start=1
FT                   /gene_family="HOG000264639" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636588"
FT                   /orf_name="MICPUN_56821"
FT                   /product="Predicted protein"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="ACO61712.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG560083"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI000199AC31"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C5"
FT                   /transl_table=1
FT                   /translation="MSDVEAETAAEVEQEAGPSSPTAPPAYESIVLSDPEPAPAVSEIE
FT                   NNAAASGGNAYPSPPAQPPGARLVARVTEPVKIGDGMTAHAAYVVAVDTDMPVFRLPKL
FT                   SVQRRFSDFTWLRDKLRATFPGIILYPLPDKVVTTSPFNPEFLEHRRAGLDLFLRKTCE
FT                   HPALRESIDLVAFLQDEHGASLGSAASPWYQRGAAGTALAAADSWWQQITTATESFVAG
FT                   AGTESLLMEEDPKYLEATEYLLLLEERLRRAVRSSDDVVGAVNAGGIIVESFAENARVL
FT                   GDCEEKGAKVLLGDAAGGLGQAFRQVGAAAQTLRAPAETQAWRLADAFRAPLKRGLALV
FT                   QAAKEAIDARTDALLKLQTARARCEQKRARYEAVAGGGSNGVNGAAGAPPPVAPAPPPT
FT                   LGSTWMSSLSSITKGAFGGGAAQPSVEELQKEAESAATAKDVAQSRYDALKDRMTTELP
FT                   RLHGELESELNAAFACAAECFKDLAAAQAAAWESVVPGCSDVEPAAPPPLPEKGTDGAT
FT                   EGRVKALWTQYMGGSTTNGGGSSGGSAAAAAAAAAAEGSSPTGVLPE"
FT   CDS_pept        complement(502473..503750)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636589"
FT                   /orf_name="MICPUN_56822"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62149.1"
FT                   /db_xref="UniParc:UPI000199AC32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C6"
FT                   /transl_table=1
FT                   /translation="MSTISTAPARWCRSVRASPGRSLRHAANCFALGSAAFVLRFTALA
FT                   DADATTAMAATPDHLSTAALARDVVDLASASLYTLGSTLWLHQTVLRERLRGSTQSPAA
FT                   VADSMDEQSATRWSQPPTWNEIAELVSGNPVVCSVVLFLCGCALDDALSLSDVIAEEVA
FT                   TRARGGLSNGEIWPPSLDPRQPAQPARISFELVLPFAPGVVGAVAFGVGGAARLVRLVR
FT                   GDGDSFDTRDEANMWLPCERDDECASMVPPPEVTERLDARIANVARFAQWPLNLLASFA
FT                   FIDGAWLAEFGAWSKLAGAQPASGNVLASVGGDVINVASSLSESAARLASENYVVGNSL
FT                   ADLGSIRDDLFGGRNGSPGDATAADGLATGAHRALSSSDAAHALGGGLFLVSSVAWIVE
FT                   LRARRRLRCARRGDDGDGHGDGDGDA"
FT   CDS_pept        504300..504959
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636590"
FT                   /orf_name="MICPUN_56823"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61713.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199AC33"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C7"
FT                   /transl_table=1
FT                   /translation="MRYFMRYLLACSAGESSVGEGRAAERAESTRKTPPTMMTTRVLLA
FT                   PTTRSSIAVGKGKAFANDSTSRGATRVVTTALPSTASRAKITISGGALALALAFTPPAL
FT                   AALDPYGGVGLEIYVGPDRLPAIVEFLPTKTTGPAHDAGLRLNDKILEVNGVAATELGG
FT                   LQGVAKALRGEAGTDVDVTVGRGRGRAPLAVEKVRMKREEIAPNPRSCFVASCARV"
FT   CDS_pept        complement(505082..505972)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636591"
FT                   /orf_name="MICPUN_107894"
FT                   /product="Predicted protein"
FT                   /function="thiopurine S-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62150.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008119"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniParc:UPI000199AC34"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C8"
FT                   /transl_table=1
FT                   /translation="MKHKNSLLGEGVTSPPELSKRVFVPLCGKAVDMLWLASCGHRVYG
FT                   VDLSGVAARDFFDEAGLPRTTTPADAMVAERWSAGVKRVHTSGNIAIVEGDLFSIRPDP
FT                   DPRPDEDDARSYGWFGVMPRVDSGGSIIARSSSNIANEDGPDTSSALDARVGAQGSISF
FT                   REEALRFASGGGPAMDAVWDRGALVAVEPSLRDRYASALVARLAPGGRMLVVSLSYDPN
FT                   AGCAGPPHNVPHEELVRLYESRGCEVTLLGSEEVIESAPPRMREKISSMTESAYLVRKP
FT                   HRRGKGGFHLPRPRL"
FT   CDS_pept        507274..508422
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636592"
FT                   /orf_name="MICPUN_107895"
FT                   /product="Predicted protein"
FT                   /function="cobalt ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors, iron-sulfur protein as acceptor "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="phytochromobilin biosynthetic process "
FT                   /protein_id="ACO61714.1"
FT                   /db_xref="GO:0010024"
FT                   /db_xref="GO:0016636"
FT                   /db_xref="GO:0050897"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="UniParc:UPI000199AC35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C9"
FT                   /transl_table=1
FT                   /translation="MEFLFRTLDRSLGPLTPVHLPPELASASVPGKVRSETWVYTSPFV
FT                   RRARFTYVDGGEKTQIFNCVVYPRCVDDSTGEESHLGDAPLLGVDLLSLNGGKKILVGV
FT                   DLQPLSRSEAYLGRYVDALASLRDARFAELNLVEPSDRFYEDAQFFSPAMLFARPVPVD
FT                   VAVDCAVAAAKATGALQDLGTITAEDVCGVEWAEPNSGCGVPLVEAKTLDAVKAYAAKW
FT                   LELMDARNDDWAKAWDQGGRAGGGATSALGSRAGSFSQMLANNIKSAVGAKSEGGEDEP
FT                   AAEAADAAEGDPPAPPAEKTEEPKRAAEVRAGKYARVLTAAESAAAQDFHDMWQRSHDP
FT                   AIPMFAGWFGKEWAERLASEVLFPEDKAKEELKAWEAQQRGG"
FT   CDS_pept        join(508566..508691,508806..509182,509597..509891,
FT                   509946..510212)
FT                   /codon_start=1
FT                   /gene_family="HOG000030046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636593"
FT                   /orf_name="MICPUN_80230"
FT                   /product="Predicted protein"
FT                   /biological_process="protein modification process "
FT                   /biological_process="protein transport"
FT                   /protein_id="ACO61715.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG560088"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="UniParc:UPI000199AC36"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D0"
FT                   /transl_table=1
FT                   /translation="MPVSAQVQYYLNAKLTATGASALPYDERLKFAVRDQLLAVVERYP
FT                   SLSVRDDPFTHNDGRTVHLLRAEGTIPIYYMGVKYNIPLKMFLPEAFPHAQPICYVTPT
FT                   SNMIIKPGHSCVDGSGLVRSPYGDRWSYPRSNLTELAGLLSEAFGSEPPLFAKPAGYVP
FT                   PPPRTSPHVLAGGLSVAEGTFKARAITALSDRLRSELDVLRAQSGEEAERLLTLQAELA
FT                   RRREDIERSLREMRAERGAWEHRIGGMQAATVALEEWVSENEGKRKETEIADAAFRPED
FT                   PLSEQILEEMAKDLALEDAMDCLDEALSAKQIELEPYLELIRELSKEQFFARATTMVAR
FT                   KEQRERGVSQGVTF"
FT   CDS_pept        complement(510294..512000)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636594"
FT                   /orf_name="MICPUN_56827"
FT                   /product="Predicted protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62151.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG559531"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="UniParc:UPI000199AC37"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D1"
FT                   /transl_table=1
FT                   /translation="MGCLSSKPADSPSSGRAHDYDPNLAPEAPKPVRPRPPAPATADVS
FT                   PIGDDEEFAPMPPQPAQPAGRKTLRSGDTPSAKNIHMESTTKMLQFMKHAESMDWPGPE
FT                   SRKWNYTSVETSGSYSFTKMGNKEQVNGTIASGLSTLHSNPGKYIGCMYQTDMVDWPED
FT                   QQQYTLIEREGTVGLKYKPGEAFTVEMANYQALPHVTEVDIDSIDDGVTMQMTSHGKLL
FT                   HGPRNVPLCPGRGMGVLDRPGIKIIQNVDPGDIHQGSVGDCWLLSAISALAEFDGAIFE
FT                   LFKKTPDMHQMPRAGPNRYHVTLYDLKTWQPVDVVVDERLASNPSNPGSLFGAKPSDDG
FT                   ELWACYLEKAFVAHCGGWDHIEGGVPPHAWAMLTGCKDQYTIEMEKSGKDKGKWNCWGN
FT                   YNKDRDFYNELANSSKEKQPPMWQQDWPEVGGGGEGAITGEELFRKVVAWDAADFIIGC
FT                   ASEGDNDTVKHDGIVDGHAYTVLQAFSNVAGSGVDLVQVRNPWGSGEFEKGMWTDINGL
FT                   ASGWQKYPKVKALLQPKVAEDGLFWMSKEEFYKYFKTVYLCAKSMRDFKVD"
FT   CDS_pept        <512146..>512826
FT                   /codon_start=1
FT                   /gene_family="HOG000184445" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636595"
FT                   /orf_name="MICPUN_71958"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61716.1"
FT                   /db_xref="HOGENOM:HBG316414"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199AC38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D2"
FT                   /transl_table=1
FT                   /translation="HVVYRGPEGETTVWDDVQRRFGNKPPLPEKFVPRAYAPEEDRGLR
FT                   AAVERDGRAGGVAHVDAAGGTDALEAMEDEDAFADDGFLEEYRRKRLEEMKTAAAIPRF
FT                   GAVVEITRDSFMAHVTDPSSEHYVLVLLHRPNCPECELLNVAYRELARKHPFTKFTSIP
FT                   GKECIPGYPDRNMPTLLVYRNRDPVRTFMGLGHFGGRHMTPEGLELALNECGRVCAGAR
FT                   GGEDE"
FT   CDS_pept        complement(513056..514030)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636596"
FT                   /orf_name="MICPUN_56829"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62152.1"
FT                   /db_xref="InterPro:IPR019132"
FT                   /db_xref="UniParc:UPI000199AC39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D3"
FT                   /transl_table=1
FT                   /translation="MGGKAKGKTSGTEGTAPTASNPAEDALNSVLDGLDTPEEKLAALS
FT                   AKFLELHKDLRRTSRRCDEAEGKVGMALVERDAARQELTKNAEVNDKLQALCRTLQGAN
FT                   KETSALLREREEAQLKLREDLEAKFDEGLGAVSKRIEESASVRDDLLKENDTLRDHLKK
FT                   LVARGDLQQETYAKAKDAFDLEKQLLEARLAEAVAFNDQLTAKLQQREEESKGYLEQLS
FT                   GYADKFDTFQGVISQSNETFTQFKTDIADLSKKLIESEAAKREMEAKTLKSDVAMIKLL
FT                   EEREQLTAQCVSLKAKKDKLEGLCRALQKQTISGDKENAKAAA"
FT   CDS_pept        join(514161..514658,515308..515494,515855..519729)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636597"
FT                   /orf_name="MICPUN_99395"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO61717.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000199AC3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D4"
FT                   /transl_table=1
FT                   /translation="MFAVTQTASKALLAVPSKASKTRTGRVVVAAAVPHSAVESGKKAM
FT                   LTGILAATFAVGSVDPAQAATVFAGKYIDPNHPHCPREIDADGVISGVDPVPFAKGRGC
FT                   RGYKKKNEAAAVEAGKISLWSIKGVVSKDDATILIDFNQKDGSGESFTGKWNGVGIEFP
FT                   DGNASAPYFSMNAASGSSDVSASISRPFARSSMRCWYRFGGCHGKDGPAAVISLGLRAS
FT                   SKIPMALFGFAGADPKPEPKPEAPPAVANDAPGAVPARGGGAGAIGFSTASGTDRKPRG
FT                   GFRSASLAMAGASKAGVGSSLFTSASSMMVNPDTVDLTADDANEDESPGKRHKTSPEEG
FT                   NEEGKRKETRRYDPVEYREKQRIKREKDERTKKKRQECRQTSIFDAMAGANAPNLRGSA
FT                   DPIPKEVWQRILAHAPVSSLRDMRLVCKTLMNAVDDEGFLPFTKIAQQTRRMRTIDADR
FT                   VIAESAAGRRKPPAVSAAAGGGRVSIGDDRPARDDEDHAAGIIQRIARDKPFATPMSAS
FT                   ALAREVEIGVERAEARDGRTPVPGHVPGEGLAATVRELAGWKIVGSHGWALLAAAILVA
FT                   AEDYGTIALLLDAARRACARADREPDGDLNGGDTAGDNERRHHYTGDYCAREDLTEFIS
FT                   LLAIALTVPSRWTRGAVDAEDVVLREPSASRLAHLDAAAGYLELIPHREAAGDWGADRG
FT                   SFTSRLTHEQLSIVSADVKKDEVLLVRAFAGTGKTTTLLEYVKRRPGYQFAYITFNRSV
FT                   MEEASTKFPKLNVKCLNFHKMAYAKFGFLYRGEKFLRGTLRQYHVSKAIGVNDSRALFA
FT                   IRVLNEFLKSADLAVELKHAEAIRAEVSTKDWNKVYGKSNVKAKLGSQSPEENLVELVK
FT                   NLWDKMLNPEDSSFPMTDAGYLKRYQLACRREHNPVRLDVNFDILMLDEAQDAAPVMAD
FT                   IILSQKECGKILVGDPHQEIYSFMGAKNAMATVAATVDKSKIVERRLTRSFRFGYEIAD
FT                   VANTLLRLKGETTCLIGSRRDLPDPVWSSWSDQEEVSAVHCLPRPKDADGVTLTLQSYA
FT                   PGYAATLRTRLGDRPIREQGRQLVVLCRSNASVFDVASRILNLGIKDLKLGFIGGLEGQ
FT                   RLGQLMDIWRLAVQSDDELDAITDYFVSRFVKEYLKAKENGVKDPEPPLQALKSSAKLS
FT                   NDLEMQTKISIVEKHRGNLPELIEKLKKVDVGTNPSNLKCANYLLSTAHRAKGLEFDHV
FT                   LLWEDFLAVDHCSPVEWDSNGHATLFQIGNMFGDSEIVGADELNLVYVAATRAKQRLIV
FT                   SDALKHLITAPRCNFAATWYLRDRGTNLPLTGMTEVEAAEDWAANEVLAQRRGGPAHFA
FT                   TLRCATNTCDRCGDQSYMFQLPEGSFQADEVDNAPTLGMEVRYGRIRQGMADTDIGMAN
FT                   ADPHAVSTVPMIAPSESYAFRHNRRMCGRCVRTFAVSRRGAERYLDDDTAGAGVERTWV
FT                   DDTILENFVRHSNRVNNIDPIEGMSMMDIASVCAAERRARGEPWRGKDAAGQPRRMAD"
FT   CDS_pept        join(520294..520470,520585..521292)
FT                   /codon_start=1
FT                   /gene_family="HOG000264640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636598"
FT                   /orf_name="MICPUN_80015"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO61718.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG560091"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199AC3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D5"
FT                   /transl_table=1
FT                   /translation="MRALEKGEPVSGRVEVANRGGLILRIFNGRFRAFLPLSQMTSSRT
FT                   LDVKRSRKKNAPKSAQVGKVIEVKVTDVNDKKIVVSERALVQERGVKRLKPGVRASAQV
FT                   VSLSDFGAFVELSQDDPQAPRLEGLIHISELSWSRVAHPRDILRVGDEVDVKVLDVAPA
FT                   EGRRPARVTFSLKQLQADPLLETLDTIMPVAMPEPSVDEDELLDTPLPGLMDICSNLLT
FT                   EEGIDAVIPGRQAVEQRVVSQDLELWLTNVVVEDGYNLLARAGRQVQEIHVVTKLSRDS
FT                   IKMAIKRATSALK"
FT   CDS_pept        complement(521409..522164)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636599"
FT                   /orf_name="MICPUN_56834"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62153.1"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="UniParc:UPI000199AC3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D6"
FT                   /transl_table=1
FT                   /translation="MVAALGGDARAAGAAAPKPEINVAKLTKAEEAIFTLQPGKDAFVK
FT                   LAAALAPFRPVVDHVADALSWRSTRKAMAAQAAFTYAVLYPYVIIPGILLTLGTCTLTN
FT                   RKEDEGSGDEDDGETRSEPAKKKPTPAEPKGASWRSKARKLDARDVQRALENVATRLER
FT                   IIALTTWEDPVVTGAFVAGCLVAALFLASHSFQVVLLCVGLYATRPPSWRVVPGPLESL
FT                   LGRMPDKGEAYARLMQETGNGGKGAASGA"
FT   CDS_pept        522478..523869
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636600"
FT                   /orf_name="MICPUN_56835"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="amino sugar metabolic process "
FT                   /biological_process="peptidoglycan turnover"
FT                   /protein_id="ACO61719.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006040"
FT                   /db_xref="GO:0009254"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniParc:UPI000199AC3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D7"
FT                   /transl_table=1
FT                   /translation="MTRRVGIGLTAGPSLATIDAALVEIDPNPIRLKPVELIEFLPVPV
FT                   PPDLRARLVVARSGAAATPAAMSELDTEVGKLLADAAKKVAGARLGEVEFIASCGMPVV
FT                   RTSASSEESKSDDGAGAPPEVVRIGDAAVLARDTAKCVVSDFVPAESDETGVFSTADAV
FT                   LFRHLLDDTRTVEWHRKPTADTSCALVVVHFGAMASMTALSGTGRVLRSFDCGPGNMVM
FT                   NLIVQNAAALGLEPKDPKDEALAEKLQQPGGMRFDEGGKIAKGGRVYHGRTKDAPIDFA
FT                   WTAPFFTRSPVRRGSEADFGMEFTKTFVNRFPKEPPVRFAEVGKEWRNVNDVVRTALEH
FT                   AALCVMEGIASHVGAVSGSGNHLMGHSGSTGRVLISGGGAYNWALMARLRELGWKNLRF
FT                   ETSTECGIRADAAQAMRAATLGYLTLSGVAGPGDGEAAEGAGGAALGKVYTPGGDPAPV
FT                   FEPVK"
FT   CDS_pept        524138..525628
FT                   /codon_start=1
FT                   /gene_family="HOG000006181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636601"
FT                   /orf_name="MICPUN_113552"
FT                   /product="PfkB family carbohydrate kinase "
FT                   /function="ribokinase activity"
FT                   /biological_process="D-ribose metabolic process "
FT                   /protein_id="ACO61720.1"
FT                   /db_xref="GO:0004747"
FT                   /db_xref="GO:0006014"
FT                   /db_xref="HOGENOM:HBG560095"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199ACAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D8"
FT                   /transl_table=1
FT                   /translation="MQSLQAPTLALGVSEGAKRRAVAGSRLARPVSVRHHRRVAIRNNA
FT                   VFADADQAQRWIDAWKARLNAPRVVGVGSAGVDYLASVAAFPEPDQKLRTDAFETQGGG
FT                   NCGNALTAVARLGLRPSILTKLSDDGAGKAILDELRDDGVDTAHVVIEPGKSSPFTYII
FT                   VDREGSTRTCIHTPGPEFTPKEMPLAAIERLLDGASLCYFDGRLTEVAIEVAKVAKARG
FT                   VPVLVEGERLRDNLPALLALGDYVCTSANYPQDSNPDAPGFEAAMVAMASKLPAAKAIV
FT                   TTLGSRGAVCLVRAPAQAGKAPSRAESLADVVSKLEKDAAVGMPAGSRGVPVPAWPVVS
FT                   DAVVLTDAGDEAAAALGAVEVIFAPAVKLQKSSVVDTTGAGDAFIGSMCYGVATGMELK
FT                   DAMRLGAYVAAKKCGSLGARPGLPDISEVPEAVFQGKEKPKVAAAAVNKTASRPPAVRK
FT                   AKAPREMTDIDKEFADGTRKSIAPGLSKWMLKLGRRYQ"
FT   CDS_pept        join(complement(527477..527570),complement(525695..527331))
FT                   /codon_start=1
FT                   /gene_family="HOG000075104" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636602"
FT                   /orf_name="MICPUN_113551"
FT                   /product="Calcineurin-like phosphoesterase "
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO62154.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560096"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199ACAC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D9"
FT                   /transl_table=1
FT                   /translation="MSAFAMTGAAAPAKIAAKYNLGRNSKALNAKATLRAARPASMRVQ
FT                   ASATPTSLTITPGDPSNYTLAILGDLHMDPRDTEHSYEGRDHIKKILDESPNPFLVSLG
FT                   DLGESKDVNESKQLFAGTTDCFKMVREFLDGFGHKYDIVGGNHDLEGIDEFATDAENLE
FT                   AYLKYMGKETPQFCYEVAPKTLIVGLGSTQFRDAQYTSHEVAIDQEQLDWFVKTIEEHP
FT                   FEDGWQIFCFSHAPIIGSGLRVLQECHVVNGCCWLNHNDKRNSKLFIETVRKSPQIKGW
FT                   FSAHFHLSHDYEDSITFPGGNNRGSCVFAQTGVMTARSSRDGRRQSRLVRGNSQGFEVC
FT                   TVDHSKGGVVRLDATVMFSDECEVNLDDPTPADEQDIRGCSVMTFAHEHEDYDHDLWFS
FT                   AYVPKEDDGCRVNEPCASGTLGVVEGDFSSRDPVKWWYMKDGAVLGGHNGMIIEYDPST
FT                   LAPLGMVVSRDELENRRVAVIDDEWGGDCLCLFDDETGDVTVVQPNEDGSYWRKVVRNK
FT                   MYRMKEMRRVKAAKNYFQKMKGEEVELNVLSSYGPYTGTAGQVMGISTRAINPKAVVKN
FT                   "
FT   CDS_pept        528027..528515
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636603"
FT                   /orf_name="MICPUN_56838"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61721.1"
FT                   /db_xref="UniParc:UPI000199ACAD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E0"
FT                   /transl_table=1
FT                   /translation="MKIRAAKKKQNKKVKAAKARAKHAREQRKKAAAGAGRDGDDDHEM
FT                   DAADAEVNAADEDVAIAEAASENPKLSGRAARALAVQARRTLKQKLSQLKDQRQKIAKK
FT                   SIARRDERKALGAKIKAAFQVSKNSTGDAEALLRAAEDLPDDDDDDNWADEDVEMAMD"
FT   CDS_pept        complement(529619..529954)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636604"
FT                   /orf_name="MICPUN_107897"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62155.1"
FT                   /db_xref="UniParc:UPI000199ACAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E1"
FT                   /transl_table=1
FT                   /translation="MTEVFCEEQGEGATGTFRTLGVSGALNAAVAVAAETANAPPAARG
FT                   RGGSAAKPTGGESVCQSERDSRPGYEYLTAAELRRVGAKMSVGGRGLERVERSGGQYYL
FT                   QSARDYD"
FT   CDS_pept        531669..532547
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636605"
FT                   /orf_name="MICPUN_56841"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61722.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ACAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E2"
FT                   /transl_table=1
FT                   /translation="MNTIWHPLLLNRDPIVVKEESDDDHHNPPAVNVEPPADDHGEDEK
FT                   TEDLAGKMSTIWRPNLGRLYASVAEMEGSESEEEKEDATKKGVKRKRAPRTKGPCEHGV
FT                   KYRSNCKVCGACPHGKWRSRCKECGGSGICEHGRQRSKCKECGGASICEHSRQRSQCKE
FT                   CGGSQICKHGRRRSRCKECGGSGICEHGRQRSKCKECGGSQICEHDRIRSQCKECGGSQ
FT                   ICKHGRRRHYCKECGGSQICEHGRQRHRCKECGGSQICEHDRIRSQCKECGGSEICEHG
FT                   RRRSECKECKK"
FT   CDS_pept        complement(<534147..>534443)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636606"
FT                   /orf_name="MICPUN_76642"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62156.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199ACB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E3"
FT                   /transl_table=1
FT                   /translation="LETVRNLVFLDLYANAVEKIAGLECVPQLRVLMLGRNRIRSIGAG
FT                   LARLQRLDVLDLHNNEIASTSGLNSLASLRILNLAGNRLVSLGDLGNMTGLHEL"
FT   CDS_pept        535341..536705
FT                   /codon_start=1
FT                   /gene_family="HOG000100024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636607"
FT                   /orf_name="MICPUN_99400"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61723.1"
FT                   /db_xref="HOGENOM:HBG560099"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI000199ACB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E4"
FT                   /transl_table=1
FT                   /translation="MGKLGELMGDSWDNAVKNNPIPVITKKMRKPGETAAYVRAQGSSL
FT                   FGIAEGLGLQYRMGAYTQVDDDLLDEDPGLNQLLVSTGSSISQLFTQDMWERHRGVSRY
FT                   WRHLATITKSTVFNRIVEPVLLIAAWATFWCLWNGTLVPVVQAFGEATLEASSGVAIVE
FT                   RIAGITGGVKFTHAVAVLASLAAPVCVPSTAHALAGTALGLVLVFRTNSASARLNEARV
FT                   LLGNMVRLVRDLTRLCQYIPEGDRRCEGVRRSVVRYAAAIGLAIEAHMRKGRTRVDPDD
FT                   PTAFKVDPSRNLTRIFGETEAKRIVNLPGASHNLPMVMNAQASKELRRALKAGMPHMIH
FT                   RECEEMVAELGKISGGAERIISTPIPLSYTRHTSRSLMIWLLTLPFALWETFHWATVPA
FT                   VFALTYLTIGLDEIGIQIEEPFSVLPVKPLADVCERDVRALDQLLELGGFPEGDR"
FT   CDS_pept        536937..539837
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636608"
FT                   /orf_name="MICPUN_56844"
FT                   /product="O-methlytransferase"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO61724.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR021121"
FT                   /db_xref="UniParc:UPI000199ACB2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E5"
FT                   /transl_table=1
FT                   /translation="MGFGRREAAREVEKVEVGAGKLKRRLLADDERTAPAPRPAASSSR
FT                   RVALTRAIGGAAFVYLAHRAWPRVRQDGGRVLRALKRGLGGLNPLKGRRGRGGRRGRRR
FT                   GASGDAAHDAGREGGNSSRDEAVEKISRSAARRDGRERDDASPPSARELPVAVSDSSKS
FT                   IAALRALEEDARRPLFDDPFAAALAGPDAIARVRSRDGDKGRIAIRTRFFDDAVLDAIE
FT                   SGTRRQREWQVVLLGAGLDTRAWRLAPRAGDKVAAVFEVDVPEVLGHKAKVMAETFGVD
FT                   FPLSLGNTYASVAANVAKRGWFERLRDAGHDPARPTVWVLEGLLYYLSQEAADELLRTC
FT                   AGASAPGSRLVASAVNGPSLARARARGNRGGAKATWASAIDEPVEPFLRRLGWAAATVR
FT                   QPGESGCEYGRWRGEPPPPRDPVERPDDAPPRTWYVVAEVSREAAATKTSAITRSDDRS
FT                   FGRSRPPHRVRGDHSSGEDGGGGSYARRFDFRRDDSKERGGRDDSRGGRWTTREGSERP
FT                   AGRRSRNDDDDEDDDDEEDGGRSRERAPEPAETSSSFGSDERDGSDEHDGPEDAEVDSL
FT                   RRRRLERRYSSGAASARSSEGIRGSTRQDSAFGSYGDIGAQHVSRAHTHRHRDEAIGSP
FT                   SPSPSKVVSVAASAAARLREIEADRERRRRAEEESELRRRAREMAEKKRHRKEEEDERR
FT                   KRVEAAAAAAGRVGRRVSPGAPGSGSDRASTLAAGATSSSNGAVVRSDRLDFRRPDRAF
FT                   DARAGEILRDDDDLPNFGALTDAGFARWRDGTREDWAALCRPTEHLSPSTCVFDVFERS
FT                   SGTMIGVAGFHVLDADASRAYLAVCIERPSRRRGYARECWEAMADFARSDLAFHLGVET
FT                   VCARVPTANEPALFFVKDTRGFASPFSSPTGKAGGVHAQTFRRRALSKAAGARRCPGLK
FT                   RSLDDPNAPVFGADAADAGTCQTFYLDVRYWGGGAA"
FT   CDS_pept        complement(539975..540919)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636609"
FT                   /orf_name="MICPUN_56845"
FT                   /product="Glycogen synthase"
FT                   /protein_id="ACO62157.1"
FT                   /db_xref="UniParc:UPI000199ACB3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E6"
FT                   /transl_table=1
FT                   /translation="MSAGASGVLHEWASTGRRAGPAFARAHPRSRASPFRRLAPRRGAA
FT                   VVVGTGLFSSGASWNPATDLALETNYDLYMRPGDVEYNTTIEREVYDHVVGKAANKLVT
FT                   QREYGLDEDHRAPLVGFIADLANERHTSSGDPTASGTDVLLALVPHLVADGFQIAVHVS
FT                   PGDERLEALVRALAATHPGRAAGAVVARRDSCESPKSNDVADDDAARRRVLAGADLLAV
FT                   LGRGPDVADARAVACRYGAVPVSRGKSGWGLSRSVPWIRNAIKGKRKKDGFVYDADADV
FT                   DGARAAFAEAAASFGDENEWATIVAGVMEETRR"
FT   CDS_pept        join(541087..541089,541348..541554)
FT                   /codon_start=1
FT                   /gene_family="HOG000244095" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636610"
FT                   /orf_name="MICPUN_56846"
FT                   /product="Ribosomal membrane protein "
FT                   /protein_id="ACO61725.1"
FT                   /db_xref="HOGENOM:HBG560102"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniParc:UPI000199ACB4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E7"
FT                   /transl_table=1
FT                   /translation="MAASKRVFAASSAKFHKNIHKRGLVDIKAKEKSKYGFSVGPVMLG
FT                   FFVFVVIGSSLLQIIRTASAGGPM"
FT   CDS_pept        complement(541686..543254)
FT                   /codon_start=1
FT                   /gene_family="HOG000264642" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636611"
FT                   /orf_name="MICPUN_56847"
FT                   /product="Major facilitator superfamily "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62158.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG609118"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199ACB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E8"
FT                   /transl_table=1
FT                   /translation="MLFMIASLAALGGFLFGYDLGLIAGALLYMEPDLRLTEASEELIV
FT                   GMAKLGAVFGTFVGGALMQEHGRRKAIAWNSGFFLLGPFIMAVGDDAATVSLGRFVVGM
FT                   GVGASAVVVPAYVAEMAPKDRRGSVVTVYELMVCLGMITSGLVDWGLRGVEHSWRWMVA
FT                   MPMFPAVLMLAGSAALPESPRWLVIRGRLRDALDVIHSLREGSGVDRDGEDVSTAAVEA
FT                   ELMELWSAVEKERAQVGEPAGEPDASAAADVGAAADVPAQKSATSSGIHGRGMLAVGIQ
FT                   MLRDIRGLTSGPERNAFAIALWLAFFNQATCSTSVINFAPEVLERVGVDSKDDAVLLAS
FT                   AVSLCKLLGVSASMFLVDRAGRRTLLLVGSHAAAAAMAGLAIAYDAGDAFGSLLCMCVF
FT                   MLAFSASWAGVFWVVLSELFSMRVKSAAVSAAAATLFATGAFTDFVFLSAARAMGGWAF
FT                   GAVACVCVCAGVYVQRNLPETAGKSLAEVQAVMAAGTGARGEGPGWLTRLRRGPAAGGR
FT                   YVEMS"
FT   CDS_pept        543380..544528
FT                   /codon_start=1
FT                   /gene_family="HOG000264643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636612"
FT                   /orf_name="MICPUN_56848"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61726.1"
FT                   /db_xref="HOGENOM:HBG560103"
FT                   /db_xref="UniParc:UPI000199ACB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E9"
FT                   /transl_table=1
FT                   /translation="MSGSPPLTPSRAEGDVKGLRRGMNALATMNGARAMAPSGAVARAR
FT                   APDTRATASRVYARRVGTSRGTLLAKVPSRLGRPHSWRPQLPPKRRRAITRAADDPERR
FT                   RPGFNKKRLASPKFSEEAQTWALLGGIATSLTAIVAVVVAANNEAAYFGSPDDFSYMGD
FT                   DFTGGPSLDVSPGNVAAAAIWSFGLFFKSPLQILLVFLGRTDTERPSDWLLRKSSGVTE
FT                   ETRTWEEASAPQKAALIAFFTVCGCGVVSGIDALFAGEETWALSAGLGFTMLAFVAELG
FT                   SPRRYSRAELDVLEAQYDDFVAFADEALERRGRCHGSEVERAFRRRFGKYTEAVLSDRD
FT                   LRTMILNWHPNAERTSSGYYKNLSVKEGVDRRNPVTVKDLGL"
FT   CDS_pept        544717..546186
FT                   /codon_start=1
FT                   /gene_family="HOG000180745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636613"
FT                   /orf_name="MICPUN_56849"
FT                   /product="RNA binding protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61727.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG558924"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006529"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199ACB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F0"
FT                   /transl_table=1
FT                   /translation="MPEERERSRDRRDRRRDDSRDRRRRRSYSRSRSRSATPPPRQRRR
FT                   PTGFSDAPPPGFSGADGAVGGAGVPPGMGIGGADIPPGMNVSVAGAPSGFSGPPPGYAN
FT                   AHPGNLGLNPVPNQQATRHARRVYVGNLPGTVTEPKVAAFFNNAMHAIGGTVAALPGDP
FT                   VLNVYINYEKKFAFVEFRTVEETSNCMALDGAVLEGIAMRVRRPNDYNVMAASSLGPSQ
FT                   PKDGLNLEAIGLNPAAAGGGGAGAANASLTEEDLQHRLFIGGLPYFLTETMVKELVEAF
FT                   GPTKQFQLVVDRETGNSKGYGFFVYQDHSVTDVACQGLHGMKMGEKSLTVQRAMQGGAG
FT                   APKPTAASVGPGHTALPGADEVAAHLAGASGAPAGLSVPPPPSEHPASRVVSLTEMLDV
FT                   EELRDDVEYGEIMEDMREECGKFGRIESIVIPRPGDADGAAVPGLGKVFVRYEDDAGAA
FT                   AARNALHGRKFGGNVVKADFIDETVFASRAF"
FT   CDS_pept        complement(546291..547241)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636904"
FT                   /orf_name="MICPUN_56850"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62159.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199ACB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F1"
FT                   /transl_table=1
FT                   /translation="MSGGFAVLLDDVEDLAQDLARFALADAPASCSDRDASGSDGDDDG
FT                   HPRPRGADIVRVAPSTVAPPERPLTSTPPRVILLDDPGSCADAMRELIARGEPCAVDFE
FT                   GVALSRTGAISLAQVAPPNGPVYLVDVACMGAAAFDEGRLGELLGATHPLKLVFDCRGD
FT                   ADALHHQFGVRMRGVFDVQVAFCLKKDVDHGGKRGAYLMGLRKALKECPGLDDEARHEL
FT                   DAVKSAGASLFAPELGGSYDAWTKRPMHPDLVKYAAADVTYLHHMHRTWRGFCGEKKMA
FT                   AVTERRMRERIESPEGLEQGTEAAKRRGSRREKFF"
FT   CDS_pept        547768..550143
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636905"
FT                   /orf_name="MICPUN_56851"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61728.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199ACB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F2"
FT                   /transl_table=1
FT                   /translation="MPRKRPKKNADDDGGSDECPLLSLAHQVMTPIAAHLDGDDLSALA
FT                   RTCVAMRRLCDGPQGRIWWRDACVRLLGKTHCAVHLRAWGGPDGGYDDARLWRQLHRHA
FT                   SFPVSFSWHAGLGGSLWEGVQNKDEAARREALRRAEARLGPLEEYDEDVDWVEQDDDTS
FT                   YTGAAILPRSDRARADVAERGPLAVAPQLSPDLARSGHTSTLIDELGLMVVVGGMMLVS
FT                   MVAGDNEHPPAPPDFNGGDEGDVKVHAVRLPEMQVVAPDVMNWTSASEARDEEDPMSAK
FT                   EPCEVPASRFRHQTIDASLPLGSRLSWNAFGDDGRGWGADGTDYSKGATLLVHGGYDGI
FT                   SRCFEKVYLLRVARDGSRCLWGDPGAPTNLVNGERMPRVFHHTLTRLRNSPRAISIGGQ
FT                   TDEDQRTQDDLGHGAVHEMNLDTWTWTRRETNGWPARQVGEMDVTLTSRWLHIAALRPP
FT                   RERRVYRNWTQWNRNSYLYAPVPRDTRVRKHSYKEAMAVMSPYMTKLERAQGEQIVIVG
FT                   GYDDSPDSAIGTMEPWVLDVESWTWHRSYWGPDNYESHTPDGEFIQYIPDGRHRAGSCM
FT                   IGQNLLLVHGGMGKSLMFGGINMLDESDSCVLDLSTLTWIHPDQGLHPRDSGLMFDDAW
FT                   QSVRLRSVAGHTLEGMLAFGGCELGFMRQPTPIAKMDFLILGPTPGVGCSRSPRNKLLY
FT                   YAAAPIGKLQRDSWRSLFRTASERVSKYRVRGFHRIVIDGRERRVMLLEHRDGSKGGLV
FT                   SVRHIGNHGSFCDERWSFWYEDSDSDFHSSSASDEDSD"
FT   CDS_pept        complement(550283..551188)
FT                   /codon_start=1
FT                   /gene_family="HOG000034586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636906"
FT                   /orf_name="MICPUN_79714"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62160.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG704164"
FT                   /db_xref="InterPro:IPR000097"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniParc:UPI000199A5C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F3"
FT                   /transl_table=1
FT                   /translation="MRWDVTDPPLPPRAPRLDRALHPSKLTVLSWNVNSIRALLDKDPD
FT                   ILDEVAASEDADVVLLQETKLQEKHVPEMDARVLAKYPYRTWNCSTSRLGYSGTAMFLR
FT                   LEPTRAPWHDPFEMDEFEGEGRVVCAELPNVFVVGAYCPNSGEGLARLRARTKEWDPRM
FT                   SAYLSSLQASAGGKPVVYCGDLNVANEPIDLWGNHAANSLASGYTPEERDSFKRLLLGP
FT                   IRDGGAGLVDTFREAHGTDAKAFTYFSYRAGARPRNRGWRIDYALVSESLRGEVHDAFI
FT                   RGDVGGSDHCPIGVVVKLRE"
FT   CDS_pept        join(552359..553129,553181..553516)
FT                   /codon_start=1
FT                   /gene_family="HOG000030179" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636907"
FT                   /orf_name="MICPUN_97136"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61729.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560106"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI000199A5CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F4"
FT                   /transl_table=1
FT                   /translation="MGARLPEPTEGPGACKVWEIKTLGRADDERARDMLEKTAWQVQPI
FT                   MRKRGWKVQELCEMKPEQRDRMGDNLNMGQRVRLKLRKNNSGDWFDYDHVVLVMLHELC
FT                   HNDIGPHNAKFFKLLDEITVECEELMAKGIGGSGAGFDAKGQRLGHRGGWGGIETRDPR
FT                   KAAAEAAARRAGYQAAMGPAGGRKLGGGGTGAATQLGPREAAAAAAERRLRAERFAREN
FT                   GLMNDVVVIDDEDDDDGGDGDGAGEGGGMAKTAPARNEGAEVVVLSSPQEPGTRDAGKR
FT                   KRTSGRRADEDDEEEAEKEETDDDDDVVFVQAVPAPRPGVDRPERRWTCSQCTLVNPER
FT                   ATHCGACERWRFGRGAPAASRPTVGVDD"
FT   CDS_pept        join(complement(554616..554744),complement(553601..554533))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636908"
FT                   /orf_name="MICPUN_56854"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="ACO62161.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG611222"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="UniParc:UPI000199A5CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F5"
FT                   /transl_table=1
FT                   /translation="MRAAPARVGPPVRVARGPRRAAGRRSIRGVRVECRNRILFRREVD
FT                   ESDDGAESITLALGDSRSEHVRGVLKLAAGDSLRVGVVNGSPATAVVSTMDATSMTLTW
FT                   RPGVETDDGDTARRSLTAPLVDVDLLLAMPRPKVMTRLWAPLASIGVRNVYLTNASRVE
FT                   RYYWDSTALDEAKVIAELTRGMEQSGDVRMPGVCVVRRFPAAVDAVREMTGAPRRDGGQ
FT                   EPRGRGGREGGGNGGGMPREGSAFWLVKPPPADENDDDAEVVMLTAHPGAAATVGDAFG
FT                   DLSSSSSSSSSGRPRRTRAVVAVGPEGGWTDFERRSLLDAGFVEVALGRRTFATDVACV
FT                   ALVAAVRERTSSW"
FT   CDS_pept        554850..557468
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636909"
FT                   /orf_name="MICPUN_99408"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61730.1"
FT                   /db_xref="InterPro:IPR021622"
FT                   /db_xref="UniParc:UPI000199A5CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F6"
FT                   /transl_table=1
FT                   /translation="MEPRGEAIGGTPPQRSERRFGVLGPQRIDRDGVGFASHENLAEVV
FT                   PYLNRSLNDLGYPGPLELEAPSVGDLARVANVLFLILRDRQQDAASREQWGRERRRLAA
FT                   DKARAETFYERARAELAAKDEELANSLAKSDGRVDKERRRLDDATAECASLKQRLLKSQ
FT                   QRCATLENESRRREKEREKLSARLEKFVNDRRRDVANATPVGVMRVTTGGPDDVGPAVE
FT                   QKVSFGGLNAANATSRVPNVHATGRHKTVAAAAATSKAAALDAAARVAASLASPFVSQE
FT                   LHHQMMGAYEAKMRSLMHDVNDLRELLAANGVDPETGERIGDPERRQTAGGYLPSPAEA
FT                   RGDLGGAGPDAMASGAMALGDVEDETAAAARDAALIAAATEAEIGVGDDAFTFNLGALR
FT                   RRLGDDGSARSPPRGFGATTTTTTTRASTERLPTAPPAALASGRAAPNETQPAGALASG
FT                   GSAGSVPSAGAPSPIEVALAWHEREHARLRGVLSHPPRELRDAPTPELAFEVEKTILSP
FT                   AKSAASGGGGGVAAAREDLRGAVAAARAAAAKASPARQQLHWNEPPSPARAPAPIYESS
FT                   PSVSSAEEDDDAPTPRTTPPTPAFGAAASRAYDNPMADDAADLDGEELAREAAAAAAER
FT                   EAEAAAAVFAERVDRAFNSVQHEASRGSIDDAGEDLVELDVGLMADDDDDVYVADDDSH
FT                   VQRVQREAAGTPTGRVTVEPRSDTIAAFVDGSRRLPEFEGVGERDRGGAFGSPADVPAD
FT                   RTTGRPEAGVSAGAGAGADFGARMAQLSTPRAQPPAPAAVAPPSPAPPASPLDELLARH
FT                   LKLGRGRPTAGGGEGDAKEDWRERYRRRRANPFASFAANDAKLAVDASQQTPGFAMLHS
FT                   G"
FT   CDS_pept        557675..558502
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636910"
FT                   /orf_name="MICPUN_56856"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61731.1"
FT                   /db_xref="HOGENOM:HBG609227"
FT                   /db_xref="UniParc:UPI000199A5CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F7"
FT                   /transl_table=1
FT                   /translation="MAAIYASRVMPRSGAAAARSPRRSRLSPGPRLIASPRRQISSRSG
FT                   GSDSSGGVGESARDAALRMEQEALDARTAIRLASLRAQKDEERAIQQRAVELQKEMAIR
FT                   EEGRRRAEETGGRRPTQRKAVPIFIAGVQCTAMSLASLTLTNRAAAFLVDGDVPVANRT
FT                   LLVNLSVGGGVAVTATLIISTLILFTVAIKEGLGVINNTPVTFYRCDGQGPTCCKNGPH
FT                   NLGYAAKFTYLANGRGFETRQRDSMRRHLLVSRKCRELKPIVIYPKEEGWKLW"
FT   CDS_pept        join(complement(559115..559588),complement(558650..558991))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636911"
FT                   /orf_name="MICPUN_107900"
FT                   /product="Predicted protein"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO62162.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI000199A5CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F8"
FT                   /transl_table=1
FT                   /translation="MRRLGASSAYTAVPTDLHSEGAEGAEGAEESPAESPAESPADDAP
FT                   TDVSLDVKLSFRRLPKGTWVKLQPRSADFQGELATDNSVDLRELLEATLHRRCALTVGD
FT                   DVSVRAHGDREYALRVVEVLPDDADGAVSLVETDVEVDIAPSEDYEDAMRRLAEAAAAA
FT                   RAERYRAAVSERLPVEPDADAAGGCVPCRFQLPDGRTVTRRFAPTDPLAAVFDYVISAG
FT                   GAGEGEAFRLVTRWPRTVTELDDGARTVRAAGLKPADTLFVEKLEKTAA"
FT   CDS_pept        <560601..>560996
FT                   /codon_start=1
FT                   /gene_family="HOG000264651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636912"
FT                   /orf_name="MICPUN_72902"
FT                   /product="Mitochondrial protein translocase family "
FT                   /protein_id="ACO61732.1"
FT                   /db_xref="HOGENOM:HBG593865"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="UniParc:UPI000199A5CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F9"
FT                   /transl_table=1
FT                   /translation="IPEKPVSAVEAGGYGIVIAAALAVALGAIWFSFKELIFEPKEQTV
FT                   FNRALDKIAVDPRVTVRVGTPMTGYGREGRSRSARQHVPHVVHVDGAGREHVRIQGAVR
FT                   GPQGKATVHADAYKGDSGEWEFAYLLVD"
FT   CDS_pept        561239..562222
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636913"
FT                   /orf_name="MICPUN_56859"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO61733.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG750656"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199A5D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G0"
FT                   /transl_table=1
FT                   /translation="MLVARRWWSRIDVCAHAPRAASAVSWVLHRDADVLVVDKPAGVPM
FT                   RSVHGVKGVDAFLADLRFDLAHPPMTVHRLDRDTTGCLILARTREAQRTLAGYFQDRAR
FT                   VARRGSGRSTKTTSPESLGDVRRVYWALVSATSTLASRGTIDAALVTTHAGVTLKPGAG
FT                   AKPAATDYEVISRASPDSCAPTAAGRVPAVLALVPRTGRKHQLRVHCAGALDAAIVGDY
FT                   KYGYRDVSRTGGVADDWRRVLRDIDERSTRRLNDAGTADGEVRGAGVPLHLHARCVEFT
FT                   HPSSGERVRVVAPAPSHMSLACEALGLALDGGDDDGLGLLLHFNRR"
FT   CDS_pept        562307..564067
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636914"
FT                   /orf_name="MICPUN_56860"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61734.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199A5D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G1"
FT                   /transl_table=1
FT                   /translation="MTAGEERPVVVKTRWVSAEEDEPSAPPRGNATAEERPSGGCFEAE
FT                   VSLPGVTSAESIVAEIVTAAEAGAPPSLYVRAKADGGGGASLSADVPLPDGCDHREISA
FT                   VKWSRKRSTLRVRFAASSPAAAGGAEDDGDDEDGAGPLAEYLRMLGVRDGEAGGSEPEL
FT                   EEDGDPRDGVRDPAGEKRENPSRADGKTPQPTEPTKQTPPGRAVRASGNKKKRRKNAAG
FT                   RGVAATPGRQLETPGRQLETTRPGVSLSELSDDLAAQLHARGFAHAQFITRDAVCVVRD
FT                   EIKRVAPLYTDGEIWLGKHDAGAQIAVKSVRGDRVFWMDPATADGGRFDAMRSMLRAID
FT                   ELVLDHLARACPKRLGGLADRTHAMLAEYPGRGSRFVRHVDNTGRDGRRLTVLCYLNPD
FT                   YAGEHGGALKVYDADDADGSRGVEVAPAAGTIAMFYADETPHEVLPSARSRHSFTVWYY
FT                   DETEFKDAETRRGEAAAADSRAAHMPSVDGSGGSDPGATLAALDASDREAQAFVRRMMT
FT                   QRLTPAGAAAAARGLGERALRTVATVFGAPDPASFVVALTQMSQSDLDELRMEITSMGM
FT                   DNAPDAELVA"
FT   CDS_pept        join(564397..564705,564745..565116)
FT                   /codon_start=1
FT                   /gene_family="HOG000277054" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636915"
FT                   /gene_name="GPX3"
FT                   /orf_name="MICPUN_112671"
FT                   /product="Glutathione peroxidase"
FT                   /function="glutathione peroxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /protein_id="ACO61735.1"
FT                   /db_xref="GO:0004602"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199A5D2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G2"
FT                   /transl_table=1
FT                   /translation="MLSTSPDTTPPQARLGAGASYRRAGEFALRERKLEAAVSLDVPGE
FT                   RQPALRLSDVDTEAPADLGSGDSDAPGAPGVYALTADDIDGRPVHLSVLSGKPTLMING
FT                   LEELGEAYGDRLQIMAFPCNQFGGQEPGDAAQIKQFAKDHGFPSDGYLMAKVNVNGPKA
FT                   SEVWKYLKAHARPKPVKSVMWNYEKFLVDAAGEPVKHYGSGFDSSAISADIQALLGETP
FT                   GELH"
FT   CDS_pept        complement(565542..565943)
FT                   /codon_start=1
FT                   /gene_family="HOG000232198" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636916"
FT                   /orf_name="MICPUN_99413"
FT                   /product="Predicted protein"
FT                   /biological_process="cell adhesion"
FT                   /protein_id="ACO62163.1"
FT                   /db_xref="GO:0007155"
FT                   /db_xref="HOGENOM:HBG560112"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniParc:UPI000199A5D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G3"
FT                   /transl_table=1
FT                   /translation="MTDMASPGAGASVVMATCSDERHPPHNALDEDERSFWVTTGLFPQ
FT                   EIVVKLGKTSQVTKVRTLTANVRKFSLEYCDDDEPIGFKPAFEVELGDKGPARLQTEVH
FT                   QVNCRAKFLKFVIGSGWGDFASVHRISVF"
FT   CDS_pept        566677..567828
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636917"
FT                   /orf_name="MICPUN_79944"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61736.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199A5D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G4"
FT                   /transl_table=1
FT                   /translation="MENNGRVVELELKEFGLTGAVPAELGRLSALMDLNLGGNQLTLLP
FT                   AEIGQLASLESLELGYNELTSVPVEIWQLASLEGLYLGGNQLTSVPAEIGQLTSLEDLS
FT                   LEANRLTSVPTEIGQLTSLTQLDLRDNQLTSVPAEIWRLTSLTYLNLNDNQLTSVPAEI
FT                   RQLTSLRELWLSANHLTSVPAEIWQLAALVKLSVTENQLTSVPAEIWQLTSLTELYLHG
FT                   NQLTSVPAEIGQLTSLTALSLYDNQLTSVPAEIGQIRSLVKLSLHGNRLTSLPAEIGQL
FT                   RALVEFELDRNLLTSVPAEIGHLTSLTELSLHGNQLTSVPSEIGQLTSLGELSLSGNQL
FT                   TSVPAAMRELEAAGCYMDLDLDSDPEPEPEEEEGEPLDFDLFD"
FT   CDS_pept        567862..568251
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636918"
FT                   /orf_name="MICPUN_52198"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61737.1"
FT                   /db_xref="UniParc:UPI000199A5D5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G5"
FT                   /transl_table=1
FT                   /translation="MNGRFALIRFKHPSTSREYRRTESRGGATRKNRKKRKVHPDSRAA
FT                   AARVEVADAVSTRSSPASASVHPARLLLFITRGSPRPRPPRARAPRGTPAPRTAPCPSP
FT                   VRWRWSRPSTGVSAARTRRRRCTCP"
FT   CDS_pept        join(complement(570206..>570538),
FT                   complement(<569675..570145))
FT                   /codon_start=1
FT                   /gene_family="HOG000198014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636919"
FT                   /orf_name="MICPUN_71782"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ACO62164.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199A5D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G6"
FT                   /transl_table=1
FT                   /translation="RAFKSILNKLTPQNFEKLLEQVLAEGIDEAQTLIGLIGQLFDKAL
FT                   TEPTFAELYAMMCQQLSNRFLAENIEFVDPDCDPDAEGGPRMINFKRVLLNKCQEEFEK
FT                   GDSAIKAEEKEEGEVPAKPKTPEELELDERRKIQQREDRMRQARRRMLGNIRFIGELFK
FT                   KEMLTARIMHTCIMKLLNEKKNPDEEDVEALCKLMATIGRLIDRPDAKSHMDAYFKRIQ
FT                   GLSVNKSISSRHRFMCQDIMEMRSKGWRERRKQEGPKKIEDVHKDA"
FT   CDS_pept        join(573237..574382,574702..575210,575665..576526)
FT                   /codon_start=1
FT                   /gene_family="HOG000218327" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636920"
FT                   /orf_name="MICPUN_79594"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /function="polyribonucleotide nucleotidyltransferase
FT                   activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="mRNA catabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO61738.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004654"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006402"
FT                   /db_xref="HOGENOM:HBG382411"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199A5D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G7"
FT                   /transl_table=1
FT                   /translation="MRARAPRIGAARSAGVQPCPRVVAPNGRRRPVRCAAAGAPDDPYA
FT                   ALDRTPKTLTLRIGESEVTVETGRIGRQANGAVMVTEGETVIYATICAGRDVTADGGFV
FT                   PLTVNYQERYSAVGRTAGGYRKRDGGVRENETLIGRLVDRPLRPMIPKGWAYDTQILEW
FT                   VLSYDGARSTDALAITAASCAAAISDVPLKKPIAGVRVGLLPGETEPLINPTCEQMERS
FT                   RLDLVLAGTEDAVMMIEGFGDFLTTQEMLYAIEKGHEAVANACRDIDAWAKDVGRVKNE
FT                   AAVLVAPEGVDDAVRALVGAELAEAMAISVKQTRGAAVEGIRARAIESLAGGDDAKFTV
FT                   SAVRRPAQSLRFAFCALLLFSLFPPGPRAFSRPFVRLPPPALENDVRLACGRCESNALR
FT                   SMIRANGVRQDGRDTKTVRPITCSGGLLPRTHGSSLFTRGETQAIAAATLGGATDAQKV
FT                   DGLGNDKDRRFYLHYFFPPSSVGETGRVGAASRREVGHGNLAERALMPVIPPYDDFPFT
FT                   VRLESTITESNGSSSMATVCAGSLALQDAGVPITRKVAGIAMGLILGDESAGEAPVILT
FT                   DILGSEDALGDMDFKVAGDGDGISAFQMDIKVEGITLAVLREALESARVGLVHILGEMD
FT                   KADPAPAGRMSAYAPQVEVVEVPTKYIGKVIGKGGEQIKAICEQTKIDTIDINEEGVVT
FT                   LTGSFGCDMPKAVEIIRSLTVEPEVGKTYRNARVTKVLDFGAFVEILPGVEGLCHVSEL
FT                   DVTRVANVRDVVEEGQTIDVKLLETNERGQFKLSRRAVLLDEGGEKVRRELAEAKVAAG
FT                   GDDADDAPGRGRPPPKARRGRSRLRE"
FT   CDS_pept        complement(576679..580467)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636921"
FT                   /orf_name="MICPUN_56867"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62165.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199A64E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G8"
FT                   /transl_table=1
FT                   /translation="MAGSFEATLSVSDRPELTSLAVTAVPIDPPAVERAAAGDGTTDRR
FT                   DPEHGVGGKGKNNGNEEDASTGARPEKQRKSSEREESVSDDEDQPDDDGLHAAAKKGMN
FT                   VVGWWRAKLNANHGLDKEILAALHLLAGARGPCMRLAFSHPVLSQPGDSDARRRNKEGL
FT                   TKLHREMRAEQKSAVMFLDDPATGRRREVHLAAVWVHPADTAGDTAGDAVGSNGADEAA
FT                   LTTNDEAAPTTNDDGDKADAREPQFLAFEVQPNAPAVALEPLLHKQLMVVFDLDETLLQ
FT                   AFTLRAMERRARELDAEDAGADGGADGGADGGADDAATSGWGGGGRGDPGKNTAGVPGA
FT                   VGGDARAATRDAKELAARRDEDRRRLRRDAELLTQFRDGDCVKMPVPGSATGTTQTVRA
FT                   KMEPVLVLDEERYGPSPVTVARPVIRVKSPHVRGGEMVFTRIDPKNVDTSMIVHVRPGW
FT                   NDLYAYLTGEASQAQAPNAVRGVNKENPAHRPRRPKCKAFVCTMSERQYAHEMWRLLDP
FT                   RGALLPLNDVHALHKRIVCVEHGRGEKKSLAHATRGATHVPELSVIVDDRTNVWERRAQ
FT                   KNILAIAPFMPYNTDTGPGLQSEVAGKGGVMGMVQSMLNEVRFKFSQQWTRWAQRCDRG
FT                   DPLRPGGERPDAGEILAPLMASWAEDNTATIVRQGGAARAAAGAGSSLNAVLKSLGRSK
FT                   SNAEEAQRRRDAEAKAKAEEEERAKAEEERAREEERVREEEKQRRWLEEAQAKLKEEER
FT                   ARAEEQRRLLQETEAKVEEQRRLLQETEAKFKEQTRLLKEAEAKVNRARMDDALAAITY
FT                   ESLAATPLEAKGKRPVKAKTEVKTATAGDVDGLGTDSDDSDDAPIAAMAAEPKRPTAED
FT                   EKRRSDEEAKRKKQVRNCQQCSQWGIRAVDHFKSCKMCPFHKDYVHPKHDDDARRRLFE
FT                   RLVELRWSSSAEKAIEGATRLVEKFQPTAIKDGNIEVGELEDAVATRLLRFVLTRQGNP
FT                   AAAPPAAAAPPAAAATLAAAAPAEESEGKSVKKPEPKKRKSGEISKQPKGGGKEAPLLG
FT                   VADGYVKKHKSLKEIIEMKEKSEVVEIEEEQEEEEEEEEIDHGPCVLCGIKDQNEMLCD
FT                   GCDRPFHNSCVNISDEELEIMIEAEEDWFCEDCVKSGKNAGANDEMREHKLKKMDKADS
FT                   DFNLDARDEVEFIKGTRGNPGAASRVRQEKKKASGQAPGPAPAEGAREVHPKDEETGET
FT                   EELAPKPSPSKSVASKYKPGTQREAMMKKLKKIGKRR"
FT   CDS_pept        580947..582185
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636922"
FT                   /orf_name="MICPUN_99418"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61739.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A64F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G9"
FT                   /transl_table=1
FT                   /translation="MSIASGVASVPVGVPHATPRRGGPRNATAKPHIPRRPRLDAPSAW
FT                   AETSPSAPSSASSATASDARDDLPVRVYIEHTDAYQVVYHSNYFKFLWRAREAYVFGGG
FT                   LASALRHRTGAPFDPTAAGWDHLDVVAIDDCVFARSAVLGDDLLVRTSLRGIGETTLAM
FT                   RQEVVFADGGELAFAATAVVAPASATGATTIPREIRGWRAGDEDGIDGVDVGTGYEDPA
FT                   WLARASASASVEDAGDCSEDDEEANEDPEARVSSIATKTRVTLFESELSLGRARGASDA
FT                   DVLRWFERDRTEAIGGSSALSALKENDGVAVVVSSMDGFRCRPGNVVGSAGIGAGGASG
FT                   GRNVRPAVASARSTIEMRRRNIQVAFIQRLFDEAGACVARAEVVCTCVTRDGGKPTRCP
FT                   AALAEKFEAMRRG"
FT   CDS_pept        583818..585401
FT                   /codon_start=1
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636923"
FT                   /orf_name="MICPUN_79438"
FT                   /product="Predicted protein"
FT                   /function="glycerol kinase activity"
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /protein_id="ACO61740.1"
FT                   /db_xref="GO:0004370"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="HOGENOM:HBG511469"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000199A650"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H0"
FT                   /transl_table=1
FT                   /translation="MAPKLVGAIDQGTTSTRFILYRVVGDGVLQPLASHQMEHKQIYPK
FT                   PGWCEHDPEEIYANTLTCIASALEAVPGGATASDVACVGITNQRETTVAWSKRTGKPLH
FT                   NAVVWLDMRTSDLCESLTSEVMGGDKDAFREVCGLPISTYFSGVKMRWLLDNCDAVKAA
FT                   AAENDLAFGTIDSWLLHRLTGSAGTHVTDATNASRTMLMDLRTQTWHEPTAVKLGVPMH
FT                   SLPRIVSCAEEYGVITEGALKGVKLTGCLGDQHAATLGQRCDAGRAKNTYGTGCFMLLN
FT                   TGGNVVESKHGLLTTMAWRLGKDATPAYALEGSVAIAGAGVQWLRDNLGLIRSAADVEP
FT                   LAASVPDAGGVYFVPAFSGLFAPRWRPDARGVCVGLTQFTTKAHLARALLEAICFQTVD
FT                   VLEAMRKDASDLDMTALHVDGGATANGLMMQTQADLLGLRVFRPANVETTAMGAALAAG
FT                   VGAGLFSERAVFEDTPADESIADAEWLRDEMANRAYFEPAIGEDERARRYAGWCDAVER
FT                   SLNLAPQQGK"
FT   CDS_pept        complement(585505..587073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636924"
FT                   /orf_name="MICPUN_107903"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO62166.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="UniParc:UPI000199A651"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H1"
FT                   /transl_table=1
FT                   /translation="MKTLHEETLHVVNLVNLLFRKDIKTPVTIVVKRLYDAKDPWKDEV
FT                   PIQADGEAVSLKLLDAFTNWRTKLYDDLPSHDSAHLFSGHDFDGETVGLANQIGDTGVS
FT                   ICSDYYCGWDVGGQKLKPGFCFCEQLNGVCQDKLNCCSMASTGISMVRKEKLASDATTV
FT                   AHEIGHKLGFPHDGVKEGGVDTTRCDKTGYIMAASSSSTDEFDSWSQCSVDKFAAALEG
FT                   DEYFCLAKGDHAVCGNMVVEDGEECDCGGSDCTAGMHPDPCCDGKTCKLVAGAKCSAGL
FT                   GDRGCCDPSTCSTRAAGHTCRPVDGLCDIEEKCDGVESTCPMDLHKEIGRGCEDSNGDV
FT                   GACLGKHCANRNHVCTSITQVRSDGLLYGGKSASQAAGKSYGGKKLWLFDSTSCDNGFV
FT                   CFDDANSVSQSTYWTLSNYGALPGFPCGSSTTVTRTTNGTNETYEIFENVCDGGPTLNG
FT                   QSSKCVTRPKMIPPPPAPFPPPSPPKAPWPPPAPPLPPYAGSPGVSTFRSTLFGVIAAL
FT                   ALLAH"
FT   CDS_pept        588253..589380
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636925"
FT                   /orf_name="MICPUN_56871"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61741.1"
FT                   /db_xref="UniParc:UPI000199A652"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H2"
FT                   /transl_table=1
FT                   /translation="MLAWIGARKNRAHRGGASTLAARYDLAVRASTSARGAKHERDEDQ
FT                   LACEDEELRPSVRRKASAALASSKPAATSLDVLDLHVLCHLMECERESSREKDKDDEAR
FT                   AALKPAEASRRASRSPCVKRAREESGDGDDDMELALEGLALSPSPPSPFGPTQGRPHTA
FT                   SSPCSPPEQLRTPGAFTLPSPPRKKIKPGLAPSLAPFASSPGRSWTTLGLDAGLGSILG
FT                   ARRTRPKACRSLDFSLPTLSESAGAERGTQLSSQDEGSFDEKDAIDVVMSHKYGRPEDV
FT                   MDADETDDAAADDDEEADATDAMEEDAENRRLRAVSLVDVDTRGGGVRQSARVDRGALM
FT                   EVMSAVGGGRTNASIGAVPWRVMKLMQIEEEIFII"
FT   CDS_pept        complement(589574..590731)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636926"
FT                   /orf_name="MICPUN_56872"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62167.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR022143"
FT                   /db_xref="UniParc:UPI000199A653"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H3"
FT                   /transl_table=1
FT                   /translation="MAEREPPSSPPGYVPGDSDSESPDIATRRRDPPPGPVVESVSPGE
FT                   RARGRGDSGEEGRDLDDYDNSGGGSGDPATPGTISFRSGLELIHNVKEGSECRICLMDH
FT                   TPFCKPCRCQGTMGHVHPECLARWCRETGVTKCELCHSTFPQYFIDAGKRTRRVREREQ
FT                   ADAQEASERLAAQTANFQVAYGRPPTTAMDYAVINLNSMLEAEAAMRQRQRENNGVEDR
FT                   QFNESMRVVVIDSSGRPQAVSMGELRGASGGGGGLGLQPVGDQNYDLDRAIVNHQLSFW
FT                   ARIVVSTLCVFLVLYIIVAIVAASSDAGRDSYPVFIFRLLGFMLPLLLIARAVYVFRRR
FT                   REQAMINTVNDMFIRHHAQTAEVRPAAGGGNGAREQRGTRRLLDV"
FT   CDS_pept        join(591004..591053,591270..591425,591582..594900)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636927"
FT                   /orf_name="MICPUN_99422"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /protein_id="ACO61742.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI000199A654"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H4"
FT                   /transl_table=1
FT                   /translation="MPLVRSNDAPDSADPVRSGAIFGLVPSTGAPPHDAHPGSPGGGFG
FT                   GSPYGGGGSYGGDTRETQQYTDYQNMGNGWVQRTRRSTVERVIERVHTDVDEMVPMRGG
FT                   AGGAHLHGGGGGGLVPHGGPGSNGWLNGELARQVHSKFEDMVRQSPAPTRAERSAYDEL
FT                   VRSFPPPESRGRLALGDGSGIEREPQPGIVSPTGGYAAPWMNGGGGGGGAGGDGRYPSR
FT                   LGHNTAGDGDNTAGGVDANGSPAERSIFSDLKSPPPSMRRASGGGGSGSGFTLDDLILR
FT                   KKGPDAAAARGAIFSPPPSPPGGRGRGRGRRGRKPGAGAGAKKPSPPPEPSESSSESED
FT                   ADEDADDDYVSPAGVEGGRDASSPLEKLARAAEKRGATRAGASPRVTVGKSPAKSPASL
FT                   TARAARRSYRIGDSDSDDDGNKIAAVRAGRTKPSTGVGGNKRGSREARQLLIAAQRMAR
FT                   VTGGGGAGASGVVATATTPAAASPSALRGAGTPASVGGRSGGRSTRERRAPSAFWLNED
FT                   AKRKDPFATTATPAATSAAAESKKTAARAKPGPKAKKPAAKRGRPKSKAKPAAKRRRDD
FT                   DDDDDDDDGESSSSESESESESEESEEEETLEARAARTSAVKKSVAKKSAVKSPAKRPR
FT                   GRSPTKGPTRARPAKKPSKSLAVYSESEDATDEDEDEEDEEDEDEEDEDDDVPPPKGDD
FT                   DTEESDGDDTEESDEDSEDDTPLASRYKGKPSKAAASPKGKKPPPAAKPKPKPSPKPAK
FT                   PSPGKGNRRHSAEHAAALVSAEIMGRKTSMARRFGLNVARVVDSEAESSDDDEEEGEDD
FT                   DDAGPPGSTPTDRSSDRTEASSPATATTDADGGAADTTDADDTPATKGSAGGQPPRSIE
FT                   KGKRGGWRPGAGRPRKVYDPNDPTPRKRRRLPGEPPRKRGRPRKHPTAEDIEAGHIRRK
FT                   PASAEEKAAALRRLAGGIGGIFGQDVAAPKPRGRPRKDGSSKSAPPKPSGADNKPARET
FT                   PAPAVRANAISTERWAARVKKAFAGGNAEASHPDSPPRRREVSFPENEGEGAAGAEPRD
FT                   GAASAPRSAPPAPPPSGRYGSDRENEQVSAAKSSRRKSILRTLGKSLGEENERDARRNA
FT                   LDRRYSDVPEFEVFGFQGTPEKGGAASPDFGGSPGLFTAKSPGGLISQLDTDTPVTSPV
FT                   RSSPRLRG"
FT   CDS_pept        complement(595008..596393)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636928"
FT                   /orf_name="MICPUN_56875"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62168.1"
FT                   /db_xref="UniParc:UPI000199A655"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H5"
FT                   /transl_table=1
FT                   /translation="MARRADVLLASVLGVAVTLTLASLVVDATDARAREPRDPAEKPGA
FT                   SPCWARSPTNASRLVPKEGGCDGFDADEVGGVDRARKLDECACVYAQAVCDVQPGLVCS
FT                   VPDGRYVCRDEATGAVGGTAGQELRVPCLQSLCTSVTCPLDPRTLPLGDDGASAAKVCD
FT                   VCEMYGYAAGTGELRAQEGSRCGGEVRAQGLRFGPKAALLAYSAFMFVDFTMAAAAAGK
FT                   PLPQDLPTTSQYPEYHHGQPSAPVLLPEILEQDTGGDWQTTTTAYEYPPTTTTYEYPPT
FT                   PPTPPSPSQHPSRPPPLPSLCDVDDLMDVLPSALPSLVPCLSGSTSTCCQNVANIVGES
FT                   TDADMTDCLCNRDAFDALAGLLMDNVGLDLASRLGECVAKGYRINFPADEGGGGGCDRY
FT                   EKRETRAYVRPRTERKGVEESGDPDAVARDRPRASVTAQSRARNAAGPRAGSDEAPARG
FT                   DDR"
FT   CDS_pept        join(596525..596819,596940..598483)
FT                   /codon_start=1
FT                   /gene_family="HOG000100025" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636929"
FT                   /orf_name="MICPUN_99424"
FT                   /product="JmjN/JmjC protein"
FT                   /protein_id="ACO61743.1"
FT                   /db_xref="HOGENOM:HBG560122"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="InterPro:IPR013129"
FT                   /db_xref="UniParc:UPI000199A656"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H6"
FT                   /transl_table=1
FT                   /translation="MVAADGGAIASEPPTGRRAKRTIRAPTKFVDEDGFNDADLQRALK
FT                   ASMKHVRRVSSTTVPECPVFRPTAEQFADPFAYIKSITPEAMPYGIAKIIPPEGWKPPF
FT                   NEEAGGDGIPFDTKLQTVNRLQEGLHFEDGERYTRDSYRDMADAFKRKYLETHRRVADE
FT                   TERLRRENRGWSDDACEARALEEEFWRIVETDVEKIRVEYGSDLDADVYGSGFAKVPLG
FT                   SASAAAGATPDSDSDEDGGVPHAWDFGELIRHPSNLLRVVGGDIPGLTRPWLYFGMMFS
FT                   AFCWHVEDHYLGSVNYMHAGAPKTWYGAPTHAADAFERAVRDIVPGIFKDAPDLLHRLV
FT                   TLVPPAVLGEGHGVPVCQTLQRAGEFVVTWPRAYHAGFSHGWNVGEAVNFGTADWVPMG
FT                   RAAVNDYQHGVGKRDSIFSHEKMILDTAKAFVRRYGYGDGSSREDQSLRAPWIARMADA
FT                   LRAELQIIEKEQRAGRAVVTSKGVKEVAGKENEASKHEDEDENCALCKAMPHLAVVHCA
FT                   RCFEIAEKIEFEQAVARARAEGRSAAGAAWALQGGSSSERLRRMGRYHRRRRRNRPVFC
FT                   LGHALDGNCGHGVTELVMTTNASMDELERVLGALQK"
FT   CDS_pept        complement(598588..600120)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636930"
FT                   /orf_name="MICPUN_56877"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62169.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A657"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H7"
FT                   /transl_table=1
FT                   /translation="MAPDVSARIRAGHDASPRTPDAIKRPDGPAESSLAGPLRRAVLDD
FT                   RAAEVRALMKFRSVSENRAPDGDCTAADALLLAIERGSFASTVELVKMRATPLDAACLL
FT                   AAAASPNPECAAFVIDGCTAAGVSPDSRDHSGRTPLEIATRHRADLTAPHERSPTSHFS
FT                   PAHRHGDDGGAGAVASSLLRCGAGANVEFSDGATPLIAAARAGRHTVAAALLAHGADPL
FT                   AVDRSRSMDAVAGGTALHAAAMSGHAECVRVIVDVLRAIMEDDEASAGAFKGANGGDGH
FT                   MNCLNPFAAFSRIFSSLGPAPPSPGLKGTDWSELTGEDDEKNGGAGSSVAAPSSPVMGS
FT                   DDDDDEKDEKDGERKPSLLDAGDSIGRSALLLAIAGGNIAAASVLCDAGADRRQRVGDR
FT                   TLLHVAVERDEPEICEILLRRRDSLTPRALYRSDSFGGGGVGPFGTGVGRGALAGPPAE
FT                   VDARDSGGRTALMLAAEARKSQCAEVLADRGADQDAAPGLRRKVETLLNVYI"
FT   CDS_pept        join(600465..600551,600659..601186)
FT                   /codon_start=1
FT                   /gene_family="HOG000230603" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636931"
FT                   /gene_name="LC1"
FT                   /orf_name="MICPUN_80279"
FT                   /product="Outer arm dynein light chain 1 "
FT                   /protein_id="ACO61744.1"
FT                   /db_xref="HOGENOM:HBG522528"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003603"
FT                   /db_xref="UniParc:UPI000199A6C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H8"
FT                   /transl_table=1
FT                   /translation="MATPKPTTCKEAIKKFETAKGVKAAEEVKVLLYAQVPPIEKMDAA
FT                   LQTLTACEHLSLSTNNIEKIQPLTGLENLKILSLGKNLIKKLDNLDGVAETLEELWISY
FT                   NLVEKLKGVQQLTKLRVLYASNNRIEDFDELNKLTELSKLEELLLVGNPIFTEAEEPNA
FT                   EGSDYRLMVLKRVPQLMKLDGIPVTSEEREKAATFEPAPEE"
FT   CDS_pept        join(complement(601933..602154),complement(601606..601755))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636932"
FT                   /orf_name="MICPUN_56879"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62170.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG734125"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="UniParc:UPI000199A6C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H9"
FT                   /transl_table=1
FT                   /translation="MASFVMSASAVKAPAVKVSGLGFRKAVSAVAMPKAAAKPVQAHAA
FT                   FSVVCGKPGAKAKTNKSAAKRFKITASGKVLHRRPGKQHLNGHKTTERKTRLSGERQIG
FT                   AEQIPLVKGLLPYSRKRIR"
FT   CDS_pept        <602704..>603614
FT                   /codon_start=1
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636933"
FT                   /orf_name="MICPUN_75681"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO61745.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI000199A6C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I0"
FT                   /transl_table=1
FT                   /translation="KSLVAGGVAGGVSRTAVAPLERLKILQQVAGSTTTAYNGVLRGLT
FT                   HIMRTEGMVGMFKGNGANCIRIVPNSASKFLAYETLESWLLSRARESDPNAQLGPLTRL
FT                   TAGAGAGIFAMSATYPLDMVRGRLTTQVDGKYKQYTSMTHAARVIVREEGALALYKGWL
FT                   PSVIGVIPYVGLNFAVYGTLKDVVAEWQGLKSGKDLSVPLGLACGGVAGAIGQTVAYPF
FT                   DVCRRKLQVAGWAGAKALAEGEAKHLAEMRYTGMVDCFVKTVRHEGVGALFHGLSANYV
FT                   KVAPSIAIAFVCYEEVKKLLGV"
FT   CDS_pept        complement(<603965..>604297)
FT                   /codon_start=1
FT                   /gene_family="HOG000240708" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636934"
FT                   /orf_name="MICPUN_76741"
FT                   /product="Predicted protein"
FT                   /function="tRNA binding"
FT                   /protein_id="ACO62171.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="HOGENOM:HBG477532"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199A6C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I1"
FT                   /transl_table=1
FT                   /translation="DPICKARLAIGKVIEVSHVENSDKLYCCKVQVGPEEVRQVITGLR
FT                   KFVPEDDLKNRMVLTILNLKVAKLAGQTSEAMILATESETDGNLSVKLVNVPDGAVVGD
FT                   VVAAEGV"
FT   CDS_pept        complement(604839..606470)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636935"
FT                   /orf_name="MICPUN_56882"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62172.1"
FT                   /db_xref="UniParc:UPI000199A6C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I2"
FT                   /transl_table=1
FT                   /translation="MPEKDGSWLLGVVVCSKTGTCLVNACSDAPLRVRELCRMLPALHS
FT                   LAAGVASPTSHLDLSTCSVALCESRVGYIVAALTSPGADWRQRRTSASFVAETVSRAFA
FT                   WHGGEHLESFIARDMDDAVMDATFDAGEDADDGDDDDATTHPQFRSFELEFLRPALARE
FT                   FARPAHVRWLEPLVGCVTARVAHAHVLIPRSRDDDASHGSGHRPATNDDVAAAVRDDRE
FT                   FDDSALSDAVRTKELGARATWECHVVASARGTEASHPLARLCDVDAVGCGEIWRETRER
FT                   CLAMAESRARRCAATAEVGGTFDGDGVGLSGHRRVSSRVKGAGVVRGAFAKREASTPPE
FT                   TAVLVFRNVGGGGGKKDGDVGRDRRTLRAVIHAFSCHPGSAIGTACAVAFCVSPPVGDS
FT                   PGGDSPGGDSPGSPTGRGWPDDLDGWDPPEVSGGYVSRRVAGGTGATSSVMPTDLARAM
FT                   FRVADAVRTTLDPHFDWSNHRSSSDGATEAKKRWGGLDGTGLEEGHTERSGRGDGVPAV
FT                   GKDAGWVVVKGAGPPTGRGVRRVVPA"
FT   CDS_pept        606648..607781
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636936"
FT                   /orf_name="MICPUN_56883"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61746.1"
FT                   /db_xref="HOGENOM:HBG406789"
FT                   /db_xref="UniParc:UPI000199A6C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I3"
FT                   /transl_table=1
FT                   /translation="MGSGLLAAAPLGIAASAPRSRRRTRRAPVNVAATSASGEDGLERV
FT                   ENCSGCLRPESCPCPKAIRRAKQKQQQRRRETSRRDEDDAAPGRRAVLSALGAVAMGGG
FT                   GAVVPGNPAVAMENGLISEAWSAISGAPSDLTFPEDFLGTWLCYSTLTRVDTLQGDELV
FT                   QDIAVVNRARKDVGQQIVYPMRFIKNDQGRVVMDRAYNVVRMAEATARAYNVIDSVEWD
FT                   VNDPNVLRGRIGADGRSVFFRVNQRSEEYPAPDRIETSEVAQIVFDGGDNGGYAPTPTD
FT                   DSVPAAIPAMALGPDGTRDPSGAAKATKVKSSRTFTKWKFRSAEAAGDGPAIVAGQTVY
FT                   DYLTSFDPGFIESRGQPVTQYTYKLALFRANKYNLEN"
FT   CDS_pept        complement(608056..610962)
FT                   /codon_start=1
FT                   /gene_family="HOG000205991" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636937"
FT                   /orf_name="MICPUN_104770"
FT                   /product="Predicted protein"
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="aconitate hydratase activity"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="ACO62173.1"
FT                   /db_xref="GO:0003994"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG284496"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015930"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR015937"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="UniParc:UPI000199A6C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I4"
FT                   /transl_table=1
FT                   /translation="MMRKAVNGRALRRLLERAAPATSSTAGSRGFASTARTTGAIAAPL
FT                   ARRAPLASRAPAPPRAGSLLPAASLASIARSARSASTFLAEYDAHVAERAAQNIAPKPL
FT                   DAKQVAALCEQLESPPAGDEAVLMDLFENRVPPGVDEAAYVKASWLAAIVEGKARSPLV
FT                   DAAKAVRILGTMQGGYNIAPLVQALDDPALGPLAADQLTGTLLVFDAFHDVEAKAKAGN
FT                   EHATRVMRSWADAEWFTRRPPVPEKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAL
FT                   AMLKNPRDGIHDAPAQIEELKTKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVP
FT                   NKRTGGVCVGGKIAPIFFNTMEDSGALPLEMDVTNMNMGDVVEIYPYQGVAKRHGSGEE
FT                   LCRFSLKTDVLLDEVQAGGRINLIIGRGLTSRARESLGLPASDVFRLPSNPPGSGSKGF
FT                   TLAQKMVGKACGVDGGILPGTYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSSDLVMQ
FT                   SFCHTAAYPKPVDVVTHHTLPDFIRNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSH
FT                   TRFPIGISFPAGSGLVAFGAATGVIPLDMPESVLVRFKGTMQPGITLRDLVHAIPYYAI
FT                   KEGHLTVAKQGKKNIFSGRILEIEGLSHLKCEQAFELSDASAERSAAGCTIKLDKEPIA
FT                   EYLRSNIIMLKWMIDQGYGDRRTLERRIAGMEAWLADPKLLEADPDAEYAAVIEIDMDQ
FT                   IKEPILCAPNDPDDARLLSEVTGDKVDEVFIGSCMTNIGHFRAAGKLLKEFDGQLPTRL
FT                   WVAPPTKMDEAQLTAEGYYSVYGSVGARTEMPGCSLCMGNQARVAEKSTVVSTSTRNFP
FT                   NRLGKGANVYLASAELAAVSAILGRLPTPAEYLEYAGKLDATASDTYRYLNFDELPQYV
FT                   ESADKVTMEDEAYAGLGPAMREQLLKVAREKKAAKAAA"
FT   CDS_pept        611512..612834
FT                   /codon_start=1
FT                   /gene_family="HOG000264470" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636938"
FT                   /orf_name="MICPUN_56885"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61747.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560126"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniParc:UPI000199A6C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I5"
FT                   /transl_table=1
FT                   /translation="MFAVAPILGAGAVGLGRARTLPTSTRISTSPRSTNRVATVVRAAR
FT                   KGSPQSAQGRKKMSKGKIAKKNQEFIEQDTEKDAQIEAMRKAAAASRASVDEGEQASSM
FT                   PPGKLDGMSFEDKLKAVKEEGAAKRQQMAEAEAPRKLMDEMLTGKAPVMRSSIYDDAPA
FT                   KPGGITFAQAGGKTPDDELNVFVKIGAGLLSLGLLVVFIPSDFVFSTNVSSAPQGELSP
FT                   EIVEQVKKQASIYEEALASTPEDVDKLRGAAESYVVLEDYTAAIPLLKRLLEIQPSVEN
FT                   VGNLADVYAANGSLAKAAEVYRDAVNAEWSGASLKPPALVKGLVDALDKDGRYGLSLEY
FT                   VKKFREKGQVDDVDGALLEARVYSGWKGHSKEAEKAYQDVIDTHGDDFRGYLAKGVFYR
FT                   EIGKPDAAEGMFRQAKALVPGEMREVANAVIAQAKAQGALQ"
FT   CDS_pept        join(612975..613002,613198..613271,613385..613447)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636939"
FT                   /orf_name="MICPUN_56886"
FT                   /product="Predicted protein"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrial respiratory chain "
FT                   /protein_id="ACO61748.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005746"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG560127"
FT                   /db_xref="InterPro:IPR008432"
FT                   /db_xref="UniParc:UPI000199A6CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I6"
FT                   /transl_table=1
FT                   /translation="MGAVQYFGNAAKVYVGTEIAIGLGLGLVAGAVWKNWHWQTRAKEQ
FT                   AYFASIKGK"
FT   CDS_pept        join(complement(614732..614983),complement(614513..614698),
FT                   complement(613643..614428))
FT                   /codon_start=1
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636940"
FT                   /gene_name="PEX12"
FT                   /orf_name="MICPUN_80117"
FT                   /product="Peroxisomal protein importer family "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="ACO62174.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560128"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI000199A6CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I7"
FT                   /transl_table=1
FT                   /translation="MQFQVDAGDSRPTFFELVATDRLVPSLRAALVYSLRTLAERRPGV
FT                   TRILDHEAEAFALLMLLVEAHSFATSDGSLAEGLYGLQRRGGRGGRGGRAAVARGGLLR
FT                   SGDDDGGNGARRSRRIGGKQRLLSVLVLVGLPYAREKLDALYPPGRSSRDEGARDGDDD
FT                   DARGGRRARGGSSPTPAAPSSSSSASAVSGASVRAGAAAAFVSAYPWIHAGWEAVVFWC
FT                   WLRYLLKDGTTHDPSLATLRLAVVRASPSEVTARRARVESARASRVNRLSSSPSWMTRV
FT                   VGPTALRAGHFALDHAQGGLMAAVVGFKLLEWWYGSAEDAVFRDRSHPPPPPPPRTAPH
FT                   PRARCVVPRDPALCPLCRRRCSQPAVVRTSGWVFCHPCVVDEVRRFGRCPVTLAAAAEG
FT                   DVVRLFSE"
FT   CDS_pept        join(615284..616504,616637..618490)
FT                   /codon_start=1
FT                   /gene_family="HOG000247063" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636941"
FT                   /orf_name="MICPUN_79480"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61749.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG444787"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199A6CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I8"
FT                   /transl_table=1
FT                   /translation="MEDLVNDPHAEEIVVRENYGRDGAAEIGAIARGLRLHFRQYGKGT
FT                   NTALVASKVPLPDYRADLDGRRRAEHEVDMSPDTMAIVARALHDSPSVEDLSANLGSLT
FT                   HASQSKRQRGDGDRSRSRVDEASHLLRRDAAVDAAAQKAELERLESPHVAARMAQRARL
FT                   PAFERRDELLAAVDACTNVLVVSGETGCGKTTQLPQFVLERALASGDASVTGILCTQPR
FT                   RISAISVAARVAQERGEELGESVGYQIRLEARRSAATRLLFCTTGVLLRRLAVEPTLDS
FT                   VSHVFVDEIHERGMNEDFLLVVLRDLLPRRPDLKIVLMSATLDAGLFAAYFGGAPVAHI
FT                   PGFTYNVRTLFLEDALEAFGTRLVVSPPDARRDGFGGFGGKRRGRFGGGRREPTPGYNP
FT                   DEDEDGGDNLVATLVATCDPADPDGDGAILVFLTGWDEITKVNDLMRADPLLGDRTKCA
FT                   VLPLHGAMPTANQREIFDRPPRGVRKIILSTNIAETSITIDDVTHVVDCGKSKEKTYDA
FT                   LNNLACLQPAWISKASAHQRRGRAGRVREGVCYRLYTKAQHAKMADHATPELLRTPLEE
FT                   LCLTIKSLGLGLCEPFIARALQPPEPKSVHNAIELLITIGALSRRTEELTPLGRHLAAL
FT                   PVDPRVGKMLVTAATFGCLSPALTIAAGMAYKDPFVLPMDKKHQADAVRRRLAGDTRSD
FT                   HIALVRAFEGWTRARRDGGNREGWEYCRRNFLSGNTLELMSDMRRQFADLLHGIGFLPD
FT                   GARSADRVDAAHNRHAADVAMLRAVICAGMYPRLVSVRPRGRRNELKTHEDGKVECHPS
FT                   SVNSEFGVSFPFPWLVYCEKVKTSGVYIRDSTCVPAYAVLLLGGDLDEEPDGTAGDGDD
FT                   DVGIRVCGGHYTFSAPRDVLALVRKLRREIDSLLDAKARNPGLGGFGCGFVDAMRALVA
FT                   DEEHRAYGGDDRGRDRGGGGGDRGGGWGRRGGRGGFGGAPGTSGGDWECSNGCGLVFGG
FT                   KRSCFRCGAPREGDRGDGGRGGLGGGPPAPRHVRF"
FT   CDS_pept        join(complement(619272..619457),complement(618864..619010))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636942"
FT                   /orf_name="MICPUN_56889"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62175.1"
FT                   /db_xref="UniParc:UPI000199A6CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I9"
FT                   /transl_table=1
FT                   /translation="MSGLDEYDYLIYPGFMRRPMARWNEDGSVAPMARARGPKGEAFQL
FT                   TLKQSEIDEDIAHIEYEIGIGKKPKKKRTGPPLNPKLEAVKKQEEEERVASESEREEQD
FT                   GDSDKK"
FT   CDS_pept        complement(619591..619782)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636943"
FT                   /orf_name="MICPUN_56890"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62176.1"
FT                   /db_xref="UniParc:UPI000199A6CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J0"
FT                   /transl_table=1
FT                   /translation="MQGDARVSAADIKVTADLDRGCVLGRPKGPTFVSARDADEAGSQR
FT                   HDRRTQAGSRKRFAGKVN"
FT   CDS_pept        <619880..>620776
FT                   /codon_start=1
FT                   /gene_family="HOG000157237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636944"
FT                   /orf_name="MICPUN_70956"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61750.1"
FT                   /db_xref="HOGENOM:HBG709927"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI000199A6CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J1"
FT                   /transl_table=1
FT                   /translation="ETTVVSAEWLKANIGRPDVVVLDCSWYLPAMERDPRAEHEAKRVP
FT                   GARFFDVDGVSDPSSPLPHMLPDAGAFAAACDAVGVANGDQVVVYDGAGLFSAARGWWM
FT                   FKVFGHDAVALLDGGMRAWEKLDGATVETKPPAVPIAAATDACARWYDDASKPSSTPSS
FT                   SFRATLRPELVLRRDDVLARCVGAAATETLVDARPKPRWAGEAPEPRAGIRSGRVPGSA
FT                   CVPFFDVLDADDRTFKSRDEIRDVFSAAGADVTGAKKVVASCGTGVTACVLSLGAAIAR
FT                   GDGTPLPVYDGSWTEWGA"
FT   CDS_pept        complement(620909..622051)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636945"
FT                   /orf_name="MICPUN_56892"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO62177.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG608966"
FT                   /db_xref="InterPro:IPR010675"
FT                   /db_xref="UniParc:UPI000199A6D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J2"
FT                   /transl_table=1
FT                   /translation="MEEAPGAEEAPEAAPASRAATKKRSREDRDAAGASNPPSGLDAWA
FT                   EEATANRGGAGAASSAGGDGRGGGDAAPASHVKFGGANGGGRDANGRQRQCFRYGNYHR
FT                   YYGYRVGESLEDHRIAHLKREWFHRKRCVDVGCNEGLVSLSIAVSFGSTTMLGIDIDEW
FT                   LVKKAREKLRRMRRAAAKAATKAERESEEAARMAAEASAREADAAAGGTLRSHPATRVA
FT                   AATETTDGTGEVGSQLGAKLADSGPSLGGVTFRASNILDETFEPGSVDAFLCLSVTKWI
FT                   QLNWGDAGLKKMFKQIYDALSPGGVFIVEPQPWKSYKQAFRKQKMPEETREHFRGIELR
FT                   PAFFAEHLRQVVGFSSVQAIRSADLHVADEFDRNLLLCVK"
FT   CDS_pept        622478..624277
FT                   /codon_start=1
FT                   /gene_family="HOG000264576" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636946"
FT                   /orf_name="MICPUN_56893"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61751.1"
FT                   /db_xref="HOGENOM:HBG560131"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199A748"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J3"
FT                   /transl_table=1
FT                   /translation="MSFRKGLVEIWEDMMSYRTLKVVKISDKRLAYVHKSLMASILVYA
FT                   TITMVGAHTYMLKEKPRLYVTTTVDDTNRLSNWTLDSTSGPRGYCNSAYTSFPGDEFVP
FT                   EPAYPQTRCASYISTAQMVSVTDQGAFIGTHMRQQAWKRTCTDETTKLDCVVENKDENG
FT                   AAVDAEDHFAADIENIVLKLQPIYVTSWGVSEPAHRITVVNAAGQEVKEFERYGTDSTS
FT                   QWPTFTLKELLKLAEMDIDAQNPIIVSKNFKGLDAETGQPRLPLYRLTGLRIAVDFTFS
FT                   NFRPMGQMKPFDFTPLAVMTVKATSVGSFVTPRESTIYSGTTSNFDSQGTTLSIRGVKI
FT                   EYQAKGLMGKADGYTGMMALMSCLVMVGVATAIVDVIGAFIYDSFKDDKIEDDSERQHL
FT                   EHMILNIETSGVPFKNDDFEFEPGTSVKKQIDELTRDIQRQATLLHHMSGELAAAGLNS
FT                   HTMHMADLGEGVQSARYECVLKGPNGEDIFLTGGPQTVGRGHGGTQSKRISHKQISVVA
FT                   NTHNGMARVQGLPTKNISGVALGGGPWQPLGPEASVDLKNGDMIALLMDEGADEAETTV
FT                   DGVFRFQATYVEDKQQGGSWFGW"
FT   CDS_pept        624694..626592
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636947"
FT                   /orf_name="MICPUN_56894"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61752.1"
FT                   /db_xref="UniParc:UPI000199A749"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J4"
FT                   /transl_table=1
FT                   /translation="MRPSIARDPGGGSRFPAPRVRPKSARRSRERSFRFRGRSNPASAP
FT                   RRCPPPPSRAPFRPINSPALSPRPPSSDQHHFPITTRRARGDGWSWNWDAPKPERNPAG
FT                   SRGPGLSVTGGRDAASDVDGRQVGGSQRGQLRLGPAGGRTSIPNRGPGAAPGRVGDGHG
FT                   YPRAGAAAAAAAANDLRGYVPAYGLGADLGGMNLDDINDTAGATAYVDDDDLDSPEQHQ
FT                   THDVIITEIEEINLTDYMQTLQAPTFSEEALATADFGFGGDRTFSGSGLYGAGMNGFDA
FT                   AASPKQGAGGVMGGSDKFPMRSETPGRAGRRVWSRGGNRSTDAGSGGLATATPGIDRPQ
FT                   TGGLDEADVNRPLHTHGLDDDEDGGDPEVDADIFDDSDDDSWGEETHAVDTFGGNQNGA
FT                   DVLSDDEDGGHAASPKAMGAVNPSFGGSAIAARSPGAGGGAGGSFSGFVSGGGASLPGR
FT                   QSPLPGSSSSSSSSFAASREARRRREEEGDFVVMSTPSGLRRVPSARRRPGTGGGGGGG
FT                   ARPGGGGGGGWPSGAGFKDGSGGGKAEVVADVYGAKENASIPPRGASAGGLGLLQRPPS
FT                   RQRPPPEATNLFARRAAAAAAAAAAPVVPGLNKVSRPAGMASNMMFSHRPGQTGGW"
FT   CDS_pept        complement(626801..627634)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636948"
FT                   /orf_name="MICPUN_56895"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62178.1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniParc:UPI000199A74A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J5"
FT                   /transl_table=1
FT                   /translation="MRTHAFRLGAVLFLALATTGAFAGDCTGLLNCNDCASIAAISNHK
FT                   CLNGGTCNAAYASSDDKVCICPSSTEGVECQTPGVTRCAGGSWCGNNGECGTNFRCKCT
FT                   VGFTGNRCEESQPPDNCVIPSNHQCLNGGKCTNNTNTPCNCPPNVGGPSCEKVDVRVCV
FT                   DGTYCENGGDCKVSGGCACDEGFIGATCGEVDREWFQARYNSGGGSSSSKKEVVNVAAA
FT                   VAVPLVLIIAAGGGFMAYMVHKERKGAPLFSKIDDVPDVEMSARNALPAPAVAKA"
FT   CDS_pept        627909..628442
FT                   /codon_start=1
FT                   /gene_family="HOG000019780" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636949"
FT                   /orf_name="MICPUN_56896"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO61753.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG704211"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniParc:UPI000199A74B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J6"
FT                   /transl_table=1
FT                   /translation="MKHGRHFRKLGKDASHRWAMMRTMVTQLIEHERIQTTVAKAKELR
FT                   RVADRVVTFAKEGSLRARRKAAAVVRTDAMVNKLFTELAERYKERPGGFTRVLQIGQRK
FT                   SDSAAMAYIEYVDRDGELRPARPATGFGLSWAAKEYVNSQLASKKRHGDVRAVLSPAAD
FT                   AAAKAAAEPPKEEK"
FT   CDS_pept        complement(628656..629258)
FT                   /codon_start=1
FT                   /gene_family="HOG000264526" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636950"
FT                   /orf_name="MICPUN_56897"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62179.1"
FT                   /db_xref="HOGENOM:HBG560135"
FT                   /db_xref="UniParc:UPI000199A74C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J7"
FT                   /transl_table=1
FT                   /translation="MAPTDVPKKERSLSYRLHDALNVPLVGGLAIMCILGLLGLMDAHL
FT                   ITKIFISYIAVDTIWIVLSPSAVPRFAWAIVLHHVLTFLILLHPLRFPEHAIETCRDGI
FT                   VELNTFFLIARRQLTRGSLLNRACDLMYHLTLSIRFLWQPYLIYHFRIITHMNSTDRPG
FT                   GYTFREHYMVMVSQVLLCVFNILIVLPGLLPKKKKKA"
FT   CDS_pept        join(629589..629651,629765..631954)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636951"
FT                   /orf_name="MICPUN_56898"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO61754.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199A74D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J8"
FT                   /transl_table=1
FT                   /translation="MGDDVVNVFADEFEHPPGETLDILRDESIVKTVVEPAPAGGFKTR
FT                   PSVGDQVSFTVRRVHAANAPTAGTVAQDAELERYLLGCGAQCRAVEVALETMREGEVAT
FT                   FLCKERHLPAPNIESVYPEEVTIRLAKIFRDVDLTPRPSPGGKLIKRRTRWGDAKTHGQ
FT                   TLYEPMTLSHSPRPGYGSDTGRDVARPGCRVIVYTKHKPTAVNANTGLDAEPWTPMEFT
FT                   LRSTAVDAPPCPDGVHEALELSLTLASPGERFEVTFPASVYGFADDRVDGTVESDAVAS
FT                   ARFAETYDTGGDLVTTEVHVRAVHPPAPFAPEHAGPGGWGGTKDVGLDGEDLWTMPKWE
FT                   RAHRAKAAKERGVALFKAGRHRAALRAYDVAIRLLTAPFAPLDLSKVEMPEWDPPSEQD
FT                   PLGKDPHLKLAERYGSNAWRGLADSGLGEGNENQVLLKATILNASLAASRRGDHATCEW
FT                   YCSKALAEDPMCVKGWFRRGRARVAMHRWDEAEDDLNRAERLQGDDEIAKELDVERKKL
FT                   AAGRKKSESGGAVAKAFRAVFGGGGGGAGEYPKPREMRRLVTGDLGIEAGPAHPTGRLD
FT                   TDEPGAQLDELLDETSPHTRMEHAFNKALHYEQIGLNEFVDSGMPIELYSEAELAPVGE
FT                   GHPTAQAVEKREYVVPFGEAEAAELDAEIAEREHDEELYDKMLNAAKRGNRVQRGTATH
FT                   NPWDRDGTKAVDELNMQFVKEYNEQKMEEAKEEMEAHKKQWHERKKRATGDDIALD"
FT   CDS_pept        join(complement(632692..632772),complement(632468..632539))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636952"
FT                   /orf_name="MICPUN_56899"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62180.1"
FT                   /db_xref="UniParc:UPI000199A74E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J9"
FT                   /transl_table=1
FT                   /translation="MAEADDDKKWYSKPNKRESLWGLGGMAIASSVAGIIYLVKREKDE
FT                   KVDKK"
FT   CDS_pept        633364..633537
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636953"
FT                   /orf_name="MICPUN_107904"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61755.1"
FT                   /db_xref="UniParc:UPI000199A74F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K0"
FT                   /transl_table=1
FT                   /translation="MDAMGPVVVNEDGSLSRIANWPMLTDREKEVTQRRIAKRNKERLD
FT                   RLREAAKENERA"
FT   CDS_pept        complement(633625..636048)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636954"
FT                   /orf_name="MICPUN_56901"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62181.1"
FT                   /db_xref="UniParc:UPI000199A750"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K1"
FT                   /transl_table=1
FT                   /translation="MVQRRAHPLPPRLLLLVVALLPALASAAAPTSVNPLAAVAESPSL
FT                   PRELVARVRASGAELAAGGLAPLAAAAVDARGGGDALARTLASTRAAVLALCGSAAVLE
FT                   RSADDTTPRADEAGDPAPAPPALLEDAENLAALFHWLAVELDAALAVAPDAPASPTARR
FT                   EGGTWSLADELREARAVLAARLETSSSSPSSSSSTSSSSNSGFSCYRWSGYIARSLAAR
FT                   NALSLPFDELVEATSTWSDAELDACGLRHARLAFLATEINERETADDAGGGNDSRNEHL
FT                   VHGLNLTAFGAVVETCRVGGGNGLAQLVGPGAFAAAATRLARLKSHLSAMDTALRSQTA
FT                   IDGFRCLSDASLAPAMDDEADAPPGSRLATATAILSFLAGAAEDVLVADRGCERARESS
FT                   STGAYYPVPVFDRIAQELAQCGVGDAYGRAWLRARYPNGGTAGLASRLDQVAAAVDACS
FT                   EGSSLNREDVKAARSKTPPLTRVDLDALAATIRHFRSADAAMFGCRRGAYAHSAAGALA
FT                   HALDGYRAVLASCPAATADSTGSDPTEIVHPEIVHPSSSSYVVIPVTEAAARGEGVKGR
FT                   GRFEPGGGAGFVGVVSASCVLAVGGVAFCVARYLQTRRDRSVRGPWRKMDAAGGDLGRP
FT                   PRVPPSGPGPGGRAPFAFSARRFYRHLQAGSVGDLPLVEDLDRASGVSTESEGNDRVDT
FT                   PPLRMGNVVDLPSPRTNRRSNSISEPATRPPPAVTPDDLVLRGFAGGISEPKPRHPSRH
FT                   STPYHGLRSVGELRVNIPVGAFRETADGRRPTTPPAGASGAAPFFGGEKRLTHP"
FT   CDS_pept        join(complement(637691..637729),complement(636263..637396))
FT                   /codon_start=1
FT                   /gene_family="HOG000182211" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636955"
FT                   /orf_name="MICPUN_90239"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62182.1"
FT                   /db_xref="HOGENOM:HBG693975"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="UniParc:UPI000199A751"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K2"
FT                   /transl_table=1
FT                   /translation="MDGPTDAEKLPVTIVTGFLGAGKTTLVNHILKGDHGKLIAVIENE
FT                   FGAVSIDDALVGENIKEQENIITMDNGCVCCTVRGDLVRALLTLKDKTKKFDHVIIETT
FT                   GLADPAPVAFTFFINPEIADHYRIDSILCLADAKHIGLHLEEEKPDGAVNEAVQQVAFA
FT                   DRILLNKIDLVSDTELAAVMEQVRSINGVAEVIKTTNSVVDLDKVLGVSSFSIEKTLEV
FT                   DPDFLEDEEGHAAATAAHDGAAADGGDHGHGHSHDGGKTECHEDHGHGHGHGEPAAKKP
FT                   RKKRHDLTGVSSVGILAEGELDFNQVNTFMMTVLQENAKSIYRSKGVLCFKDQGNTKFV
FT                   FQGVHEHINFGPSSVEWGADEPRVNRMVFIGRNLNRKELEEGFRACLVKD"
FT   CDS_pept        join(638407..638465,638665..639161,639319..639578)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636956"
FT                   /orf_name="MICPUN_99437"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61756.1"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniParc:UPI000199A752"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K3"
FT                   /transl_table=1
FT                   /translation="MGDDSHSDTVEVKGDWRAFRAALVNQEHAHRQRFNQQQQANHVVT
FT                   NLSAASTAYSRRQASKITPGDWAHVLPEAETGCLLLAPETEEGWWRHSVVLVLNHDAEG
FT                   STGVILNRPTNAQLKNVVPEIDYSAPHHRVLANRHVSMGGPMGTEKGARCLVALSHTRL
FT                   DGATSEVFPGLWHVSDFSAVKPEHEPSLMVFVGYCGWMSGQLNAEVAANGWTVAAASAA
FT                   NTLALVNASARAGDVMGESMWATMRGRLGYPRPGNLGYDTPNFGAEGPL"
FT   CDS_pept        complement(639847..640569)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636957"
FT                   /orf_name="MICPUN_107906"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62183.1"
FT                   /db_xref="UniParc:UPI000199A753"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K4"
FT                   /transl_table=1
FT                   /translation="MSDGYAAAQARKEAYLASLILQDVEKRGEAVRERGVTAWAHRPRE
FT                   REQVNERFLRNTLRGVDSSNRRVEQQAVRSGSPAPGAGGAKRVRPEDVVVDHGRGGAGS
FT                   TRRGSEGTSSSSSSAAASSSDSEPDAKPSAGNGKGGMRDDELAEFLSRPRVKRGRGAVG
FT                   SRADEPGPFLPGGGAEHKVGGYSLVLANEETRRNDARIAAMRDEAKRKERKKAEKREKK
FT                   ERKRERKEGRSEKKKRRR"
FT   CDS_pept        641175..642533
FT                   /codon_start=1
FT                   /gene_family="HOG000264352" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636958"
FT                   /orf_name="MICPUN_56905"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61757.1"
FT                   /db_xref="HOGENOM:HBG560142"
FT                   /db_xref="UniParc:UPI000199A754"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K5"
FT                   /transl_table=1
FT                   /translation="MARGTGPSRRSNRPSSRALGNSALNTRGIARGERGTRGKSSRVAS
FT                   RATSNEDDEPPAPEPLLVIVEVDGVLCDVHCDLHRLAFNEAFVELGMEGASWSEERYLS
FT                   LLRTGGGTAEGMVERYFHFYGYPTPELRDPTAHIPDEVGQAAMSGSIRPEGWNAEGASV
FT                   AAQAAAIQAAASRNPLNRELLARRRLEWIDEVVAKKDERLRAIVSEGRLKLRKGALDFI
FT                   DECLLEDGAQVVFVGATASAPEEGVLDAVLEAIGPLRAAAITQCGGHEQIDGCEFQSFE
FT                   NYHANNIVKDITANGEVAAREEQLQAVNGDVDVRKEMQAMMKQRKGELLAEEIGGDLQR
FT                   QRFDSNVVVDSGVFCTSTRSVISAEAVRGMLEAKGFGKDRAIFVGASRTTCAEAGAAGV
FT                   FNVLARTAHQADSQITDVACVVDGFGGGGGLTLRYIKRRAAAWDGRAATMDET"
FT   CDS_pept        join(complement(644174..644852),complement(643871..643923))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636959"
FT                   /orf_name="MICPUN_99439"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62184.1"
FT                   /db_xref="UniParc:UPI000199A755"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K6"
FT                   /transl_table=1
FT                   /translation="MVIRVSNDVLVVPPFDCAWLSSPDAESLTTASSEGGEGIVVSFDA
FT                   KADSDVTVILKGRRTSKSELDSRPARRLDHWSGRQDDPAKVDASTYLVIIGSHRNSACV
FT                   IEKNGRVVELAKGPAVPLLPARGRDAFTRCFVSWYPKRGALVVGVGEHLRHAWVDPEPH
FT                   TDPICEIGLSTWDDYAQYRDIEVRALDPDGGSRVNSWSATPADSPRGGRRPAPPPAVAD
FT                   VENLRGATRCARCCRTFGSPR"
FT   CDS_pept        644995..645621
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636960"
FT                   /orf_name="MICPUN_56907"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61758.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A756"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K7"
FT                   /transl_table=1
FT                   /translation="MAMKTTIWRPNVRVTLDEYGEVEDTERGGEEVTKQGTKRKRAPRP
FT                   KGPCEHGVKYRSRCKVCGACPHGKRRCYCKECGGASICEHGRQRSHCKECGGASICEHG
FT                   RQRHQCKECGGSGICEHGRHRFSCKECGGSGICEHGRIRSACKECGGGSFCEHGRQRSI
FT                   CKECGGAGICEHSRRRSQCKECGGGSICQHGRRRSQCKDCRGERL"
FT   CDS_pept        complement(645707..649054)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636961"
FT                   /orf_name="MICPUN_56908"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62185.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199A7BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K8"
FT                   /transl_table=1
FT                   /translation="MSTGAADPERVRTSITSMNALLDPLKHLYLNLADADGKTTRARCL
FT                   FALADTGILDDLPCADVGADLGHGFSDDVEVEWTYEDFVNVLGAAIAHRTAHRKPLPAA
FT                   PRGVAQRQLRDLFHLCCNDFDRARPKSNASRLTLHQWLVVCDGADLLTRRFTRDAAAVV
FT                   FARCRRGAETDLGLDQFITCLASLAVETGKTFEAVVSAVSTSPLCTGGAENVAPAKDIA
FT                   PGAAKDTYKTPGKVRVPTVFGGAKPKTPGAALKTPGASLKTPGASLKTPGASLKTPGAS
FT                   LKTPGASLKTPGASLKTPGAPNDVRYTAALESAVESPDAKSFETHDADGDGLLNRHELA
FT                   SLLAQGDSASVDGAIELVSKLFDDVDLDRDGRVCLAEYEAFCKKARRTLRRRTMSSAHG
FT                   PTASAPVPATYATDARLEEMFVAYCVVGAAKTPAKERTTNEGSVHVNNQNAFAAKRTID
FT                   ERRFLRVLKDAKLTGPGFLSQQQAQLCFHSQCARNERKLDHAGFLRALGAVVAHSGPGA
FT                   TYESIADAVKSLPIPDKLSAAVIERTIAPQPPARAGTGVGPRPHSARAGIGSFSTSSSS
FT                   SSGDSGFGARANAAVRTRPKSAKPRVSVSFADDDDVKSDVKSDVKSDVKSDVKSDVKSD
FT                   VKSESTAPDALLAAFDRRDAEANDGDVTGVASIGVCRLALADVAGLNGADAAAVADAFR
FT                   DVFEAFAVRAKLRREKLGEFKRKFDARVANLALAGAPLVPPVQVPPMSAPQSDAISGVF
FT                   DSTVGTSAGAPDFMTAAEFASLLSAAGLIDTDADADAVEVTFCRCVGGKPRGDADFASF
FT                   VTALAAIAGERRLTFFQVAAPVVDAAMRARAARGKEKEAGNETGDAAEPEAEPEPEAEP
FT                   EPEAAPEPEPEAAAAPEPEASEPEKAEAAQTAAPPLTEEERAVWAQEFKSHDEAESKSG
FT                   FVDVERVSFALAKLRLLEDVDVALAASELEASVKIVDPSGVGALDLDAFIAVGAAVRAL
FT                   KLGGRAKPSAKPVPVQREYVFDDSHPFAAKFRAVADVNGEIDGDSYRALLDRAGLLHDG
FT                   SRGSSETPETRLTNAGAAVVFARAKARHPGHGRRVPYRIFLGALSLSAGHLGMSFAEVV
FT                   ERIMATEL"
FT   CDS_pept        649408..650736
FT                   /codon_start=1
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636962"
FT                   /orf_name="MICPUN_52211"
FT                   /product="Predicted protein"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="ACO61759.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG525531"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI000199A7C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K9"
FT                   /transl_table=1
FT                   /translation="MALFGAGGSPAVCSSLYILDSNLKTLLMRDWRGDTNPSMVERFVS
FT                   IVNNAESESELKPIIYDDEIQTSFTYIRHRDLYFLALTRTNANAVALLTFLHRLVDIFT
FT                   HYFKELKEESIRDNFVIIYELLDEVMDNGYPQFTEAKILSEFITVGAHELQAPKAPMAV
FT                   TNAVSWRSEGLRYQKNEVFLDVVESCNCVVNANGQIVNSEVNGALRMRTQLSGMPECKL
FT                   GLNDKVMLQAQNKSTRGKSVELEDIKFHQCVRLARFESDRTISFIPPDGQFDLMNYRIT
FT                   TPVKPLIWVEAKVTRPSRSRVEYSVKLRTQFKSRLNATGIEVKLPVPGDATTPEVKAAL
FT                   GSVTYAPEQEAMLWKIKTVPGEKVVEMRAKFSLPSVSALEDDGPRQKKPPVMVKFEVPY
FT                   FTVSGVQVRFLKVIEKSGYQALPWVRYITKAGTYEFRLDHQSS"
FT   CDS_pept        join(complement(651599..652086),complement(651282..651488),
FT                   complement(651137..651209))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636963"
FT                   /orf_name="MICPUN_56910"
FT                   /product="Fasciclin family protein "
FT                   /protein_id="ACO62186.1"
FT                   /db_xref="HOGENOM:HBG750250"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI000199A7C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L0"
FT                   /transl_table=1
FT                   /translation="MPHTKRPLLLAALALVAFAALFNPAAAGDTAAVGTMDPPKEDALL
FT                   MPTDAEADPAATDAAAKEMDMAPDMDMEPAAEEDAELKPLGETLQADPEFSTLVALVTA
FT                   AADESGATAEDLAAEGPFTLFAPVNEAFTKFLETSGLSVEDVLASPDLKEILSHHVVEG
FT                   KYTAADVLAMELPAEVPTLDGHTIKIDKTTDGDVLIAGNKVVAPDIEASNGVIHGIDGV
FT                   ITETTPEPEDTTTNEEVTSTALLGTLYAAVLVM"
FT   CDS_pept        join(complement(654574..654591),complement(652305..654194))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636964"
FT                   /orf_name="MICPUN_56911"
FT                   /product="Voltage-gated ion channel superfamily "
FT                   /function="voltage-gated potassium channel activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62187.1"
FT                   /db_xref="GO:0005249"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniParc:UPI000199A7C2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L1"
FT                   /transl_table=1
FT                   /translation="MSKVTPIKGAPPPADDEPEMTEEERQLADGVAKLAELTAKYEQSP
FT                   YLLDPRSRLMKRWDLIIGIALVYTATITPYEVAFLDSKAGGSTHPSLPTFPIYIINVIV
FT                   DLLFFADIVAHFNLIYYDDQLANGTYVTDRRKIVRRYMRGFFVVDVVSIIPFHEMESAG
FT                   GLKALKLLRLLRLVKLLRILRSGRILKRLEDNLNVDYNVLSLVKFILGTLMIAHWLACL
FT                   WKLTARTVAEKDDWVTRYYSNFVDADLFATCYAETELNNELHACMNLSPWNMYIAALYW
FT                   ALVTMSTIGYGDVTPTRTEERFFVILAMLIGTSVFAYVVGSVCGIVASMDKKSNEHHER
FT                   MDTLNAMSREMQVGDELQMRLRDYFRYRHTSTNIEEWFELLELMSPSLRGEVALKQCGS
FT                   WINNVPFFSGAPDGFIVDIALKLKTETFPQGEEIVHAGQISTKMYIVERGVVGGKGRVF
FT                   TSGKVFGEEVLGGGSQAAFTARAMTYCDVFGLLGTDLDDTAASYPAMQKRLRVAGCRGM
FT                   IKDSLLAFAQAWGHIEKGIKVNPNGGVEDAERDPHVSVAELAVVRRKDDIFRFALSVAR
FT                   DGSAKPTLPSDPAGAFKAINRTFIDDSSGAGAGGDKVDRVLSAVERLERKLAALEARIK
FT                   "
FT   CDS_pept        join(655294..655437,655620..657002)
FT                   /codon_start=1
FT                   /gene_family="HOG000225180" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636965"
FT                   /orf_name="MICPUN_79903"
FT                   /product="Histone deacetylase"
FT                   /function="histone deacetylase activity"
FT                   /biological_process="histone deacetylation"
FT                   /protein_id="ACO61760.1"
FT                   /db_xref="GO:0004407"
FT                   /db_xref="GO:0016575"
FT                   /db_xref="HOGENOM:HBG396919"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="UniParc:UPI000199A7C3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L2"
FT                   /transl_table=1
FT                   /translation="MSGKPKISYFYDPDVGNFYYGQGHPMKPHRVRMTHNLLLHYGIYK
FT                   EMEVFRPALASAEDMTKFHSDEYIEFLRLITPDNQHEHMRQLKRFNCAEDCPVFDGLFN
FT                   FCQIYTGGSVGGAVRLNHKQTDTVVNWAGGLHHAKKNEASGFCYVNDIVLAILELLKVH
FT                   QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKFGEYFPGTGHLQDVGQHRGKYYSVNV
FT                   PLKDGIDDEAYVALFKPVMAKVMEMYQPDAVVFQSGADSLTGDRLGCFNLSIRGHGECL
FT                   KYMQTFNVPLLVLGGGGYTIRNVARCWTYETGCLLGHDLDNKLPVNDYSEYFGPTHELQ
FT                   IQPSNMENQNTPEYLQGILNKILENLSKIPPKPSVPFHDVPPDAIDQDAMRVKEDPDAK
FT                   GGGAEAEAARRSDPRELEPEDGDVDDKPSRHDASMRDVEDVDGGEKKVKEEKVEGADAV
FT                   KAELGDAADVDDPDAAVKAEKGGEGATDANDGDAANAGGPGIMASDHGDQ"
FT   CDS_pept        657228..658970
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636966"
FT                   /orf_name="MICPUN_56913"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61761.1"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniParc:UPI000199A7C4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L3"
FT                   /transl_table=1
FT                   /translation="MSTASAGSSGSIVIGARHGYARRTALRSSPGRRRLRTCAGKLSQR
FT                   KTRGSRGLSVVAEQHGISLEDARALFSKRFCKGSGVHLELQETPTGRGLVATAPVAPGD
FT                   VLITVPWREAIHVLEDGYSDGDDLRLALELLHVLDDGDEDGYIDGEYDARVKTWRKYRP
FT                   MLPVSTGAAAFWCVDNIRELQFPEAVEKTLAQRAEFTAGAMRHSNDSRTKERIMWALQQ
FT                   VHSRSFSVMTPQGRARCLVPYVDLFNHRPESPKEARMTDELLQRALRKAFTKGSEEGIN
FT                   DGEWAGAEPWQVVGPDPEDLENWEDAAVFQMRSIWAYEPGEEVFITYGHETSAELLTSY
FT                   GFFPEPNDGEFIRVYENVQDLIDDDRFVDEELNSPALQMEKEQFMWSMLAVEAPLAIRP
FT                   GGVRESAHLLSALRVVHARENQLAAMRDDDVPRIGHSTFVWTEGDEPCGMWDPDRFLSC
FT                   FFDESCDSDEWLWDDDDARDRDATDRAALAQACARCEEILRDDFATTLEEDQVMLDEIE
FT                   EAIRGLSPEEADEDPEGHLEYVAALRYRMSVKRILRDFISECKRAYGVEAEALKAEPEF
FT                   EYIE"
FT   CDS_pept        complement(<659196..>659642)
FT                   /codon_start=1
FT                   /gene_family="HOG000236769" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636967"
FT                   /orf_name="MICPUN_72663"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO62188.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG657462"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="UniParc:UPI000199A7C5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L4"
FT                   /transl_table=1
FT                   /translation="FHDPRGTLVEIGMGTGPNMRYYEGLNVVGVEPNEESHSYAYENAN
FT                   RNGVKSIECVRGFGESLPLGDASVDTVVSTLVMCTVDDVERTLAEVRRVLRPGGAYLFL
FT                   DHVAAPPGTPLRTMQEMLNPLNRAAYEGCRLTRDPEAAVRAAFGD"
FT   CDS_pept        660248..661375
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636968"
FT                   /orf_name="MICPUN_56915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61762.1"
FT                   /db_xref="UniParc:UPI000199A7C6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L5"
FT                   /transl_table=1
FT                   /translation="MAHFQHTCNACLKPICEGDVYITRCGHRFCERPRDRDLLASSPSS
FT                   LLAPLPSSRARARRLTTSAPPAVCTQATTTREGCVRRASARRAARRSTGRRISRCGACS
FT                   DRPRPSCAFFDRPFNRQAFAVRPGEEVSEALRGFDPGTIMTAAFNGINWWCEQAALVQE
FT                   MSSRRVQEEGRAHAEGYKSKLLEVHSAYKRAKAKAEALWQQMQQLELDKKELQSKYEQK
FT                   SGEKRRIEASYRELQSRGGVAGGGGGGGGGGHPRAPPSMPPPSRHAYQHMSSPPVHLGS
FT                   PPLDRNISRPASRPSMANFGGGNRPLLSGFPAGAAQTRPISPYSGDLMSPPQDYLDDRR
FT                   EWRRGGNRGAPRASRGGYRPPHSPTRSHHTFSIGN"
FT   CDS_pept        complement(661547..662323)
FT                   /codon_start=1
FT                   /gene_family="HOG000166435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636969"
FT                   /orf_name="MICPUN_99445"
FT                   /product="Mitochondrial protein translocase family "
FT                   /function="protein transporter activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="ACO62189.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG560149"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="UniParc:UPI000199A7C7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L6"
FT                   /transl_table=1
FT                   /translation="MGLRDLLGLRRGDKGNNAAAAGRDAYSSEIISEAVPEQGASGSSI
FT                   LDEPVTSGFSTPAGMVSRADLAKMGTGASGVAYNPYTGLGGPFDPQMSKALYTITDSPE
FT                   LLFDEERRAKTRSWGENITFLTGVGYLGGIIAGGGLGAYKGLSSVPEAGLVDTQKLKLN
FT                   RVLNAAGSRGTSMGNAWGCLGLYYAALDSLVGHYTSHEYPALGAVVAGAGAGSLYKSAH
FT                   GMRAAAVYGVLGAGLSAANQAGQFLVGYGAATRPRW"
FT   CDS_pept        662781..>663746
FT                   /codon_start=1
FT                   /gene_family="HOG000225141" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636970"
FT                   /orf_name="MICPUN_80010"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="ACO61763.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI000199A7C8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L7"
FT                   /transl_table=1
FT                   /translation="MHGPRGPPPDIAVEILASLIVSTVALLAGTVAVKALDPNRGAKKK
FT                   ADAMKRDIARRLGRPNIVTTPYEDMIATDVANPNAISTTFDEIGGLGETKRALQEIVIL
FT                   PLLRPELFSGGSLLKPVKGCMLYGPPGTGKTLLAKALAKECQACFINVRSSTLQSKWFG
FT                   DANKLVAAVFSLAWKLQPSIIFIDEVDSFLGARKGSEHEASTSMKTEFMTMWDGFQTNE
FT                   NARVMVLAATNRPWEVDEAILRRLPRSFEVGLPNLEQRIDIIKVILKDEHMEPGFFGPG
FT                   PDPPVLKIAKATDRYSGSDLKELCKSAAMGPIRDLLASEAR"
FT   CDS_pept        complement(664379..665470)
FT                   /codon_start=1
FT                   /gene_family="HOG000256919" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636971"
FT                   /orf_name="MICPUN_56918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62190.1"
FT                   /db_xref="HOGENOM:HBG315524"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A7C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L8"
FT                   /transl_table=1
FT                   /translation="MDPMGLSAGPNILELYQKPVNITTYDTKWIPTSARFVVLGSYARA
FT                   TGCLQIYSLDTENEGVKLNKELEKKAAFKCGTFGASSLRERHLATGNFEGYLQLWDLQR
FT                   PEKPLMDVKAHTSIVNAIDGAGGQRSGYGPPELVTGGRDGCVRVWDVRQKDAPVAIFEP
FT                   AEGVKARDCWSVAFGNSFNDEERCVLAGYDNGDVKMFDLRTGTVRAEHNVRNGVCSVEF
FT                   DRKEIAMNKFVVTCLESAFTVFDARTQHPAKGFSSVTEKVPVSATVWGAKHLPQNREVS
FT                   MVLGGDGTLMLYKYQYPDQRVVKDKDGVKMGVAGTMNLVNSKNVSTQPISSWDWSPDKE
FT                   GLAVCGSFDQTVRVVCATRLNTL"
FT   CDS_pept        665607..667811
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636972"
FT                   /orf_name="MICPUN_56919"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61764.1"
FT                   /db_xref="UniParc:UPI000199A7CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L9"
FT                   /transl_table=1
FT                   /translation="MNRRGGVAALIALAMVTFVYLAYVSGVGNMYLPSESVASTTSSPV
FT                   GRVAIPARIANPSPPAPAPLVDERPEPAPEPRASPAPTSPAVVRDDRKDEGRKLPMECP
FT                   MVDVADPENVAAVARSLGDASDVVVFATQDIEHWRAEFLVNVILNLMSVNVTSVVTVGR
FT                   HKHTCESARRDNPDVVRCCVYSTWLDGHDALKRWTLAEDHAYVLWLIRYRFALDIMRAG
FT                   EVGVLVSDSDMWFERDPFELLKDAATGLGTHSVVANVEGEPFPSMNGGLVYFRADLPGK
FT                   GGRYLLEVFNDHVDDLLADESPPECHKEQGVGTQVVWGAMMDQDILRDAAETAVAGAPL
FT                   WWSYTHHVCLFKGGYDEATKAKMEIKSKHPETLDWSRSGRSLPRPFQSHPAVEALGDEH
FT                   PLNESEEKYGIMKVPNYETWRNLTILAAPKWMFANHGDGDGWFALRPRPGAAFHCMSQN
FT                   QGIKPRMLRAYDMWHWDVLGAGRGIRVGQGRYLSLASAAFGHFTKRGEFAMQAHRLAAL
FT                   AAATGRIPVLPMIPCASPWLDDWRRPDDCYAGVLERINVLAGTCPVTALRQFQGPDAAY
FT                   PGDPAAEGSVGSPCCYFVPPGDDCEEKFAAWGAEMTGEDPHNRPGRTVRLDAIIDAAQL
FT                   VVDAGDATEYADRSWVLGDDFPPDNAKHPTDVFVDFGRVVKAIEGDGDQNTPWVEIDMR
FT                   GKDALPRVVTQRGVDDKSRRKWFMDYNAACPLVNRVSPMV"
FT   CDS_pept        complement(667974..668336)
FT                   /codon_start=1
FT                   /gene_family="HOG000039506" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636973"
FT                   /orf_name="MICPUN_56920"
FT                   /product="Predicted protein"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO62191.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG716384"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="UniParc:UPI000199A7CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M0"
FT                   /transl_table=1
FT                   /translation="MMNEAARPIVSLYRQILRAHYKCLPPPMRVLGDGYAREEFRRHLD
FT                   SKSMTNDRWIEFASEWSRYLANVAPKEEGAGPKFTGELSKETIDAMSEEQRMMLRKLKE
FT                   EAQSFGESVKADEETK"
FT   CDS_pept        complement(668395..668649)
FT                   /codon_start=1
FT                   /gene_family="HOG000264686" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636974"
FT                   /orf_name="MICPUN_56921"
FT                   /product="Predicted protein"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="ACO62192.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG560151"
FT                   /db_xref="InterPro:IPR005683"
FT                   /db_xref="UniParc:UPI000199A7CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M1"
FT                   /transl_table=1
FT                   /translation="MEIQPAAEPNRSSKPFGAADAWHVSKKLAWHTGKAAWQFGTSFLI
FT                   LVVPLVIQLHREEQMMALEQEQMGVLQSPTGNAEPTPTA"
FT   CDS_pept        join(669430..669562,669808..669979,670325..670904)
FT                   /codon_start=1
FT                   /gene_family="HOG000264687" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636975"
FT                   /orf_name="MICPUN_56922"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61765.1"
FT                   /db_xref="UniParc:UPI000199A829"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M2"
FT                   /transl_table=1
FT                   /translation="MANMANMFALLDEDAPKAAPAKENKPAAAAAPAKKAPAKTGDKPA
FT                   GNRNNGNAKRAPRAPREFEGSVEGTEGGRSRPRNADRRKPKDGEGGRRDRADRSGRGHE
FT                   GPHRGGAGKGGWGKPGDELNAPKEGDDAEPEPEPEEPDNEISIEDFEAAKAAKKAALNA
FT                   AMAKGATAKEVDSSAFASMTLAAKSEDVNEFSLDGAGPKAKRERERKAKEAAKLELGFK
FT                   SAPTAPAEDRPARGPGGRGGRGDRREGAGRGGRGEGRGGRGGRGGDRPAGGRGGSGLNV
FT                   KIEDSSAFPTLGK"
FT   CDS_pept        join(671829..672601,672665..672710,672744..674036)
FT                   /codon_start=1
FT                   /gene_family="HOG000075154" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636976"
FT                   /orf_name="MICPUN_79742"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /biological_process="DNA topological change"
FT                   /cellular_component="chromosome"
FT                   /protein_id="ACO61766.1"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="HOGENOM:HBG304889"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI000199A82A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M3"
FT                   /transl_table=1
FT                   /translation="MPSRGASSSVTPREAIAVGDEEAGGAPRDNTGDIIAAKAAAKAAA
FT                   AAATGGSDAYGASSIQVLKGLEPVRKRPGMYIGNTSTKGLHHMVWEVLDNGVDEVQAGH
FT                   ASLITVTVEADGSVAVEDDGRGIPTDVHPATGTSSLETVLTVLHAGGKFGGDESGYHVS
FT                   GGLHGVGISVVNALSDSTEVTVWRGDREYRQSFSRGAALAPMTEGSQDVANVGKKKGTR
FT                   VRFKPDPSIFKERQDFDPNIILARMKELAFLNSTATDEASMDEGDVKKTEEYYEEVLSF
FT                   PGGLKDYVVDLNEGAEPLHEPITFRAEVDGVQVEGALQWTKEAYTDTLLGYANSIRTSD
FT                   GGTHLDGLKQSLTRAVNTQARKAKLLKEADANLGGEHIREGLSAVIAVWVPQPEFEGQT
FT                   KTRLGNPEVRKVVESVIGEQVSEHLEFYPNTLGSIFSKASQAQKAAEAAKRARELVRRK
FT                   SVLRSGSLPGKLSDCSVSDPESTEIFLVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVE
FT                   RKDEASMYKNTEISSMVTALGLGLKGEPFDESQLRYSKIVILTDADVDGAHIRTLLLTF
FT                   LFRYQRGLFEQGKVYVAVPPLYKVESGRAGKNNPPTYCYDEAQLQAHLATLPEGASRSI
FT                   QRFKGLGEMMPEQLWSTTLNPETRLLKRLTVDDAAMANKTFQLLMSDKVAPRREFIETE
FT                   GPKLEDIDV"
FT   CDS_pept        674186..674542
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636977"
FT                   /orf_name="MICPUN_56924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61767.1"
FT                   /db_xref="UniParc:UPI000199A82B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M4"
FT                   /transl_table=1
FT                   /translation="MASLRLSSVTGSGLLLRTGGGSGGGRAGGGRWQSHWQPTTRSTSS
FT                   SSSSSSSSSSSSSSCSTTTTSSSSSGIRSSLCARRPRMFCPQNNPERQPPGRSCSCLSL
FT                   RRLITLYSYCSPSS"
FT   CDS_pept        join(complement(676280..676282),complement(675803..675961),
FT                   complement(675001..675555))
FT                   /codon_start=1
FT                   /gene_family="HOG000170917" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636978"
FT                   /orf_name="MICPUN_106801"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /function="transcription regulator activity"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="ACO62193.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG618766"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="UniParc:UPI000199A82C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M5"
FT                   /transl_table=1
FT                   /translation="MPAVPETALKRRKRDEAWAANKAKAAAEAKAKAEANKKEIFNRAE
FT                   KYVKEYRDQEADLVRLKREARAKGGFYVEPEAKVMFVMRLRGINDMHPKTRKIMQLLRL
FT                   RQIHNGVFMRVNKATINMLRKVEPYVMFGYPNLKSVKELIYKRGYGKVNKQRIPLTDNS
FT                   IIEKALGEKGIICIEDLIHEIYTCGPHFTACSNFLWPFKLSAPLGGMTKKRLHYIEGGE
FT                   AGNREDKINALIRRMN"
FT   CDS_pept        join(676751..676843,676963..677072,677214..677823)
FT                   /codon_start=1
FT                   /gene_family="HOG000264682" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636979"
FT                   /orf_name="MICPUN_56926"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61768.1"
FT                   /db_xref="HOGENOM:HBG560154"
FT                   /db_xref="InterPro:IPR005491"
FT                   /db_xref="UniParc:UPI000199A82D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M6"
FT                   /transl_table=1
FT                   /translation="MGAGVGEQVRKLELDAYQAFLKVTAVTGMSWERDDLATKLRQELN
FT                   ISNDDHTRIREKLSDDERIKTIRENWKQREINQAAKKARIDAGGFTGAKTPKAPASAKP
FT                   KAAPKAKTPKGPAAAPIVVNELICRRVQRFWPDEGGWFDAIITDYRPTTNEHCLTYEIN
FT                   TPNETFEWADISQFDGREFKLLEDRVNIEDLKFYSQGMKVGAETATHNQAIVATHAAVG
FT                   DVNKIVQKAAKTADVDKIVEAKGTLSAQEEALRAQLAALDSDSDSDED"
FT   CDS_pept        complement(677928..678767)
FT                   /codon_start=1
FT                   /gene_family="HOG000237461" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636980"
FT                   /orf_name="MICPUN_79533"
FT                   /product="Glycosyltransferase family 2 protein "
FT                   /function="transferase activity"
FT                   /protein_id="ACO62194.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG477361"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="UniParc:UPI000199A82E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M7"
FT                   /transl_table=1
FT                   /translation="MRLSVVVPALNEERNVARAVASAREGAGAADHFEVVVVDGGSDDA
FT                   TVSVAHSAGADAVLVSPERGRAAQLARGVERCSGDVIVFLHADSTLPDGYAEKLRDAMK
FT                   PEHSWGAFGFRLAPEERDDDDDAADPSTAARGSKGPGGGTARRFLEWCVDKRTKWLGAP
FT                   YGDQGVWVKRHALDSVGGVPQQCFMEDYELVKRLRRRHGMPCVVDAAVTTSSRRWDAMG
FT                   VARVTALNQLIVFGYAMGVAPERLARWYTAGRNMGGGTKRWDTRAEANAEATKVEER"
FT   CDS_pept        join(678958..680351,680392..680428)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636981"
FT                   /orf_name="MICPUN_56928"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61769.1"
FT                   /db_xref="UniParc:UPI000199A82F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M8"
FT                   /transl_table=1
FT                   /translation="MRLTCALLVMMFSVTRAVGASSVSSWAAVACPSRVVTKEDVGKPI
FT                   VLLGAWVRAGNGTDGSKDRHPSIASLRITSNPRHGALYWRAKPVLEGDAVPAEMGWERC
FT                   SEVSSRAFADAWPVGDPPLATPEWPCDVVVNANAPSPTHAAAAAAGVVVQPICAEVLYA
FT                   PDANYHNWPSGVDALGNRRVPGSNPTRDEAPDAFGFEFDLVAGDASAAGGAGGAADAMS
FT                   SSAASAASVLVAAVPDAPALTYTAAPIEDGDVAREGDRPALHAALLTRTRVRGIALRDV
FT                   DEGSFAVTVRIQSAVGNYVSVAGAGADVLARAVNPFRLGDGVMDAGVMEFTALPEDAAR
FT                   MLAALEYVHVVDDVYDERGYATDTVTVTATGGACLRSDDSFDDFSDAGEVTRCPRAADV
FT                   GATSVYVKVIVSGRVKDLGERSDPAWRRGFSSLLPIAASLAAATAWSAFAMWSGCAWAL
FT                   ERAGLGGAALGRRRARGA"
FT   CDS_pept        complement(<680971..>681759)
FT                   /codon_start=1
FT                   /gene_family="HOG000231240" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636982"
FT                   /orf_name="MICPUN_70072"
FT                   /product="Predicted protein"
FT                   /function="NAD+ binding"
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="ACO62195.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG596746"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="UniParc:UPI000199A830"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M9"
FT                   /transl_table=1
FT                   /translation="LEEREDPPEVMMEHVAVLVELIRQRGTFVMHTGAGFSTAAAIPDF
FT                   RGRDGIWTQQAKGRAVPMPRFENTKPTKAHLAAVALHDAGYLTHVVTQNVDGLHQRAGM
FT                   PQHAVSELHGSVFRELCRNEHCPMGPTPRDRTYHRAFDVTSTKRHNGRHRHRTGRRCDA
FT                   CGGDLHDVVVQFGEHLDDETLKTAIAASEASPLALVCGTSLKVPPASTLPRRSGALVVC
FT                   NLQWTSQDKHAALKIHARCDDVMLAVCGHLGIDVPEYDPSR"
FT   CDS_pept        682105..682584
FT                   /codon_start=1
FT                   /gene_family="HOG000264683" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636983"
FT                   /orf_name="MICPUN_56930"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61770.1"
FT                   /db_xref="HOGENOM:HBG560157"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI000199A831"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N0"
FT                   /transl_table=1
FT                   /translation="MAGTTAEDEDRDRRPRKSPFQKLRREQRSLLCFVQALVGHLVVIE
FT                   TRDDVTTRGTLVEVDERMNCTLEGAQRVTVEQALEKKNSKFDRMFVRARLIRYVHVPAR
FT                   VDPAELIERRRQEEFDASRHYQAKVVFGPINPSPYDNSEEAQKIRAERAKGYAKH"
FT   CDS_pept        complement(<683015..>684607)
FT                   /codon_start=1
FT                   /gene_family="HOG000271635" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636984"
FT                   /orf_name="MICPUN_66542"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="ACO62196.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI000199A832"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N1"
FT                   /transl_table=1
FT                   /translation="RNVDIALNAGQRVAVVGPNGSGKSTLLQVLAGKDAGREDGELWVR
FT                   KGINTAFLEQEPPFDEELNVLEAVYTRDTPLFRLLRRYDGMMAKVAAGEEVSENAMANI
FT                   LEEMDSNNAWDTENKAHMALEMLGCEEFMNRKMGELSGGQRKRVALAAALIEEPDLLVL
FT                   DEPTNHLSVEGVEWLENRVNEMTNTAVLLVSHDRAFIDNVCPDILELDGVGGSHRHRGG
FT                   YAAYLEGRAARWAAEEQARAAARNTLRKEQEWMRRQPKARATKEKARIERFYNLTERAA
FT                   DKGSKTKMVDLVESRQLRMGDIIVEFDMATLAFGDKKILDDFTYSFVKGDKIGLVGPNG
FT                   AGKTTFLRTIMGEIALDSGWCNIGETIEFGYYSQMPEFRDPTQTVVDFVKEVESDAKGY
FT                   VGSYGGEGGKMSAYKLLERFNFGGPKQMTRIGDLSGGEQRRLQLLSVLAKCPNFLILDE
FT                   PTNDLDLDTIEALEEMLEDFDGCVIVVSHDRQFVNNLVDHIFVFEGDGIINDWSGDYTA
FT                   LREFLRRLEEERES"
FT   CDS_pept        684953..685579
FT                   /codon_start=1
FT                   /gene_family="HOG000264685" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636985"
FT                   /orf_name="MICPUN_56932"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61771.1"
FT                   /db_xref="HOGENOM:HBG560158"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniParc:UPI000199A833"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N2"
FT                   /transl_table=1
FT                   /translation="MSASLRAAAPVARPRAPVRFRRRAPAVIRAATTADADSPPYQVAA
FT                   RKDLYELRIYGGHYVCRAPYNNREKGLAALMSYIEGGNEESKTFPATQPLIMRYECAPG
FT                   TEDVVGKTMELSLGAGVADPPASAEPEAVGVAAAGGELVAVVGFEGVATPELAGEYRRL
FT                   LTAAIRSDGLELAEPDGFRLATYGQLYSLKPRLNELMLKVKPPGA"
FT   CDS_pept        complement(685629..686441)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636986"
FT                   /orf_name="MICPUN_99453"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62197.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI000199A834"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N3"
FT                   /transl_table=1
FT                   /translation="MEVPHSPHWSPLKDLTRISDAGATEDERTVHASVELKSTETEIKS
FT                   HRCPICYQTMLMPKRAPNILMPCGHTFCNACLNARDDPRCRTCGDRWRHRVPNHQLQTT
FT                   IQAYVDATATAAASFEDSVIWTSGDRGAPVASSSFDAALARAHVRCEQLRERMREGEAA
FT                   QTAALHREDVEARHLLVLQCDEDNARVRLAEVARELREAHAAVEAQRAVCAGIANEVRI
FT                   HGSSVRSAGEALAAVERGRERLVAEAEGSADGRTKPATLPGTHTAVSR"
FT   CDS_pept        686953..687696
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636987"
FT                   /orf_name="MICPUN_56934"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61772.1"
FT                   /db_xref="UniParc:UPI000199A835"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N4"
FT                   /transl_table=1
FT                   /translation="MVANKPGNLDGETAGSTVWTPPNELVVAAARARDAVAPSAERSAL
FT                   LKEKERQRSKRRRENATAEQRAKERARSARRRNALTPEEKQAQALKRAERRKERKANGT
FT                   LPAPKRAHRPLALAGSPERPLALRAAGEVDPATPGELGTFVEAVTAAAGAKATGAHIGK
FT                   GLTADDDAGDLRAVVPQIASATERRTPKKASTEEQRAAERNRSKMRRAAMTDEQRKKES
FT                   QARAERRRRSKALAAGGGGDGATAE"
FT   CDS_pept        join(688189..688287,688443..689825)
FT                   /codon_start=1
FT                   /gene_family="HOG000177308" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636988"
FT                   /orf_name="MICPUN_56935"
FT                   /product="Predicted protein"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="ACO61773.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="HOGENOM:HBG315290"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A836"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N5"
FT                   /transl_table=1
FT                   /translation="MFCSISGTTPEDPVISSKTGHLYERSLITKALQETGECPVTKTPM
FT                   TLEDLLPVKSSTTVKPRTTAAASIPGLLSIFHNEWDALMLETHELRVDLHGTRQELSHA
FT                   LYQHDAACRVISRLMKERDEAREALANARAAGPSAAPGKRAMSSDAMDVDGDAPGGDGK
FT                   KQRSGVPPEAIDAMTAKSKELSKARKKREISPTLASAEDIGKMEVGAIAPCHATKAKGI
FT                   RAVCVNPLNADEVATGGADGSLALFDAAKGKRGALMTGHKKAVTDVAYAGDAILTSSAD
FT                   KTVKIWRGGAEVAALAGVHEGEVVAVSAHPTNAYAVSIGGDGAWAFVDVGAAECLSVQR
FT                   DADSEYTCGGFHPDGLILGTGAADSSVKIWDVKTSKVAAKVEGHVGAVSAMSFSENGYY
FT                   LATCANDGVKLWDLRKLKNFKSVEAAGVRCVRFDHSGHYLAVGGADACVHNVKAEWEVV
FT                   KRWEASKAPVNALEFAADAKALYAGCSDHNLRVIA"
FT   CDS_pept        join(complement(692259..692339),complement(690471..692117))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636989"
FT                   /orf_name="MICPUN_99456"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62198.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199A837"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N6"
FT                   /transl_table=1
FT                   /translation="MTTDGDPRGLPNSHVEGISEGQILSMEGDELAAHDNLEEALDRYD
FT                   RALLADRKQHGDTHPDVAARYCSIGGLYKATGDNEMAREYFAKALEVEESTGTDGRRTA
FT                   RASYMSNLAAVSRAAGDVDLARDQYCTALDHLRGMIPDSNEAVETALSREEASLFRVSG
FT                   DTSTSGYGIGGEGVAAPSPKLLGEGGVLNVAASILNNLGLLLKSIGRLHAARRCYVRAI
FT                   SLGAVALGAHSPAIALRVRNLGAVLLQLGYVDLAVERLTRAHGACVLGHGADHPETIMC
FT                   AEWLQAATETADLDAHAHAHARGVGSDPDETLPEAAEWFCERLRCGVLEPTPEPSLPGE
FT                   ERAIEAIDPAPIGLEDAMVPAVEHATRDAEAAGVGHSHAGTGKTFGVGTPGLDASESQT
FT                   RFNPVEPPPGEDMLSPYAAPVTSRELKRVGNAETSPVWRAVALEHEAIVSGKSSMPRGQ
FT                   DYISAYLRQAPGYANLITPFQEMPSDLLMPYASFRGYGAPLKSGAARQGKGEPRRHQLP
FT                   KRTLDERGVASSAGTAPRPRAIEVREEEEETTPVAQVGLGGRAGESRSGGRNMYAYPD"
FT   CDS_pept        692526..695225
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636990"
FT                   /orf_name="MICPUN_99457"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61774.1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A8A8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N7"
FT                   /transl_table=1
FT                   /translation="MASSFKWDHPNGRGVLLPGQTHCHTGKLVPFDDYDLDATCELVCS
FT                   PCGRFPDPDAPVRVKGTAHLAGAMVGKSADKENRDARTNVPPMETAGWALMGCKPCGSA
FT                   KRWSCCGTCAGGCRMWSEEGYVMTGGPKPPDDDADATDDDDGAPKLGGPLEGTPDAAEF
FT                   ASWDGCVAIPTPAVVPLPEPRLEGAHGERIARLTVGRGAVTCIAVSGCGTRMACGGSDG
FT                   SCVVYAIDPSADDLAPEFLCAAYPGKPLTKPRTRRQKNANAVVCLDSDSDVEDPTEAGL
FT                   DADELAEKRERDAAEAARVESEVTEGGHAGAVSCVAFHPDAASFYTASADGTCKRWKIP
FT                   VVSNSAHATALMSTYAHKRTEERGAVRCLRVSDDGARLYVGGEEACLAVYDAGSGDVIA
FT                   RTYSPRWPEKDKDGLGVPPVDDEDEDPEAAEKAAKAAEARAEREAAMTPEELAAVLDAE
FT                   AAAAEAKAKYLEEKRYRNKPKGFGGVNTVLCIAGGAGESGDLVFTGSRDCNVRRWAVSG
FT                   DAPVVERVIPGHKAPVTAIAVSRDGSELVTGGARGDGELRHYRWQPVAGVDAEYVDGKL
FT                   KSSAGSYVRVRTIRRGPEGFKESAHPAGVLAALISPDERYLYTVGANEGGVEVAISRWS
FT                   VETGAEDKDFRIETNHQGGVTSLCLFPDVAPPGSDAAVGVAAVTRATAARAGGRILTGG
FT                   ADGCVDLWTAERHDDGAGQQLAAEIAQQEAAMTATEYQRAQVKLTALSPELSRPAMAAR
FT                   GRKELPALEAAKFPIDEETGTKKDLEDFTVEDFEPFTSKELISMCCAHGLLFIDPKKPP
FT                   ESKRAIAERMVAFFREEKEKARIAAREERMGLAQPAKLRARPRIPGIESPEEKKKPTSG
FT                   DEESEASETEVSETELSETEEEAKKDDE"
FT   CDS_pept        complement(695284..696183)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636991"
FT                   /orf_name="MICPUN_99458"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62199.1"
FT                   /db_xref="UniParc:UPI000199A8A9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N8"
FT                   /transl_table=1
FT                   /translation="MAPEKEPLEPSWLAQVKELLGPHKRYHRAQTEDALPSGVKVEQAS
FT                   RFPKEVAHFTRWKIIHIECSRWDADAMMKRAEVHVVDLVDAATIKLNPALHSHALELEA
FT                   ADDGLVVSNRGGFHSKPDAVQKLSDCGCEEATQIMNLVRSCVMYEPGKKARHENDAKVT
FT                   TAWINVCRNGHTHGLHSHEPAKFSAVYYVSVPESKEEEEEEEDSLSGHLVLRFGSGGNE
FT                   GDPALGLEDDSWCLWDHVEPKEGRLVIFPSSMPHGVLKVSTAADEEKPRISIAFNTGEK
FT                   NVNLEKYGKKNKKRKKTE"
FT   CDS_pept        696428..697309
FT                   /codon_start=1
FT                   /gene_family="HOG000264703" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636992"
FT                   /orf_name="MICPUN_56939"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61775.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG560164"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000199A8AA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N9"
FT                   /transl_table=1
FT                   /translation="MKTGPPAWAVDASIVFALVYLAGSLELVEPFERYLVPETLPKYSY
FT                   PFTTDQSVPTWTLPFLGVFIPLGLIVSVAAFTGAGWLEIRRSIAGLCVSVSLGWAVTNL
FT                   LKVSIGGYRPDFLYRCWPDGNVAWASPGVPACTPTNPRHVIEGRKSFPSGHSSMSFSGL
FT                   AYAAAYATARLEVFSPYDYGVVGVHPRDRASMLRMALAWWPLALATYVALSRWRDYWHH
FT                   SEDVICGSLLGTGAAYLAWVTKQPLAGAGARGAGGLRREGRDYAPIGAESGEGSADSAR
FT                   LDRMEGRGPRSE"
FT   CDS_pept        complement(697428..699731)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636993"
FT                   /orf_name="MICPUN_99459"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62200.1"
FT                   /db_xref="UniParc:UPI000199A8AB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P0"
FT                   /transl_table=1
FT                   /translation="MSDPEDEEPAMEEEEEEELEVEEGDEEQFEEGEEGEELEEGEEGE
FT                   MEEGEEGEEDLEEGEEEPEEEPEEGEYEEEDDGDVADEFSEERPDASPEGRKSKSSKGG
FT                   RSSKGPDPEYPTEPESDSDDDALSRRRRKNKLSKAARDPYRFVRDSDDESISSGRDRRG
FT                   GEPWRTKMDGKTEYNTLANEVRNYSMHRPPGPDGRAHRMEDLPVKLAFEHLSSLAGMSE
FT                   KVQNAINLSRNLFQRRVDKMEKGVMFKAWRGWLLVQHDFNNKRNILTRAVNKMKRRRLY
FT                   KAFSKWAELHNKAHRPSHFDKAARAVVLGGCRRRTFGAWREHTKDVRRQFKMAAHTARM
FT                   REEFLERLVEAGLRQVMHKRIRRAWDAFDKFSEVRRAKRNKARQVIGRAMNREQARAFG
FT                   RWREYVAQLNKQHGQLKRAVARMSKATMARAFDAWQGQQLHKKRCLMKIIKGTQARAFA
FT                   KWQDNLRLLRKARIVFARWNQRTRYAAFNGWWLNVEEKRRQTEMCSKICKRILNRAVRN
FT                   AWAQWMYCVEQSFGCTLEQVKALRDQNARLRRDNERFVRLVDSGEWGRGRVEELSEAGR
FT                   LLRDERKQLEDLIRSIKDEKDGFVKDAELQAREARALKDRLVSGNFVQRNKLNVRGGSA
FT                   FNSMQRVLKQDLIDSGAAARQRHMLGGAVHNVDRLAMDKVSVFADGEIQMQAVKRAPPP
FT                   FARGGARRPAPPPLRAAPPPVPMPRTTAPRPASAPRDEEGENVLVEALSSLTADEVDAL
FT                   EDILKRGRTDAALV"
FT   CDS_pept        complement(701033..702871)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636994"
FT                   /orf_name="MICPUN_52217"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62201.1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI000199A8AC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P1"
FT                   /transl_table=1
FT                   /translation="MSRKYEPDAVADTPAAASWTHALAGYDETLRSRGSTFRLTFPLDQ
FT                   FKRPIHDPRSTSRATALASAAWYLGVFAFAAFAVYAHVTRPTVTNLVLLPSTALPPLPL
FT                   TLRTRCSSPWACTPGATPLPGATHIGPCRYENPYNRTYACAKHAHNILDGPELDANGAE
FT                   VWPNLTDTPTSAGAGGRRRLLNDHLWTWTRAATATQAYKSPTSRCDAERVATVTSWGAE
FT                   ASALDLTDADPRVYAGFDPDAMARRARDPNAAVDELFAALDEDASGFLDGAELDVLGPF
FT                   ARIMLKLNNFGDYHEGNATFAGGFKDIEDFTGPGSTTGVIERGVVDEMRTYLAGFGYEC
FT                   TWCVTVDDYRNALRYVWDSTKANWNGFVANVDPLYHPWSYVLSGDAFYPTTSVGVDAFP
FT                   KDGRVSPAELREAFRYMLAHQTVTPWAVAQAVSAALDANPDAAESAAMQLCSADVAAGD
FT                   DALGGILVETTFPPGCPYGSESCDTRLTIELGDGKANGMALRLDLEPGQRKAVQVGVTV
FT                   RRERGKPDAYELRADDLFYVGKNDDRRASLRVGVKQYAEALDTARPGTWLTVFAAVGGF
FT                   ASLSLSILSLGVGAIAALAERSESACACLGDAFGRG"
FT   CDS_pept        703032..703430
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636995"
FT                   /orf_name="MICPUN_56942"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61776.1"
FT                   /db_xref="UniParc:UPI000199A8AD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P2"
FT                   /transl_table=1
FT                   /translation="MNGDDILLKPSAETMSRSTTGDVMPQTEARAYALSLPPAQRSEIS
FT                   GCYCLKCVPCGSFPVAAHCVCGGSSLCWGCGTTPFACFAIPMPFIDPYFRSIKRDCVVM
FT                   VVNAEDQTLACYPGEQAEDPICIWSKLW"
FT   CDS_pept        complement(703561..704031)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636996"
FT                   /orf_name="MICPUN_107908"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62202.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000199A8AE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P3"
FT                   /transl_table=1
FT                   /translation="MPSSHAQLAAFVATMMTLQYVRRREEFRVFCKWNKRGTSGRAGHA
FT                   DAMTAALVVLAWPLAWTVGISRVYLGYHSVEQVVAGACVGCVFGAAYHELVCLAATKSF
FT                   ARLDVNDGGLGGAVARAVIGARMRDSSLVPDPLEVERVALQVNVLDFKEKSF"
FT   CDS_pept        join(705048..705256,705359..705587,705834..>706004)
FT                   /codon_start=1
FT                   /gene_family="HOG000003584" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636997"
FT                   /orf_name="MICPUN_80272"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61777.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG706903"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199A8AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P4"
FT                   /transl_table=1
FT                   /translation="MLREKADMGDPKAMSDLGATYFQGDELPRDHSTAFAWFERSATAG
FT                   YTLAFVNLATCYREGLGCPKDERKAEGAYWFRRGAEAGSLECSYRWGVCCATGTGAERD
FT                   FGNAAEAFRFAAERGHAGAALDLGHCLMNGLGIIGGAKKSMAAWYERAVALGVTDAAAA
FT                   LGRMHRDGVGGDETTRDLDEASKWFRISAAGGDDASAQAL"
FT   CDS_pept        join(complement(708218..708724),complement(707003..708115))
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636998"
FT                   /orf_name="MICPUN_56945"
FT                   /product="Pyruvate kinase"
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO62203.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000199A8B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P5"
FT                   /transl_table=1
FT                   /translation="MANIQVDDILAGTPAVQCKTKVRAPSAPTTRDPPARFLTRLANYG
FT                   IPLAPEQIVCTLGPKSAELSIMEDLLRAGMSVARFNFSHGSHEYHQGTLNTLRQAMLNT
FT                   RLMCAVLLDTKGPEIRTGMLKGGKPVLMEAGREVTIHTDYTLHGDEHNIAMSYKKLPND
FT                   VAPGAEILIGDGSIVMVVLSCHPENGTVRCRCANTAMLGERKNVNLPGVVVDLPTITEK
FT                   DRDDILGWGVPNGIDFIAASFVRKGSDVRYIREVLGEEGKSIKIISKVENQEGLVNFDD
FT                   ILEESDGVMVARGDLGMEIPTEKIFLAQKLMIEKCNAAGKPVVTATQMLESMVKNPRPT
FT                   RAEATDVANAVLDGTDCVMLSGETAAGAFPVDAVRVMSKICREAEVSIDHYQLFKSILA
FT                   QVPIPMQPLESLASSAVRTAQKVRAALIVVLTHGGSTARLVAKYRPAVPVLTVFVPTLT
FT                   TDSLTWQCSGESPARQANLTRGLIPLLAEGSARATDTDTTDEILHAAIDHAKAAGYCAS
FT                   GECIVALHRIGNASVIKIVNIP"
FT   CDS_pept        join(complement(710404..710784),complement(709621..710307))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636999"
FT                   /orf_name="MICPUN_105273"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62204.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI000199A8B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P6"
FT                   /transl_table=1
FT                   /translation="MHPPPEGLSQAPAKRGRGRPRKDAPKPIPAPKEAPAKRGRGRPRK
FT                   DAPATEKTAPEKKPAKPNAAVKRRAPPAVKEVGQHSDDESLDELIAAEKAKERAPPPPP
FT                   EPAVENWTISMATPMGTLPVEVTSLVTVTDIKQLVTAKTGGRLPPDRQIIKLNERLIDD
FT                   FGPNATLANHGLKHRSMLTLTFIRNAKSPAKSPTVDRTREHSRALQTVPSPPREERPAK
FT                   ERRTGWQPESVTRRVGPRERDQSAQGTKHKWTREESELVAEGVAKYGYGEWAAIQKELF
FT                   AESARTSTDIKDRWRNMLKAASKPNDFKFRSFMDDDLREQINEAQNKADEYQQKKLMEV
FT                   ERQRQEMIRVRGQIA"
FT   CDS_pept        join(complement(712198..712947),complement(711736..712143),
FT                   complement(711058..711630))
FT                   /codon_start=1
FT                   /gene_family="HOG000198032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637000"
FT                   /orf_name="MICPUN_79957"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62205.1"
FT                   /db_xref="HOGENOM:HBG559594"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniParc:UPI000199A8B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P7"
FT                   /transl_table=1
FT                   /translation="MTAARAAASALGAKTEIPAPRRPVGLSRAVRARPRRALAEDRDVS
FT                   KLSSPGRPRTLGWGRKRGSVGPDEDLLADPDTHGYCVYSHADWSYAYKSVAGEFDSIRD
FT                   GGDVVGTIPDELIGGVLYRNGPGLFERGGREYNHMLDGDGYVLRFEFSDAKTARFASRF
FT                   VRTKEFRAEEEADDVLYRGTFGTMRAGGPLRNALDLHQKNLANTNILAWGGKVYALYEA
FT                   GRPVELDPKTLETVGEVDLNGRLSGGMFAFTAHPHVDPNTGRVVGWGWTSAVAKRSVEA
FT                   TFWEWDKNWGEVASTEYSMSGCEAAPHDFAVTESWYVMIQNCLRVDPLLYLAGVKGAGE
FT                   CLVSQPEDPVTVHLIPRRDAGFDGGADKSGRAAVAAAGPRESFEIHLEPGSFLGEWSQS
FT                   AGWDFDIATSLSPDFNNIPRTLLWRYRINARTGTVFREPAPGCEDLCIDHPHVNPMFEG
FT                   RRECRYVYASISNEVRCSGPPLGYVRIDVATGKTQRWWAGNRTFCEEVVLVPKKGSDGS
FT                   PGSDDRCWVLGMCVAHDAEGAGRSSLVVLDGEDLGKGPVARVWLDNQIPHGLHGMFVPA
FT                   "
FT   CDS_pept        complement(713118..714548)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637001"
FT                   /orf_name="MICPUN_56949"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62206.1"
FT                   /db_xref="UniParc:UPI000199A8B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P8"
FT                   /transl_table=1
FT                   /translation="MADPPPIRGILKKGRFSQPMPAVGAVDVGDDSTDVGNGRQNSDPP
FT                   TATSVDEQLPPGAQRAMTSSVAGAETSGGSDDGASCPRYFGSKSIRDSIAKHVGSVTKS
FT                   SQEVLELRKQFAGLAAAYDDDSESESGSDAANVPDDAFTLQEDRVHGGERGAALALLSP
FT                   VHPKMQPRAFGGEIQADEDPPAPPPPPPPAAAASAAPIGSRRSDGSTARGSSGRGLSRF
FT                   SRDLDVEAKDFPDVSVHSGEEPSPLPTPEVSKHGTNEAWLFIKDQSQQQRQREGRPPLH
FT                   LMNSGRSEATSSIGAESDDGSSAPTSRAGSARRSGSGMHRSASVVSFRGDGGSEESLHD
FT                   VHVIGSVSDLKKEKKGKKSSTFKWLKKEASALAYEFGLKKKKKACLEVDAKLKESRRNM
FT                   VDNLDDASVHNEGRRAWETRDVSLRGGGEFFHADVMRRSASSPKLQGGTTGLGDGDEAD
FT                   SPMSLPDGLERFTREENE"
FT   CDS_pept        join(714866..714985,715104..>715874)
FT                   /codon_start=1
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637002"
FT                   /orf_name="MICPUN_71399"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61778.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199A8B4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P9"
FT                   /transl_table=1
FT                   /translation="MGGCLSQPANIQAPASVEIVFDRKVEDDYDIGPKLGEGVQGVVFS
FT                   GVCKSTGTKVAVKRTHIGSYGSSASRASAFAEIELLSYCDHPNVLRLMGAYQTGGDINM
FT                   VCKKVEGWNLIQYLIQLDKEEAAGRSAEDIAAEKMSLMHQLVDAVAHVHARDIVYRDLK
FT                   PANLMISEQKPRQLTLIDFGRATHLDRAARLEKEQPMGTSLFQAPEVEERAAYGQQSDM
FT                   WAVGVLVYLLISGGMPFEHSIAGLYKVLAGQYRPMDESFSPEAKDLVSRLLVVDPDKRL
FT                   NAAQCTQHPFFTREGL"
FT   CDS_pept        complement(716984..717385)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637003"
FT                   /orf_name="MICPUN_56951"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62207.1"
FT                   /db_xref="HOGENOM:HBG607303"
FT                   /db_xref="UniParc:UPI000199A8B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q0"
FT                   /transl_table=1
FT                   /translation="MVATRRTPAKGKAEPAAKTPAKKSAAGKKGAAGAKLDPDGNEMTP
FT                   VYYLRQYVGLFFTLLSFAFIAFAGYATQYGFSSANIFLYPGCAIGFVGLAFHELRPYKT
FT                   KAQMTFDPAAVEYRKKEIAEAEKRAKKSK"
FT   CDS_pept        join(complement(727082..729780),complement(726241..726994),
FT                   complement(723904..725445))
FT                   /codon_start=1
FT                   /gene_family="HOG000264435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637004"
FT                   /orf_name="MICPUN_93685"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO62208.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG560171"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI000199A916"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q1"
FT                   /transl_table=1
FT                   /translation="MAGAASEASDLTTPLISGNQPAATFSSRGGNRRSGRRRASGESGA
FT                   GAHDSDGGSPAPRHSHVESPLAAADHEGITVEPLAPLADLLVEATNTRVRQGYLSGDWL
FT                   AERLPAYSSISDLIANSSRPAITPVDARASLTHTQLKDLIYRVDDELKTWGVTQAGSRV
FT                   GVAVPNGPELMSVLLSVIDRHTCVPVNPATTPQEMHEELRATGVVALVYQGGNEMAVTM
FT                   RKLCEKLKIVPLAITPDPNVGGLFSISSDAGDASGSRAGPGTYAPPDSDKNRTALVLHT
FT                   SGSTGKKKIVPISLHQLVLGATAIGASSGLGQNDVCLNFMPLFHVGGICRNLLAPIFAG
FT                   GSTVAMPFFDADDFWQTAVQKQCTWYYGAPTMHLLVVNSAKAMPTDQIPETKIRFIANA
FT                   AGPLLPSVAIELRKVFNGAAVLTSYGMTECMPIACPPPGYALERAGSSGQAICPEIAIV
FT                   DDSGERVANGRVAHIVVKGSIVTRGYENDPEATKASFHPGGWFKTGDMGWMDADGYLYV
FT                   TGRSKEVINRGGEIISPAEVEEALQSHPGVADVVAISIPHATLQETVAVVVVPTRGIQE
FT                   PGLRQLCQHASDRLPPAKWPQCLVLVESIPKLATGKVSRSAIAKSLDIQEIRDGMWELD
FT                   VTFEASLEVNAGRGSSGVAGHRAIATRDEATKRVAEALSKASGVEDTAACIDTTGSNAL
FT                   IGAVTPADADTEKVMSFACRCLPGFLEPKDVIAVDEIPRAADGKCDAQALLALWKGQKA
FT                   AGVNGAAFTATQRAVAEAWANTLNCDARTVGLDDDFFQVGGSSIVAGQLAADIRRKLSS
FT                   NLTGADIFRYRTVKEIAAKVEKEGGGTKDGNKTEGGLPPSMASKPLGPMEWTRSYSSTS
FT                   FFALLFQSLPLLVFAPMQKILRWTIFLNMAAGVDPENEHFHHLRLVAFFVALVFTGLIS
FT                   FVLFPVMTVMLKWTVLGRLKPGLHPLWGSVYIRWWLSNKAVEVSGFGIFGMSDGLFRIY
FT                   LRMMGARVGRGAKIGRLVRIADFDMLEIHTNAAVDDYAHLRAAEVRRGALRVAPVYLGP
FT                   GSTVCTRAVVGPGGVVPQGATLGPYMSWRELDVTNPKTMAQMEEHRKIARMRQPQPGFG
FT                   SQMLAWPIVFVCEVVAWIPWIFVFVVLIRSQGLYLSIPGQGGLHDCITWFMDPFRLGVI
FT                   FAARVGHNIFGPLLQLIWIVLVKWIVVGKFKPGPLPRTYLAREWELTRRWLMNKLLPKG
FT                   DFRGALAVLGKHYEYTSIVYRMLGAKIGKRVFWPGSGVLVADGMYDLVDIGDDVVWGSR
FT                   SMVFPADCTSSLPVSICRGANVSDRCVIYAGVTLMDDACLGSGAVAPRKMKYDYGSIHV
FT                   GSRNGACVQLDPGSKPDDSVPREPKPFGRAVYQRKATYFLPHWQVMPFVFSFFIALRTA
FT                   YSVMPIWVSWYLVAIITWDLGNNFWTEMPEWRYLLLLIFVYLWVNMIHVVVRFIIDTGL
FT                   KWLIIGRREPGLYPWDRSSYCIRWKIFESLCSDTLHSLRLIGGSAFLPFFYNIMGSRIG
FT                   RRVCLYPTGADPPMVEPDLVVIEDGACVNFTHIICHTNTLGSFALNHIVIKSGATLSTE
FT                   SRIMGGVVIGEDAVLLEHTMAMVGDVVEPGDIWQGWPVQAIAKADEVAKSAKDSAEKAE
FT                   KVHEGKVLPLGLKEMPKPHKSYGSHR"
FT   CDS_pept        730852..732429
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637005"
FT                   /orf_name="MICPUN_52223"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61779.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="UniParc:UPI000199A917"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q2"
FT                   /transl_table=1
FT                   /translation="MSPRRAAAKHAETETVDATPEAMENPAEEVVAEQSASGDPTKAET
FT                   VDGSAEVAKQGTKRKAEAGARMDDPSPKNEPTGSPEYNREDEMGGSKSRVCRVDGCDVV
FT                   FSTAHECRARACQKHCSALFVRLKGARPDEQFRFCYQCHKFHPLDNFRGPDGTLLARHN
FT                   CSQSQVQRLERRKRKDALKASKKMAEALGLNHPAQIEAVNLIGASNVGQLLLANQLVMH
FT                   ERLLAAIGAGGGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGL
FT                   GAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGSGAAQGLGAAQGLGALQALIGAQG
FT                   VGAAGSAQANALNQQLGKQQLPQQLEALAALRQREQLAMLNQAAGVKGLAGTQLSGLGP
FT                   AVANGGLHGGAGVSAMLDAAVRQEKLNMLSATMANMVPSPAVGPAAASGLQGLQGLQGA
FT                   AAGLQGLQGAAAGLQGLQGAAAGLQGAAAGLLWLQGAAANAPGANLNGDILKSLMGQLG
FT                   HNGQNQPQ"
FT   CDS_pept        complement(732650..733906)
FT                   /codon_start=1
FT                   /gene_family="HOG000193909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637006"
FT                   /orf_name="MICPUN_107913"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="ACO62209.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="GO:0042176"
FT                   /db_xref="HOGENOM:HBG523170"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="UniParc:UPI000199A918"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q3"
FT                   /transl_table=1
FT                   /translation="MADVAEGGEASATKDDTAGDNAGDGANAVPPTPPTPAQRELPETE
FT                   AYSHLLVLLLLLDANDPECKAASVAALNRLSQFNRRTLDALQARIVFYYSLAHERFGEL
FT                   AEVRPSLLALHRVAALRFDEMGQETILNLLMRNYLHYNMYDQAEKLRSKAQLPASRSNQ
FT                   QQCRYLYYLGRIRAIQLEYSDAKECLTQAHRKAPKLAKGFALELTKWITVVRLLLGEIP
FT                   EKKDLTTAVSGGAAAQRALLPYLELTGAVRLGDLEKFRAVQEAHEAAFRADKTTNLVTR
FT                   LRRNVIRTGLRRVSLAYSAISLDDVAQKLGLGEGDGDVEFVVAKAIRDGGIDATIDHDA
FT                   RTMHSSDATDVYSTGEPQAAFHARIAFCLDTHNEAVKAMRYPDKVKKGKGDGERKSAKD
FT                   RDLEELAMHIMDEDEMDEF"
FT   CDS_pept        join(<734863..735075,735229..>735816)
FT                   /codon_start=1
FT                   /gene_family="HOG000194726" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637007"
FT                   /orf_name="MICPUN_71596"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61780.1"
FT                   /db_xref="HOGENOM:HBG434815"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniParc:UPI000199A919"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q4"
FT                   /transl_table=1
FT                   /translation="IALVTSGGTTAPLERTAVRFVDNFSSGSRGAASAEYLLRAGYAVV
FT                   FLHREGSLRPFDRKIPDAARWFYDSLIDLGGHFDMINRGTLLAVPFTTLFQYLNLLRAL
FT                   CTEMSSVPKPRRVMVYLAAAVSDFYVPWERLPTHKIQSREAGDAGPSNLPGIDATDDGG
FT                   VVIRLSQTPKMLGHVRSAWCPNAFVVGFKLETDPDILLEKANRSLVKYRMHLVVANEMH
FT                   RRKDRVALVEPEGKSTWVNRPADVADIEELLIGELARRHAKFVEE"
FT   CDS_pept        join(complement(739742..739852),complement(735908..739612))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637008"
FT                   /orf_name="MICPUN_56957"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62210.1"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199A91A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q5"
FT                   /transl_table=1
FT                   /translation="MPWERVLRETPSPYPGAVAWSHENLIAVGQERSVCILNPADIDGP
FT                   AGCVSLVDDARAKPANANDEDADDHGDDGDGGVPFPELTRPRRSTSLLSTRVVIHPNHR
FT                   PEVVARDLAWSPLGLAPPAVSPSGILGDGCLLAIASSAHRVTVHAPPRAESDAEWAKVC
FT                   DVSEMFASVAEAEGWLDDGGDAFDRSAFETNRRPRLPSPQYARLLLRAREAPLALPAVA
FT                   NGGGGRGEKRTALPAAGVGEGSSGGGGGGCWPTEPAKFPADSLRVGAAVEVRRRASSGA
FT                   DSRGADSGAAGGWRPGTVQSLVSAFNFRVRVCFDEPVRGAPRCVWLVCENDGEFPALRL
FT                   DGEGASAAGCHEFPSQSLGFEGASGVFELRPAQSGWKDGVVGEAEVAMTRRGGWVPAFV
FT                   DKGGAWIKLGVRGEGERSNVPPGTIRSRPRMAWIGEGCAHGAWRKATDSDYSGYKLSDF
FT                   TFPEDEEDDEEDEDEEGEEDKEGEEDPVAPKPEPTVAKVTIPKETDVVEKEELPDAAPV
FT                   AVAHRPAASATGKTRGRKPGEHFAAAYANELRASAKAAAAKTAAECGANDAPVKAVEAV
FT                   FTAAKVGDDVFAAVNDVTKANKSRRNAGLKDIALRVCDAFLAARAGAGITRLYPQGKHL
FT                   DKNDDKPLLEKVEKLVWEKVAPRVQKNKDKVRKELKPPTQNGYQLEIRENITQADDNDE
FT                   EEDVPIARRARAARARPILPADEDEDEEDDEDDPDASNASSSDDDEEDDDEPKPKRQRG
FT                   RRASITAASSADPASAAAAARRAAAAAALSVAWSPRLDRRPDEPPASVLAVGCKSGAVT
FT                   LWLVRRPATAGDGGAVDVEAMGRFRACDGCATSLAWTGDVRLGESPPGESPQNGESPQN
FT                   GESSPGESPGGGGFALVVGGSDGSVRTFTVSRKSLLAAAGAEGGRRGRRATRAVPLTPG
FT                   AELSPADGDPVTRVAVADSVKIDSDNRAHARPVIAAGKASGTVAAWRLAAHDSTSAEAT
FT                   WSARCHVQPVSGLAWCAAPEIENCAAVRLVSMHTTGAAVAYTVPTDPRARHDDWTLTDA
FT                   CVEDLTVASIDGLDLNGNTAGGGAKLPVSSHAGLASSPAGVLVATAAGFVASTYASGAT
FT                   MIQSRARRGRVAVAPPAALAAGRVKSHSMTEISGDAASGKLDDGAADESLSVACAARRL
FT                   PFLASDRGVSLWDVRAAAKHAGAGGARALESAAGEMQSTGGARASQLAKSLLCGAPEMF
FT                   VGFEPLSCEGCGRGYPRGEGWPGCGDCGLLLRPEDVTRAALSRAMI"
FT   CDS_pept        740045..>740311
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637009"
FT                   /orf_name="MICPUN_74510"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61781.1"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI000199A91B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q6"
FT                   /transl_table=1
FT                   /translation="MASAIRAWINSPTGPKTTHFWGPVANWGFVLAGLNDTKKPEEQIS
FT                   GPMTGALTVYSGLFMRFAWRVQPRNFILLACHTANASVQVRALS"
FT   CDS_pept        741564..742499
FT                   /codon_start=1
FT                   /gene_family="HOG000030427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637010"
FT                   /orf_name="MICPUN_97151"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO61782.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG299384"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniParc:UPI000199A91C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q7"
FT                   /transl_table=1
FT                   /translation="MPEFKWTGPLRPMKVSPKRSVPKIGWLCPLPDYARTGWPEAEFAS
FT                   SLQHKLEVKTPEQLAKMRAACSLGRAVMDAVAAAIKPGVTTDQLDRICHAMTLMNGAYP
FT                   SPRNYMGFPKSLCTSVNEVVCHGIPDARPLEDGDIVNLDITVCLDGYHGDLNETYFVGT
FT                   GSSDPERAERAKALMKCALECLELAMARCTPGARFRDLGEAIQTHANGRGYGVVKDFCG
FT                   HGIGALFHCAPNVPHYAKNKAVGVMKPGMTFTIEPMVNEGTHRTKHWPDGWTAVTADGG
FT                   RSAQYEHTMAVTETGLDVLTKRTANSRPFY"
FT   CDS_pept        complement(742671..743453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637011"
FT                   /orf_name="MICPUN_107914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62211.1"
FT                   /db_xref="UniParc:UPI000199A91D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q8"
FT                   /transl_table=1
FT                   /translation="MALPQCLSKDKASKLRGQENMAINSSAYQFFGTLFNVIGLAMGIV
FT                   GSLMYSPTVLHAMFGADMNENREWEWMRNWANIIWAVSFFMFPIGVGMFLVERWECISA
FT                   HNEAVGKPPPSPWDKNMRILVWAEIMLGICAAGGVFFCFDDDPGAYFIACALFTLAGGI
FT                   KVSLLVYEICEMSGCCCGTGVFDEEHGMPAKGADEKTPLLNDGDGYPVGGGNWKGEQGS
FT                   AGKGRRDSTGSPQGSDIAPSSDTSSLLGDPHVAQGSPR"
FT   CDS_pept        744189..746138
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637012"
FT                   /orf_name="MICPUN_56961"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61783.1"
FT                   /db_xref="InterPro:IPR021897"
FT                   /db_xref="UniParc:UPI000199A91E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q9"
FT                   /transl_table=1
FT                   /translation="MDDRSRETAVDVVRRCREAGIELDPVLAAYHCAALRYQGVPWDDA
FT                   FTQTAAERIVAPRSRLAVDTMAMQVAADEIRATMTAAIAADRRDREERAAAYEREVLTV
FT                   AASFPRMTQREQADFMEHMWKNVFFRYVCVKGGMESALGINDEVGREETFAAFKSVFPK
FT                   HETTRFLTQTAPEISAQLRELASIVLGIRVFNRRMEELSRGGNGPSPSGSVPDPAPGYL
FT                   NLGAKMREDLAGRAHSAARLCAQYRCVSSHQSLRRDPGDELLTRLADENNNRVAYWSII
FT                   RALIEDNAEGIERVDELTRRVHDGCEEVRELIEDAEGLTEGLGGGVRRDELYPILQSVG
FT                   ANHSALLDEAAAQEVIHAVSARMTDFSKPFETSLTNELLHEGIRVEKMAKERYGPHAVV
FT                   GVPKVDDAKDVPKTVVEPHLSRKLGESGAEITHGGVTTLEYGGYDVFALCKRRGLALPA
FT                   SMSAPDTAVVFQGKTYGFADEYAAKQFASQPAKYVRAMHATLFRMPELVRITHPSGEAT
FT                   ARAFPNLDVAKLAAGMSVPSPTEFGTQTDTHPVERHVDKDYEWNEWALRRRALHAANLL
FT                   RKATHGSQTHSSHFRRENTTQVWLPKRNETQTVVTKGTTMPQKKRYIGGMRGAPDVKLN
FT                   VVNVELDLGQPYEH"
FT   CDS_pept        complement(746990..747214)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637013"
FT                   /orf_name="MICPUN_107915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62212.1"
FT                   /db_xref="UniParc:UPI000199A91F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R0"
FT                   /transl_table=1
FT                   /translation="MLRTMLSICLPVLKFSARALGLTKTEMDPNARTIEDPVRARPDFT
FT                   PILTLLHLRSTRSPRPLSCTLCPLLRNAC"
FT   CDS_pept        747474..>748358
FT                   /codon_start=1
FT                   /gene_family="HOG000030425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637014"
FT                   /orf_name="MICPUN_79723"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61784.1"
FT                   /db_xref="HOGENOM:HBG318431"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="UniParc:UPI000199A920"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R1"
FT                   /transl_table=1
FT                   /translation="MSSTWNKLVNLVIRPPRAQYDPNEHLPGPRFRIAGVTHVRRDIDL
FT                   AGADGLTLKCSHYEPEVRGNDPLPCVIYLHGNSGSRCDATEAIRLLLPARITVFAVDLG
FT                   GSGMSEGEYVTLGVRETKDVECIVNHLRDQGLTSKIGLWGTSMGAVTAIMYANRDPSIA
FT                   GVVLDSPFSSLPKLMLELVAQFTKGSRVGVPKMAARMALSFVRSSVKSRAKFDINDLDL
FT                   RKVAPSTFCPALFAHGKDDDFIPPHHSETLHELYAGDKNYIAIDGDHNSPRPAFFFDST
FT                   VIFFCNVLDPPPTS"
FT   CDS_pept        join(complement(750727..751131),complement(749410..750624))
FT                   /codon_start=1
FT                   /gene_family="HOG000007098" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637015"
FT                   /orf_name="MICPUN_97152"
FT                   /product="H+-translocating pyrophosphatase family "
FT                   /function="hydrogen-translocating pyrophosphatase activity "
FT                   /function="inorganic diphosphatase activity"
FT                   /biological_process="proton transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62213.1"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0009678"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG593668"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniParc:UPI000199A988"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R2"
FT                   /transl_table=1
FT                   /translation="MFGRVGGGIYTKAADVGADLAGKVVAGIPEDDPRNPATIADNVGD
FT                   NVGDVAGMGSDLFGSFGEATCAALVIAAQSHDLVSAGWDTLIFPLYISSVGILVCIATS
FT                   FVATDFRPVRSEASIEEVLKTQLTLSTVGMTCVTMGPMSAFCCIAAGLWGGLIIGFVTE
FT                   YYTSHSYSPVREVARSTETGAATNIIYGLALGYKSTIIPVGILAGIVFVAFSLMDMYGV
FT                   ALAALGMLGTLSTCLAIDVYGPICDNAGGIAEMAELPEAVREKTDALDAAGNTTAAIGK
FT                   GFAIGSAALVSLALTAAFVTRTEVLENGVNLLNPTVFAFLLVGSMLPYWFSAMTMKSVG
FT                   IAAMEMVKEVKRQFDTIPGLLEGTPGHAPPDHARCIKISTDASLREMVPPAILVMTAPI
FT                   LTGMFFGVEAVVGLLAGGMASGVQLAISASNTGGAWDNAKKYVEKGGLYIDMPKRDEVT
FT                   GEIMRDEFGSPILVSVRQRKGSECHKAAVVGDTVGDPLKDTSGPALNILMKLMAIISLV
FT                   FADFFMSINNGQGYFNIPRRVF"
FT   CDS_pept        join(complement(751489..751641),c
FT                   omplement(<751351..751455))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637016"
FT                   /orf_name="MICPUN_80332"
FT                   /product="Predicted protein"
FT                   /function="hydrogen-translocating pyrophosphatase activity "
FT                   /function="inorganic diphosphatase activity"
FT                   /biological_process="proton transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62214.1"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0009678"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniParc:UPI000199A989"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R3"
FT                   /transl_table=1
FT                   /translation="MADAGEAEADSYQKLRQIYRDIQAGAKAFLAAEYRMCLAFLAVFG
FT                   VAMIFFIGTLTAFSFFVGGITSMVSGYIGMMIAVFTNARCT"
FT   CDS_pept        752397..753743
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637017"
FT                   /orf_name="MICPUN_99477"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61785.1"
FT                   /db_xref="UniParc:UPI000199A98A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R4"
FT                   /transl_table=1
FT                   /translation="MRRQAEERRAVVLTNTEKDMLKELSEARKGTWNNTLEAQRKQREA
FT                   AKAQRLEDEEEAKCVLDREEASIRATQRQAQIMRANKMLYDQTDRVKSFNSSLLLSDVL
FT                   QERDLQIDLKKRVEEVRDRHEAAFVKEQEKAWEVADYAEAAKASERKQAAMQQRDAQLL
FT                   QIEQFKEQILAEMREDRRDGELIRRRAAEEEEEERLRELRRREEAMRGAMETAKANAAL
FT                   KEYKAGEAAAEAAMDRKIEQFARAKERMDAARRVHAEAKNREKAAVRDAMVARMEADLI
FT                   ARQKKAVEAEDNAAERAEAEREAAEALKAAERLEDLRVIELSRQQQLAIKAAERERERE
FT                   REELFVRQWAQRNEQLQREEEEEKLETFARNKRLQQAHVRQIARKIKKANAERELDLRA
FT                   SLAATRRLEEEDELFDHYARVCMDEWESRGKSLRPMMVELGKFDPNRVT"
FT   CDS_pept        join(754190..754322,754463..755478)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637018"
FT                   /orf_name="MICPUN_56966"
FT                   /product="Predicted protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61786.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000199A98B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R5"
FT                   /transl_table=1
FT                   /translation="MDDHPGGLAPLFDDAGKDRTYTDTELQELLSFVENMDNATSADEL
FT                   AGGLNHVGLGLAPANAGLSHPVPHAPVLPMRFNEQGISLQFQPGPTSARGRGRGGRGGG
FT                   RGAAPAVGNFEAPMSASPAIEDDGSQRVSHGASEKQRRDRINAMIDELRMLVPGQAGGG
FT                   EGRRSKYIVLQDTINMIAALKAKCQAQERELVALRAAGASEGASGGVQTQDQQQQMMML
FT                   MGQDGQGLDPVREESIRNPANGTNSTLNSGQTISVAVEMGEEICYVKIKAPDRQGLLQD
FT                   ILNALHALPMTVQRAVVTTDSENGVVFVTDIFELKINTAIPVEQRISPEDVKTHIHQSM
FT                   HASFLAYENPELYARKRKGTQGGVSGSDSGGSGIGSGVRAAG"
FT   CDS_pept        complement(<755725..>756288)
FT                   /codon_start=1
FT                   /gene_family="HOG000242591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637019"
FT                   /orf_name="MICPUN_72375"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62215.1"
FT                   /db_xref="HOGENOM:HBG317622"
FT                   /db_xref="InterPro:IPR008501"
FT                   /db_xref="InterPro:IPR018018"
FT                   /db_xref="UniParc:UPI000199A98C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R6"
FT                   /transl_table=1
FT                   /translation="EEALIKKRLLTQTTTARPGADPPVKKLTKKYVAYVNALAEDDANG
FT                   DGADAERAREAWLKEIALYEFNMGRYRAVASANAREMEQYASASAAVDGEVRGTKDEIA
FT                   ELKTDLDGARLDRQHKEEYEALRRLCTQFPSRSDTTARLASLEAEIAELETESEATASK
FT                   LDLRKKQFALLLHLVNELQGELAEE"
FT   CDS_pept        756876..758516
FT                   /codon_start=1
FT                   /gene_family="HOG000040008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637020"
FT                   /orf_name="MICPUN_93687"
FT                   /product="Phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO61787.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG287074"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniParc:UPI000199A98D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R7"
FT                   /transl_table=1
FT                   /translation="MVTTQFIPHATAAEDGTPVLVTTTTPAILKKLQNGSDVRGVALEG
FT                   VPGEPVTLNEEAAYLIGAAFVDWLADKKGKKPSELSIAVGRDPRLSGPALANAMFAGFG
FT                   SKDVGRVVDMGIATTPACFMATVTPGVAYDAGIMLTASHLPFNRNGAKFFTSDGGLDKA
FT                   DIKRICEDAAAACQAAPDGHAIPLDGDDAVESVPFLEDYAAQLRDLIKKGANHPTAYDE
FT                   PLTGMKIIVDAGNGSGGFFAKSVLEPLGADVYGSQFLDPDGKFPNHSPNPEDAEAMDSA
FT                   VEATVKAKADLGVIFDTDVDRSAVIDGDGNPINRNKLIALLAAIILDEHPGSTVVTDSV
FT                   TSDGLAEFIEGKGGKHVRYMRGYKNVINEGVRRDKAGEPCHLMIETSGHGAMKENYCLD
FT                   DGAYIAVKIIIEAVRRRLSGGKGISDLLSELREPLEEKEVRLKITCDDFKAYGGDVLEQ
FT                   LKEAVGSMKGYTPVDVNYEGYRVNRDEGDGKRGWFLLRQSLHDPVMVLNFESEIPGGVD
FT                   AMAKDVVAWLKEKDFASLDASAVYAILDK"
FT   CDS_pept        join(complement(759279..759330),complement(759082..759155),
FT                   complement(<758643..758957))
FT                   /codon_start=1
FT                   /gene_family="HOG000216624" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637021"
FT                   /orf_name="MICPUN_90249"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62216.1"
FT                   /db_xref="HOGENOM:HBG499888"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="UniParc:UPI000199A98E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R8"
FT                   /transl_table=1
FT                   /translation="MLIPKKNRKEVYKYLFREGVIYAKKDFNLPAHPEIKEVPNLQVIK
FT                   LMQSFTSKELVKEQFSWRYYYWYLTNEGIEYLREYLNLSADVVPNTLKKSTRPPTRPMA
FT                   DERAPRGDRGPRGGREGYRSERPGGFGRGGDKAGPGGNFNPQF"
FT   CDS_pept        complement(759802..760710)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637022"
FT                   /orf_name="MICPUN_107917"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62217.1"
FT                   /db_xref="UniParc:UPI000199A98F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R9"
FT                   /transl_table=1
FT                   /translation="MIGTSPVLVLYLAYTVMAGAFTLKLSSDCASSAPAPGVLEPPSPP
FT                   PPPSPPPGTAYVSSGETNYWEMASAVALGVAMISMSCTSFAAVYYMEDTVENKRKECEA
FT                   FPVDEEVEAREKKVQAKKHAYKAVTSWNALPKLDKCLLGASLFLMTLACHIAGNFGSLC
FT                   FATFSVTCSVALADVVLPLGWVAIGLFTAGCLTFYFYGKGASRRARKVLEAESNADMVT
FT                   ADAVTEIGGAIESGGRRGRGAVNAVEPAGTTAQDPARLPGAVTEQVTRAANWSDDETPP
FT                   GSVSSYGEEEDVEEGKPWDRM"
FT   CDS_pept        763187..764254
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637023"
FT                   /orf_name="MICPUN_99481"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61788.1"
FT                   /db_xref="HOGENOM:HBG560181"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199A990"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S0"
FT                   /transl_table=1
FT                   /translation="MGDENDAVADEGDWYAALVAGEHVGDWLDTVRNAKIPPGRRTRAA
FT                   RQLAEKVAADRTYADEAREGDAADVCEAAARDIPEGDDDERLVAMREAFESCAAACRAA
FT                   AQDGGARERSFSFEGGREVVVREIALGVGVGAKVWRAAIMLGDELAANPGWCEGKRCLE
FT                   IGAGVGLCGLLASKLGAASVTLTDFERPLLDSLVLAVDRNRELDARDAVGTTTTALTLV
FT                   RRLDWIEECERPHATGGDADDPKKPTDFASGENGWKEMDHNSTFDFVFGSDLLYEEVHA
FT                   LTLPGVIKRRVASPSGRCRIVGAVRNRAMLDALVENMRKEGLAVVETHLRDNDTNAADW
FT                   YEDGYCALEVTHDVE"
FT   CDS_pept        complement(764340..765656)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637024"
FT                   /orf_name="MICPUN_56972"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62218.1"
FT                   /db_xref="UniParc:UPI000199A991"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S1"
FT                   /transl_table=1
FT                   /translation="MAVKDELSPIVVNAWLPHKPLPGEDEEAIDKKPIDQILRGIPYRL
FT                   VNSAPKKKIVELKAALEAERAKIKEAGEGEELSEEQTATNAAAEEAIAPMEEELAAAEA
FT                   AYEELTGILCKGQLSTLPWIDSLMRYVDLGGSCIVPGGAVAADDAFRSVNGNLTDVNGM
FT                   LTEKQLAESKAWAEYITQAKLEKPGGYTIVCKYAPNPYLSAQAAIDAFPAWVERQITLG
FT                   FGVELEEGADPILPHVMLAWPDPSVPGVAEVIAKMLGPLTEDAEEGKVKAVSLDLSGDV
FT                   SCDPRPLRECLERGGTSKPSGVVVPGIHALDKVGAQLVADATRSDVKVIAGDALLGGLV
FT                   SERYLRVPAPTLAELKGTAAFAGLARVLASPGGWDGFQATLEALEATGRGVATALVQAF
FT                   ADAGMKVEIETELEKGPAFEIGEPLGEEHTAAIVAAMSA"
FT   CDS_pept        join(765945..766061,766272..766829)
FT                   /codon_start=1
FT                   /gene_family="HOG000264301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637025"
FT                   /gene_name="SSRbeta"
FT                   /orf_name="MICPUN_112669"
FT                   /product="Translocon-associated complex trap beta subunit "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61789.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG608371"
FT                   /db_xref="InterPro:IPR008856"
FT                   /db_xref="UniParc:UPI000199A992"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S2"
FT                   /transl_table=1
FT                   /translation="MFPRTAVRATLVALFVAAALFQGVVADNAPTSAHLIVHKLIIGRN
FT                   MTIEITLYNAGETAATGVEINDPGWDSSSFAMLGPSTSAKFASIPPLTKKTHRFVVVPK
FT                   VTGQFSAGPSLVSYTAGAGHQASGTSNALDPLPILTPWEAKVEVAMKIGSYLTLGFCNN
FT                   AEEWTKAAIITTVLVGLITVNWIALKGKRAVAEAQRKQAMKSLGINPKDVAVSKKQKQK
FT                   KK"
FT   CDS_pept        767031..767714
FT                   /codon_start=1
FT                   /gene_family="HOG000264300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637026"
FT                   /orf_name="MICPUN_56974"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61790.1"
FT                   /db_xref="InterPro:IPR019258"
FT                   /db_xref="UniParc:UPI000199A993"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S3"
FT                   /transl_table=1
FT                   /translation="MATDEEVAWCAELRRAVTSLQDSIDAARSFDHVRLPADGPVSAAD
FT                   VVEYARRISYTTFAPAGYQPGAPLHGIMPPAPQDEHFAASHLAAHAAQARQREEARRAR
FT                   EKAAEEARKAASRGEMPPIETVIKLLSAWKPGQPWPAGIPAPPPGWKPGDPLHLGAPKP
FT                   KDDGGKGSVRVEPPARVVPAAVTAPPVKPAKPVMPKVPFVKIDLHSDSDEFEEVSASDY
FT                   SSDSD"
FT   CDS_pept        769359..769808
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637027"
FT                   /orf_name="MICPUN_107918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61791.1"
FT                   /db_xref="UniParc:UPI000199A994"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S4"
FT                   /transl_table=1
FT                   /translation="MRRKAAAGRAANADKENKESGNFALWMERGERGYTRTPGDLREVY
FT                   TAGDNAVGERGNNLYRRRHVDLLGGAASAASGIDARADRYRTTASEVSATAEEVRWEEE
FT                   NSRASEGSGLSDMASMRDAIKSASRTASERTTRSRSHLSSHVGII"
FT   CDS_pept        join(770813..770918,771034..771120,771242..771497,
FT                   771609..772287)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637028"
FT                   /orf_name="MICPUN_56977"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61792.1"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="UniParc:UPI000199A995"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S5"
FT                   /transl_table=1
FT                   /translation="MPRENGVTPDGEDKESKVFRRKLRGKMRNLHKTLHESKDEIIDLT
FT                   GPVSKLGEVIEILEDIHEDVVKPREQLLDAEVMATAADLGVEMAKKMGGLGAITPAQFM
FT                   ARLCKQFVVGVDPDAQAERDEGAFNWTLFGSSVGKHFHDAPTMAFMNGAMDTQIKERRV
FT                   AQRIRRDPVGPAVAPDSVADTKADQQTDQAMKRMVKILRNKKHQNETLTVEQLSANPKS
FT                   FSQFIENIFTLSFLVKDGEAGLTPPPEGLDGPNVEKCPQVRKMKKPEEQHMDRSTFVLH
FT                   LDMEGWRRLCEANDRMEGAIPHREEVTEMDLTEGNGIGGPGAAARAEDGEEVESPGGAE
FT                   NPKGKAKPRGRGLTRPRDSTNSEERAAALRRKVAV"
FT   CDS_pept        complement(<773246..774585)
FT                   /codon_start=1
FT                   /gene_family="HOG000189846" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637029"
FT                   /orf_name="MICPUN_79984"
FT                   /product="Glycosyltransferase family 22 protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="ACO62219.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG397465"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI000199A996"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S6"
FT                   /transl_table=1
FT                   /translation="MKAETTDLRTVFAACVLFRVVNALCVRTFFSADEYWQSVEVAHKL
FT                   VFGYGHLTWEWTHGLRGYLHPLIFAIPYKIAQTIGLDSTAVTVWSPRIVQAVIAAAGDV
FT                   HVYKLAHRWFAGAKRKAKDEKSEGAASPDAAARWALFCSLACWFNFFCAVRTFSNCTEA
FT                   ALTVAALAYWPWTGAASENDDVKNVNRPLSLALAAASCVVRPAAALYWLPMFVEESVKS
FT                   VSRVRFILKEALPIGAAALAISTCVDRVFYGRWEIVPWNFFRFNALDGGGALYGSHPWH
FT                   WNLTQGYPAIATVFLPLAAIACRDKKRWAPLAVVGWTVLGYSVPAHKEFRFLLPALAPT
FT                   LAAAGAQLASFSCRKRVAAVALILLTQIPAALYLSLRHQSGTVSVMSVLTAAVDAGETH
FT                   SAGILSLTPCHQHPWTTHVHRPNVGMRFLRCDPPGFGTPKGELDEAD"
FT   CDS_pept        join(complement(775655..775798),complement(775130..775618))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637030"
FT                   /gene_name="PDI"
FT                   /orf_name="MICPUN_112673"
FT                   /product="Protein disulfide isomerase "
FT                   /function="isomerase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62220.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG557454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199A997"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S7"
FT                   /transl_table=1
FT                   /translation="MVSSRVSGALRALIFAALIALASAAKGVVQAGDSNFDRLVLGSGK
FT                   NAFSMKPDWDKLGGHYADHPSVLIVDVDCTADGQGTCQRMGVQGYPTIKYFMSGDKKGK
FT                   DYQQGRDFNSLKSFAESKLNKPVCDAATKKGCAKNEIAFIEKHEGKSADALKEVAKEKA
FT                   DELKEIRKARSEAESELKQKQREWKKRENALNRATNILKQMQKTASA"
FT   CDS_pept        complement(776150..777319)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637031"
FT                   /orf_name="MICPUN_56980"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO62221.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199A998"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S8"
FT                   /transl_table=1
FT                   /translation="MILASPDDLPPTAANPDEVGDLEQYLDAADVAVVGVLHAFKCGDV
FT                   LDQLADIKRRRGADFVPTVLVLGGTDVNVDAGDKADVLTRRAHAVDKVVSFSASMIAAA
FT                   PPGSLPSDGRTAVVPQGVSLPEEAKGVPSVEEVPSGGFEEEGFEEEGFDVADDAPSPPP
FT                   PLPLHEACGVPTSTPVFLLPAGLRPVKDVLWAVDAVDAVGAGSANASPPFVLAIVGPSL
FT                   DDKYRDAVVERLGRSKNVVLIPPVDRAHTVGYMRAATAVVNTSKSEGQSGALLEAAAAG
FT                   VPIIARDIPGNRALLDLLLDATGETPDGERDEEGFESHPCGLLCPTPESFAAALVGSAA
FT                   VRRRRSTDRAALGAGCLARNERDRWRGIIRELIGDTPEDGCGSDMAAAA"
FT   CDS_pept        complement(777446..779152)
FT                   /codon_start=1
FT                   /gene_family="HOG000253478" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637032"
FT                   /orf_name="MICPUN_56981"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62222.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG482141"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="UniParc:UPI000199A9F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S9"
FT                   /transl_table=1
FT                   /translation="MEARDRWFHGIHAHSVPVPGASPLNKSGSAPGSSSDSRILALATP
FT                   DDLVKLDLYGTLAEKHVGLTRRQVRLMYRDVRERTERVFAGLTPEQLRGKIESSLNPMD
FT                   WGLGHIAHFYEFMILRLLAPGSEPVLPGHDVHALFDSFRAAHDDRWKPKEVCGSDPTLG
FT                   EIRRYIADVTDRLVNLVGPDDDTRLDPVSTYLHVYGVVHEHWHVEDFIQTRHTLGYARP
FT                   NPLPSSPDPAVANVWGDTFAPPTFANIDSIGGIAQGAHSGFVSIPAGTYSLGATKDEPW
FT                   VFDAERWAHEIEVPAFRIAKAATTNAEFAAFIAAGGYHKRELWSHEGWRWLSRNRSEQK
FT                   SRGMSDEDAAKAGLNSEAPRYWVRKGSGEGGGFSKVAGGWHEHLFDAAPAPVRPHAPVL
FT                   HVSWYEAEAYCAWVGGRLPTEAEWEVAARTEPGNYGVVKGPRRRAYPWGDSPGPDPSRA
FT                   NLDGFRGNSVDVGSLPDGDSAWGCRQMLGNAWEWTSSAFLPYPGFQMDFPYRENSAPWF
FT                   GYRKVCKGGCWATSAPIARAGYRHSFWPEMNAVYTGFRVAVDGAPGAIGKL"
FT   CDS_pept        join(779353..780098,780169..780187)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637033"
FT                   /orf_name="MICPUN_56982"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61793.1"
FT                   /db_xref="UniParc:UPI000199A9F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T0"
FT                   /transl_table=1
FT                   /translation="MPSGAEGFDTNGRPDDLLKRITYNANNYGKGAFLFADADAGPEDE
FT                   SRARRNRFPKRENLELEQKLYETMERQADEVVKARLAEAEKAAKEFNWDVYVDPDANAP
FT                   VEADARPGISRPNGDGCGAAMRAALPPAEPVEPESALAAEFGARCSAKEARGALEAAGG
FT                   DLEKARKLLESLASGRGRDGLRLERKRSKDGDKGKRSRKSKKRRRKRTKYDSDSDSDSD
FT                   SSSRSSSSSSSSSSSSSSRRRRKKSKNLHIYS"
FT   CDS_pept        join(complement(783539..783820),complement(780264..783407))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637034"
FT                   /orf_name="MICPUN_56983"
FT                   /product="Resistance-nodulation-cell division superfamily "
FT                   /function="hedgehog receptor activity"
FT                   /function="transporter activity"
FT                   /biological_process="cell division"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62223.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniParc:UPI000199A9F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T1"
FT                   /transl_table=1
FT                   /translation="MHRVPRVTYPGRAACRPWLWFGSLQLPESWPGKSHFLAVESPKSP
FT                   VFTRGLLSAGRRRFQDMSPFDTIAKAVYRRPLTVYLLSILVPVALTLALLNFRIELDTG
FT                   ILSFRARDEPYAINYDAVLSAVQWGKGHTQYLHGPPSPPSPANASPPTPLSERLQSHAS
FT                   YWLTMVYETRPPGGNVLTEERLAYIAEVERKVRAVSGFEDFCHLGVPLASLNDTSCRRW
FT                   VPSSTRDQHPPACPGMQCVPAMSLMSFEGMIRRWFIELVEAGSGAANSTAGAEAVERRL
FT                   EAVGFDPAQASAMAEALAASGWDTAEAYAEMPLTELLALVPSGALTRDFFHIGHEPGWF
FT                   FDKWYATGESDGSSSGEGVRAVALRSGFEFALPLAGYATNHDRQWEQDRKYRKWAEEFT
FT                   RMLADGGEIDRGAEKVGLRVLHAGGGISEDEAAALVLGDLLWCTAAFALVTACLFAYSR
FT                   KLWWTVNAIVGISLSFPVAFFFFRAASASPYVSFLNMLVPFVLIGIGCDDAMLMFDAFR
FT                   AAIRDDCGDDDGILLPSEDVFAARYAPAARAMLATSLTTAVAFGSNFFSFIPPVRALGM
FT                   FAALTVCVNYLLVLTLLPAALVIGAKGFKNSFMDAMDECLGLFTRRGYTPRQVNESAPP
FT                   TPAQKATYSQLDTRDTEPSGGEVELQTVRGKTDDDDEADWTEVGVHDDGFFAPSTAEAK
FT                   DGGDASIVRVKKEMTCSCADLNASIRANTAAATTWLGDFVIRRKWAIIAAGVLCAVVSS
FT                   AVIADSLVVARTPPPLLREDQNLQRIQHLLFDVFYTENWSNVRVAFGVAGVDRSGADPN
FT                   DPTQFGDPVWDGSFARFNDDEYTQLAVLAACDAVTAANETLQLTPSSGSTECALQAFVR
FT                   DSGGVDSVDWGPGLPSALARWSRDMGRNWRENLGWAGEEGSSELKFITADYFVDLHPVS
FT                   STTEEIRRVHDAWEAVVAAARTAMASRLPPGSPVPLVIQACDVWNRMGVEESIGYTARI
FT                   SPAVSAAACSLIMLVATRSWRVTVAAVGTIAIAVLGMLAALVSLGWEFGVVEELCVTLL
FT                   VGSSIDYCIHLAMAYAEEAPSGAGRDERVKAALAHMAPTLTGAAMSTAASSAMLLACVV
FT                   EVLVKIGATIVANTAVGFALSLFLFSALMAAFGD"
FT   CDS_pept        complement(784798..785670)
FT                   /codon_start=1
FT                   /gene_family="HOG000264353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637035"
FT                   /orf_name="MICPUN_56985"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62224.1"
FT                   /db_xref="HOGENOM:HBG560191"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199A9F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T2"
FT                   /transl_table=1
FT                   /translation="MSSASTLSARVAHSAGVRAPGGARRSFRATRIVSRAVAEDESSSS
FT                   AVYQPAVAPEQPSGADVNAAAKKRLLAVAAASGRGLDATPAQKTAASSLIAELIAANPN
FT                   PEPATSPTIDGDWELVYSDTFLFRSSPFFWAVGSMMGDTADFFYQAHSHQTGIFGGGVG
FT                   RVVQTVDTKGGRLISDCVVKASVGIPLLGFSPVFAGYGSVITAGRCAAKDGTRLAVTAE
FT                   TTTVRQDDANVLPQLNFLNGTTVPVEDVMKQVGGGEAGPEVYLDTFYLDDEMRISKLED
FT                   GSVFVYQRC"
FT   CDS_pept        787115..787555
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637036"
FT                   /orf_name="MICPUN_107920"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61794.1"
FT                   /db_xref="UniParc:UPI000199A9F9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T3"
FT                   /transl_table=1
FT                   /translation="MAAAAAALMAQDTAKAKAGETAANDGDANSRDANNRDANDANNNG
FT                   DATTETDDAAAKERRRSGDRARIDAEIERRRRRHEAARAAAAMKREKLLEEDPLDLRGA
FT                   AHRLERAKSDAKALSRQVREAKEEARRRREEREARARDDSEL"
FT   CDS_pept        <790154..>790432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637037"
FT                   /orf_name="MICPUN_76840"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO61795.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199A9FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T4"
FT                   /transl_table=1
FT                   /translation="IRDDGSSTSNVVEFNVVAHLTVGEHLVLVGNVAELGGWKVDVGRR
FT                   MTWSEGDVWKTSISIPNAEASVEFKFVRYNDNNGVLTWQEGDNYACEL"
FT   CDS_pept        join(complement(797357..797464),complement(796895..796958),
FT                   complement(792329..796698))
FT                   /codon_start=1
FT                   /gene_family="HOG000100026" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637038"
FT                   /orf_name="MICPUN_56988"
FT                   /product="Aminotransferase"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO62225.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG560193"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI000199A9FB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T5"
FT                   /transl_table=1
FT                   /translation="MDYDAYVPDSSRWAKSGLAYRVLGHDAATYYQYAIYVAEGLGKNS
FT                   FNALRGIKDWRTDDQNGEQNDLPALSKGKLKDFFYIRNLYGNIEDVFNRPVYSSPEDWI
FT                   DVAIREPESERGYFSKLVTTPQSRRCLNLGSYNYLGFGGLNTHCTPLVAKSVMDYPVTS
FT                   AGSAAELGYNPLIKEVEETTAKYVGKEAAVVVGMGFATNSTVIPAICGKGDLIVSDALN
FT                   HNSIVEGARLSGAKVRAFKHNCVGDLELILQDAVAGKQRYNKILVIIEGIYSMEGELCC
FT                   LPEIVEVCKLYGAYVWLDEAHSIGAVGPTGRGVCEELGVDPKDVDIMMGTFTKSFGAAG
FT                   GYVASDYETVARIRQYAAGCTDACSMPPAVCTQILSSLRVISGEDGTDIGAKKLRQLRE
FT                   NSKFFREGLEALGLEVLGHHPSPVMPVMLYQPYKIGDFSRLAFNRKLAVVVVGAPATPV
FT                   NYPRIRFCVSAAHSREDLADALAAISDIADELSIKFKVAPPNAWCPGSIHDKEEKEKQL
FT                   SIKRVAKARAARSAALDSASKLASGTNRARFAPLHSVGQPLGDDIGPPRSSSGPIDAYK
FT                   LSGVTEKQPKWNQYKIMLSSSDVLGLTNDPVMKEACAATVEKLGLGSCSPRGFYGTFPP
FT                   HMDLERTIADFLGVQEAVLYSYGACTVSSVIPALGHRSDVAVVDRGVGYGVLAGLRLSK
FT                   MDVRWYNHCDAADCARVFAQLETEDGVHSARLARPGRRRWLITEGCFQGTGRLAPLPDL
FT                   VALKDKHHARMIMDESVSFGAMGESGRGLTEHFGVNPKSIDVISASLENAGASVGGFCA
FT                   GDTGVVAYQRLMGAGYVFSASLPPYLATAAAHAIRRVSAEPRLVERAQASAAALRDAAL
FT                   SGRVPGFTTDADAGSPIVPLRLAVGASVADENALLADVAARARRRGIGVCVARVNPLVP
FT                   PDNAPPRALRCFGSAAHSREDLAAAFQVLAEESAKVLPSHALSAGVDASPGAKNKARLG
FT                   ADPGSMVMNPPGQVPPKSGGYGSPKNAPGAKINLDGTISLNKDSVRRDIFAKGDEAKAS
FT                   AGKRNGLHNRSASWSVNSMNGNSDNAPEMFEALSPVKESPMANGSASIGAPRRMFSDHD
FT                   SPQSLSVPLLVVLLYWHNIFRRYILNQIDITTHMVPRWLARIGLHPTESRGPVRFFYCA
FT                   AGYIGSRNFHSMALPLLVWTYDCGFTRLVMVFYCMTSGVGCLLKGALATNTSSSRPANS
FT                   SLGSLMPHRVHAWPSVAGCNATALPFLILRWRHGDVWLWDMEEPKAVAREYAAAFAYMF
FT                   AISLARMGNGDSPANVQGGVVVGAIMLRVLLPHIDWCIGGLEASTVFTAQGFALVGMVL
FT                   AAILLFPMPLNARGEILYASSTCYRRMWRTFFYMLFFAAGSVWREGPATRATELPTTPA
FT                   GWAGVLAAKFFVGHVISQFSVWAISYVAQLFVECWLRAYVKYFKPWSVGEHRRGKEGGE
FT                   EEGESKTYGTTHMRLVAITVVELAQDITGALVTAHGVPRLFDTLRPYTSLRI"
FT   CDS_pept        join(797905..797997,798118..798206,798333..799170)
FT                   /codon_start=1
FT                   /gene_family="HOG000214351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637039"
FT                   /orf_name="MICPUN_56989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61796.1"
FT                   /db_xref="HOGENOM:HBG676888"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A9FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T6"
FT                   /transl_table=1
FT                   /translation="MASRRLLRAASAGDIDAVDALIREGADPGFQDRKGTTPLMLACEH
FT                   GHVDVVRSLLAAGAPWNELDNEGHCAGEYASAGGHAELTDALIDHAVSAEMVLGAVSRA
FT                   RPREADLTYLSQPVRYDGDDKLLDTENDAVMMDWEAPLMRIHAQVMCAGKGDTLNVGFG
FT                   MGIIDGYVVNENETRSHTIIEAHPDVHAHMLRRGWDAKRGVRVEFGRWQEVLDRIIREN
FT                   ESLPDGEKRLFDGVNFDTYGEDYDDLREFHALLPKIMRPGGVYTYFNGLAPDNIFFHTV
FT                   YCRLAQAELASLGFDTKFDVVDIDTRDPEIWRGVKRRYWWGDKYFLPTCTLTGAAGSE"
FT   CDS_pept        join(799328..801076,801114..802796)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637040"
FT                   /orf_name="MICPUN_56990"
FT                   /product="Predicted protein"
FT                   /function="RNA methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO61797.1"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A9FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T7"
FT                   /transl_table=1
FT                   /translation="MEDPGAPDWSRCRRVAAIHAHSASVKCVSGGRWPAGHPGESGRMR
FT                   GDDSRTTVDGFATAGLDGAARVWTLDGTSSSGFRCVAAFGDHTAGVRAVAMPPPRGTGR
FT                   DRASSSSSSSSGIPRTAPEMLAATGSYDRTARLWHASRAVPPVPPLANGHSDYVLCVSF
FT                   GPDARTLVTGGADGRICVWDCDDAAAGNPAPAACLRPGSNAAVRSVDASLPPPSEDEPG
FT                   DVLSMTGGEDGTLRVFSHASGGGAVCEVVFAGHGGAVTSLALCRGEERGWGSPPRARKE
FT                   NVPGTRRIRIAAGHDGGVLSVHDAALTSEAGGDENARASVKVKVREAFVGRVHANGAAR
FT                   ATLLLRPDARIVASASEDRTVRLWNMQKGNCLSVLVGARCTVESVSFSALGDLLYAGLA
FT                   DGHVWVYLEESGEEEDDACAGGGIERRVIESRLALAMEALRDPKDPRASSASESERCAS
FT                   GAAPSARRFQDAYEEMECDALGLLPRVDRSNVALVGEVAGGSLGGGGFAWSERGNPTLS
FT                   CSVCRGELELGFEDPGGDWPAPLPCGHVFHARSCLVPWLRHSPACPLCRANALGSGEPP
FT                   PAACLPVEPKRSCWSSLRARGSREVAGYSGFVPIESSTMTGDASSTAAEGARGEPVPGG
FT                   EPAAQEEIPEYHDPVDASTYSAALDAKVAELERLFSPLMQQASIPILNAKGVDRSVSVR
FT                   PEVFPSPPLNFRSRCRFQVMWEDAPVTAESTGITPGESVEPGRRLSYRMWNKGKPTVPI
FT                   TEFPMALREIEELMPAVLREAEAHPELGDGLQAIHFLASRGIRGGMLVTMVYGRPIDEA
FT                   WKMAAEGPRARLKAAMVDIRERVYGGGDDDGFDGFAGPRGDDEELDATALNILGRSRGT
FT                   QIVVGDACHVFETLALRDGRRLRYRQAEGAFSNPNSFMAESTLDWLCDCAATTVREALG
FT                   GTSEHSAEAAPPSLLELYSGNGNHTVALAKYFDSVAAVELSGVLCEAARENLERNGVEN
FT                   AKVLHSPSESVARGMLRRKKRHEEGRVGKAAMAAAATGAGDGSKRGDGSGMEFDINAYD
FT                   VVLVDPPRAGLDPDTLDLVSRFDVVLYISCDPRKGLLENAVGPHAARALDTGEFEGEFK
FT                   GWSGLARTHDLVRFAVFDHFPYTRHIECGACFVRRR"
FT   CDS_pept        complement(802878..804866)
FT                   /codon_start=1
FT                   /gene_family="HOG000240610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637041"
FT                   /orf_name="MICPUN_99494"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="nucleic acid binding"
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO62226.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG521382"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI000199A9FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T8"
FT                   /transl_table=1
FT                   /translation="MSEFTGPDGKPWVPPTADDLIAKGSAAVKTEYLRPVPPLADTNAN
FT                   VVDDDKAEAGKRGDGGVDKKRTGKSRRALAREKKQARESGADLCSAFSKGACTFGDKCR
FT                   YSHNVESYLRAKQPDLPGACPFIAAGKDKCPHGIMCRYLGTHPPVPDTEENKLLPALTP
FT                   QTTAELKERNAAPGVNEGVLELPVPESPGGPFGPDDEMNQFCGWLKVRLRKGQVRFDKA
FT                   DAVLKELGVESSWRYGKEGDEKLRKKYGEKKDVVDPGEGGGDETREDDDEGGGKRSKVD
FT                   PDNTAEGVDVKLRPVEKKTIDFRGKLYLAPLTTTGNLPFRRICKRYGVDITCGEMAMVT
FT                   NLLQGQPAEWALLRRHPSEDIFGAQVCGGYSDSMSRCMQLLEDEVVSKGGLDFIDINMG
FT                   CPIDLVCNKGAGSMLLEKPARMEQLVRASAPLLSCPLTLKTRMGYFDNKRVAHEIIPKM
FT                   VDWGLAGMTLHGRSRQQRYSRLADWDYINQCARASPIQLIGNGDVFSYHDYVKNVEGQG
FT                   VATCMIARGALIKPWIFTEIKERRDWDISATERLDMLKDYAAFGLEHWGADARGVANTR
FT                   RFLLEWLSFLHRYVPVGLLERMPVGIHQRPPNYVGRSDLETLLSSPNSEDWVKITTMLL
FT                   GPTPDNFSFQPKHKSNAYSKESDQVQG"
FT   CDS_pept        join(complement(807920..>808056),
FT                   complement(<807347..807859))
FT                   /codon_start=1
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637042"
FT                   /orf_name="MICPUN_71484"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="catalytic activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="ACO62227.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG464473"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI000199A9FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T9"
FT                   /transl_table=1
FT                   /translation="SPFPNLARPTVDECWAARDALAKLHSSFFQQFETQQAAGGDAIGP
FT                   GKTVLDSLVGTILSQNTTDTNSHRAFAILKHRFPTWEQVRTAKPAKVEDAIRCGGLAEV
FT                   KVSRIQVILNTLKEERGECSMEYLRDMSDDDVKAELSRFKGVGPKTVSCVLMFCLKRPD
FT                   FPVDTHVWKIAKDLGWIPKGAGREDAYEHLNRRVPDDCKFDLHVLLVEHGKVY"
FT   CDS_pept        join(808814..808970,809076..812455)
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637043"
FT                   /orf_name="MICPUN_93697"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /protein_id="ACO61798.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG317648"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI000199AA62"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U0"
FT                   /transl_table=1
FT                   /translation="MSEENVAVEEEEEIGQEDAWTVISSFFEEKGLARQQLDSFNEFIQ
FT                   HTMQEIVDEMSDFTIEPEEQHMPGEEADGKGKKKYKVEFKQIYLSKPMVTEADGMTSTL
FT                   FPKEARLRNLTYSAPLYIDMAKSTITTTDEIDATTGKYIETIDTEEYPKVFFGKVPIML
FT                   RSQYCSLHDHTDKELTELGECPYDEGGYFIINGSEKVLIAQEKMSTNHVYVFEKRQPSK
FT                   YMWVAECRSSPESGARAASSCMARLCHAPGTKDEAGVISVTIPYIRTEIPLFVVFRALG
FT                   FVADKDILEHLVYDFEDHEMMQLLRNSIEEAQVIQSQDVALDFIGKRGSAVGVTRPKRI
FT                   QYAREILQKELLPHVGVNEGCETKKAYFLGYIVNRLLLCALGRKKEDDRDHFGNKRMDL
FT                   SGPLIAMLFRQLFRKVTKDVRLYSQRCIDSGKDIQLTLAVKAKTITSGLKYSLATGNWG
FT                   AQGAQDIRAGVSQVLNRLSFSSTLSHLRRLNSPIGREGKLAKPRQLHNSHWGMVCPAET
FT                   PEGQAVGLVKNLSLMCLVSVGSPSAPLLEFLEEWSMENLEEISPSVIVNATKIFVNGVW
FT                   VGVHREPAQLVQTLRNLRRKLDITIEVGVVHDIALRELRLYTDYGRCIRPLFIVEDNHL
FT                   VIKKKDIQMLYEKEITGYTWNDLVATGCIEYVDTEEEETTMIAMTIDELVGQRINAEPG
FT                   GVKHMYTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGMYVTNFQIRMDT
FT                   LAYVLFYPQKPLVTTRAMEHLHFRELPAGVNVVVGIMCYTGYNQEDSVIMNQSSIDRGL
FT                   FRSIFYRSFKDEEKKQGSLTKEELERPSRDTTLGMRHGTYDKLDDDGLICPGTRVSGED
FT                   IIIGKTSPLPEDDPSAVSKRFTKRDCSTGMKNSETGIIDQVLLTTNDQGLRFVKIRVRS
FT                   CRTPQVGDKFSSRHGQKGTIGMTYTQEDMPFTCEGIVPDIIVNPHAIPSRMTIGQLVEC
FT                   LMGKVAAMMGKEGDATPFTPVTVESISDMLHMCGYQKRGNEVMYNGHTGRKLEAKIFLG
FT                   PTYYQRLKHMVDDKIHSRGRGPVQILTRQPMEGRSRDGGLRFGEMERDCIISHGAAAFL
FT                   KERLMDQSDAYRIHVCETCGLIAVANLKNQTFECCKNPSERTKVVQVMMPYACKLLFQE
FT                   LMSMAVAPRLVT"
FT   CDS_pept        join(<812765..813451,813545..>814126)
FT                   /codon_start=1
FT                   /gene_family="HOG000015126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637044"
FT                   /orf_name="MICPUN_67496"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61799.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG143928"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AA63"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U1"
FT                   /transl_table=1
FT                   /translation="ILLIWAPAIFYRERVAFNLAGASCQWPAVDEGNGARSSDPSVHVA
FT                   VVADPQLTTYLSYRELGRGNPGLIAVEGISDAYMSRAFRRAVLSNDPEHVLFLGDLIDQ
FT                   GEWIVNPEEWDQARGRFDRIFRWPRRAWSGDVHATGPLDDGDDGVPRDRERPVSYRTVH
FT                   GNHDVGYSRHAVRLRHLHARHEEYFGSTNFVRRLGGVDLVGVGAMALDGADDPGARSAQ
FT                   TNETWAFARRCVGEPARPRVLVTHVPLSKRSYEPGTCGDQRTSEVIRDKTHMSSTAGGR
FT                   RIEIPRHDGLGCYYQDYLRPATSRRLLDKVRPTLVLSGHDHDQCVGTHEVFASDATGRA
FT                   CATSGRSATEHTVGSFSFLMGNPRPSFAMMTVRGACGMDDGACPAELGTGGARDAVNVS
FT                   LCFLPSQWSTFKVYGALGVITVFA"
FT   CDS_pept        complement(814356..815450)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637045"
FT                   /orf_name="MICPUN_56996"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62228.1"
FT                   /db_xref="UniParc:UPI000199AA64"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U2"
FT                   /transl_table=1
FT                   /translation="MFKREEPETERLLASNPRQKLTVHRGQLYFNDPRVAGAAAPASSS
FT                   GQSHSARIAEKYGGRRYFGGGFSDNTLVDLNQSSSEGDVTSGTEYSDYDYVTDERAQQM
FT                   ERGMRGASVPAGIQTRTAVSNRRGRSGSSSYSNMINASTAMIALVVCAVLVALGLFATG
FT                   AVSTDVVSSMFSVERESLAPQADVSESDDHAHGHRASTRSARDEKEEEEDKVYPVEIGA
FT                   DADAIGPRAAARAAEEAARKRAAASAKLGDDAKKGARRASSKGASSKRAFSRKASSLGD
FT                   AARMRPKGVSGEDASSFATRSTSKGPESAGTAKAADAGAKLGDFQKAEEAAARMRNMGF
FT                   ASPEVPNREEPAAETEEASDESRR"
FT   CDS_pept        join(<816125..816938,816978..>817258)
FT                   /codon_start=1
FT                   /gene_family="HOG000197965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637046"
FT                   /orf_name="MICPUN_67316"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /protein_id="ACO61800.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI000199AA65"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U3"
FT                   /transl_table=1
FT                   /translation="SPLGAYERLSKQGVLRWDEAQHRALKTLNELHAKLVGDMDGGAAA
FT                   AKRKSEAPKKEGSWFTDLFTAREEDDEGGYASHGGVYLFGGPGCGKTFCMDLFYASLPG
FT                   TDGKEKRREHFHSFMLHTHQTLHKLGKAGHTEDTVAIYAQRVAKKTRVLCLDEFQVTDV
FT                   ADAMIIRRLLDQLWERGVTIVTTSNREPDELYKNGLNRVQFLPCIEAIKARCVVHPMES
FT                   VRDYRLTGRGIAGEDTTGGESGGFKGTWRVRREGESHEEGERWLERRLQPMGGRRIQVP
FT                   RAGGGVALFRFDEVCASAMGAGDYTAVASTFHTVGLSRVPRMTIERVDLMRRFITFIDV
FT                   MYEHKVKLLACAPTSPATLFESSGG"
FT   CDS_pept        complement(817779..818204)
FT                   /codon_start=1
FT                   /gene_family="HOG000004132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637047"
FT                   /orf_name="MICPUN_56998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62229.1"
FT                   /db_xref="HOGENOM:HBG731751"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199AA66"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U4"
FT                   /transl_table=1
FT                   /translation="MARSPHYSHTLVIRYSECDQQGVVFNAHYQAMCDCVMDLWLRDRM
FT                   GLAWVNDVVTNGGGFSMVVASEFKYISPAKFLDDLTISGEVLRWGTTSFEVGYVGEVHS
FT                   RRCFEGKLTYVAVDPDAKPTPVPAEFRERMTAKRSRL"
FT   CDS_pept        818374..820488
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637048"
FT                   /orf_name="MICPUN_56999"
FT                   /product="Zinc permease family"
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61801.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI000199AA67"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U5"
FT                   /transl_table=1
FT                   /translation="MGPPEGKGVTVGGVFLLTTIMAAMSGLGAIPFFFVGRLSPRIASL
FT                   GNAVACGVMLAASFDMIHEGGPYGGFYVVCGVCAGAVFISIMQGWLHGAEDVKFEMLRG
FT                   ADARKTVLMVGIMAAHALGEGSGVGVSFSGAKGWAQGQLITLAIGVHNIPEGLAVATVL
FT                   AARGVSPWKCAAWSILTSMPQPLVAVPAFVFVETFQALLPFAMGFAAGCMVWITLAELL
FT                   PDALEHAGGGEVATWATVAAAALEGFRMYTSYLENDDGSFDSPFKPAEPARVPDVVLAA
FT                   SDPIPSTLGDATFDGGAPAVNAVPTNAVPVGSSSNDATDPMPRSLPNIHAVVGSTNADA
FT                   LFPAALACLAVPLACLLAAFFLPKLFGPDVLTPRRRRRYGRGTTGTGLGDGLLDRGVDS
FT                   SQVLDVAELMAVAAGASAMTATMRLAGVVHRCRVGDAPWAAALGGACLGYLAYHLAADK
FT                   FTRTSSGRGGRDAGREDRKRRERRNGWADGPESNSAAADDSNGHRDDDLRVNGDVGSHG
FT                   STQDRGDAADGTVRAAAGVLLVALAVFAAAEGQALAAATSVLGGHVALPAAIRGAPRAL
FT                   GAACAAAASGQGRWSVAWSVFGAAALEPVAMFAAAFFGDARDGDGASGVAFLDPSASVG
FT                   IEAFAGAMLMAAAVSTVLPVARKRGERAMKMGEPDRAFGGFGLGTFFSLATVVVVGSLC
FT                   WQTPYCDRRW"
FT   CDS_pept        join(complement(821244..821547),complement(820601..821142))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637337"
FT                   /orf_name="MICPUN_57000"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62230.1"
FT                   /db_xref="UniParc:UPI000199AA68"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U6"
FT                   /transl_table=1
FT                   /translation="MPKPRSRPSSDAQRRPPIRRDSTRVVNRLTTFPTHACWSEILKRS
FT                   DGKDRVVGLIQYVAMVISGGRPGSVLTSIGFALNDARRPFRLYTPVAVLIDTFLAKGKP
FT                   KTKGAMRTLECIKAISTAVYVTCDHVVWAGGAGAVDKRSTLYKVCDKLSLMGWAAGSAL
FT                   MAAGHVPDLIAYTRALRDPLASDNKRDDDVDEWELREELEEKTVASALDVASGLTQALF
FT                   ALSLLGATPLKGRQMQCVGLAMGIVGVMRQLVSVPLPPEKTGMGRMGRLPISPSMPMLR
FT                   "
FT   CDS_pept        join(821684..822127,822308..822755,822933..823807)
FT                   /codon_start=1
FT                   /gene_family="HOG000237536" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637338"
FT                   /orf_name="MICPUN_80171"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61802.1"
FT                   /db_xref="HOGENOM:HBG560198"
FT                   /db_xref="InterPro:IPR019140"
FT                   /db_xref="UniParc:UPI000199AA69"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U7"
FT                   /transl_table=1
FT                   /translation="MSAPLPSCVTDPLGAVASAFDAAIGSGDTAPDQDGDWGIKATLQE
FT                   ALDRPGVMEQIPEINAVGVDNVRPGQLVRFRCMVQDMYNPEYYVGAYKDRSTGGKWRTT
FT                   KFTERISGGNSVNTGESQPDDSAERVIWERRVLYCVPIPGESSWIARDDEDMVAKILAA
FT                   AGERKEGPAAKVDEKVDEKAASSNPVAKHPRADHATCPPASIVPEAAESMDESLNLPLG
FT                   ATDVADGLPRAAPAIVKVYESEDALPVKLNDVLELVGVLQIEPDISNDVSNTNNDQQQA
FT                   AMAAAAAAVNGDPATSGAIEAPAEIRTALIQHLAVPLGGDVLAAEYVLAAIVSRVHTRT
FT                   DSLALGKLSVTLMGVPEGGDLPRNLAAAIADIAPCVAHLPLSIAGLNARSWTPKKDYGV
FT                   NRLRSGPLQLAPGTVVVLDETALTSGQLRETGVRNVQALKQLVQLQELEYDFQYHQMRV
FT                   PVDVAVVVLTSAKQGDSVVQGGECRVPLRMVKDTRVAEQLDPVMARTMRRFVARAWGSD
FT                   HSISEKAGKEIESEMVAARQGERKATELEFHRWLTIARLCALSSGETDLTVKHWKHAME
FT                   CERKTEERLRLM"
FT   CDS_pept        823907..825292
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637339"
FT                   /orf_name="MICPUN_57002"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61803.1"
FT                   /db_xref="HOGENOM:HBG608447"
FT                   /db_xref="UniParc:UPI000199AA6A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U8"
FT                   /transl_table=1
FT                   /translation="MGAPDLLTRSFAPRITFVDMAEKWRDNQPAVSVAFAGVNRARRAR
FT                   AAAADASADAAEASLGRADLMPRDDTVDATRIASGASSSRGDDGDKGSESRAAWSVALG
FT                   TGLERWIADRGIVVSEPKHFVDVEALYDLYVRDVHPEGKAPNLVTFSSMAGKTLRRVLA
FT                   PATLARRVGKLSVTCEALPATRENWPPRMANKKAEKIKKHGPKDPGRSRPHDLVKQDKD
FT                   STGATCARYVSEMLKLACGPELVRLRVFPDAKELTEAFAASNAIRTHLWSRYKPNDERV
FT                   CLIAVGDGNTPRSAALCAFLTRWQCVAVDPEMVPWRDWRRRHKIQDATWSSCEVKEGDE
FT                   IDEEGDTHGWGGVRRLQVHRRKMQEMVVECELALIVMIHAHISLKDVLAAVKTKSGECA
FT                   AVILPCCNWYSRLAHPDGATAPCHEYEDDAVVSPQRTVRVFSSLPCGVSGAGDGVPCPE
FT                   VVA"
FT   CDS_pept        join(complement(826121..826179),complement(825392..826007))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637340"
FT                   /orf_name="MICPUN_52244"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62231.1"
FT                   /db_xref="UniParc:UPI000199AA6B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U9"
FT                   /transl_table=1
FT                   /translation="MGGGDFVGDYGSVQDRNAERSRFHADLAESQWHTLGDLLERKRSS
FT                   NPRSMLVAVKKFVTGHGKGLGSAPFLLGLRAFLEAQRGGTECVAWVLSPAVFTQSGGEI
FT                   WMRDAVDAIASGADRRVDLEGDDGNDIPLSDADKRLAWSLPLQFRDGDIDEVLSQIPSK
FT                   ARLEDAGCGPTGEIVRHGAHPPGAPARTAGTGKRRGCRARCCFLPFLFVAATVCCVVVL
FT                   VR"
FT   CDS_pept        complement(826512..827135)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637341"
FT                   /orf_name="MICPUN_107924"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62232.1"
FT                   /db_xref="UniParc:UPI000199AA6C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V0"
FT                   /transl_table=1
FT                   /translation="MQAITSLFTVKPVTRRPKVAKRGSLQVVAHGGVGGSGGTQYPGKD
FT                   KPYGSDQAPWKKKLILHDDDQADPEANQRSGQRWTPPPPKQESFAAAAPAQSTSSWDSP
FT                   SSGSGGSSNAYSWDSGGSSSYSSAGSAKGRPTHYDPDQYDPDANQRGYMGGGGGGGYSA
FT                   PKPSYGGSTGGGYAAAKPQRVTRGSDGVTYDPDQYDPDANQRSR"
FT   CDS_pept        827449..829164
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637342"
FT                   /orf_name="MICPUN_57005"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61804.1"
FT                   /db_xref="UniParc:UPI000199AA6D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V1"
FT                   /transl_table=1
FT                   /translation="MGGFSEYRRKKATMLSAAKRLRVEDRGGQERRSARVGRGAEDGTV
FT                   ASDRGLPTRGWQVSVTEPVAGSRRGLSRPLVAGEPIMKKSDRREATSDRRRAGGYGAAD
FT                   GAPIAWDAADDLPMHPRTRGRSSAAASSSSAFPSCAALVTGVALMMMVAVCALAVVHPE
FT                   LARAGATHAAAAWTGRVSSFVSSFRRETVDTQSARLAFLAPHGHDGRHRHAQKTAAKMG
FT                   PGCELLSVEEAAASVAAAFAKGESSIGAACEAAKQFRWDDVDPYVDAAAKDRVGGNEDE
FT                   GKVVVFHAGSRFDPDAVTRAAEMMARDDEVDPKVSPGEGSAGAEKRKEKSGAAHVGKKE
FT                   KSGAAHEGKKENALPLPGGGDEPPPRPTGNLTAPPAPPAPPRPVPALRDSSTAKSKKGA
FT                   GLGEERLPGSNGGVFGVLRGLMRRRETSEERAFRAWQKKHDTGEVGAATAARRLLAVPG
FT                   RDGRSKTTKSRSKDRGEGSKVPGWTCVIVGENARVAQKISRAVADVGLPCASVVNRANK
FT                   TRDGANVRGEECEVKRARAADVKLMSRARHVVATEHNDGAHVAALLRRCARDAA"
FT   CDS_pept        join(complement(832753..832814),complement(829304..832625))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637343"
FT                   /orf_name="MICPUN_99502"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62233.1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniParc:UPI000199AACB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V2"
FT                   /transl_table=1
FT                   /translation="MSSLVSQLTAKTPATGKRSSRRKLGGTVSIVGTDVNEEVVSRALP
FT                   AITPGTKAKPLRKPLGERTNGATTAKKTRGLDDDAVTGLTNALKTAAKAAKKKDGDIAS
FT                   KENGADYSEFADLPTDPLERGLALVRKGVEAMRTGGVDPKEALLKFAKKPKSGPNVREA
FT                   AATVVNRLLETLEAAADDKSDTSRELDYSGGSDDENNESEVVEAVGDDDEEVEEDDSED
FT                   VFATATNSPVKSISGASDSAGVAADDLSAALQGMTVTVEEGVMGCGDESCGSGPDGACD
FT                   PLECMRRAGGPFKMPAKLVKQPSTVSTARSSPPEEKDAPVVGEKEEDEDDEDEEEDANE
FT                   STAEESVLATDDDDEDDADEEDDDESVADTASVAGTDSQEESSMADLAAVEAAAEADAA
FT                   EGSPMMSPGPEVVDVSDLPDGTPLAEPVPDAPIVIDADDTDEECDDDDEVTSKATPPAM
FT                   NATVREKLDSSAEDDAADETGYQEDDDEMPVSARRTPGRRSRAVVDSSDEDEADDEKAS
FT                   SREGEEGEGSGESPSIGTPPAANTPPAQPVFNAPPPTTGRRSILRRIASNMKMRAQREA
FT                   REAAMRAPNFDDDAASSELSAAANAPAPALAATQPKAFPKSALKKSSKYAAAPAPEPEV
FT                   SEEASTAADAVTPARRRPQRRAVIESARKKALAWIDDEASDDGDDDDDEDEDEACSADD
FT                   DFVCDDDDVEYDSDASSNAIAEDMHARSGGVMPNVTPSPEVPKTVSRAPKSILKGRTPG
FT                   KTPGKGSRLTFGDDDVKHMTDSEGEGSSPEPDENDPRLPRTMVAKGTAQDPYGLDDLKT
FT                   PTPPRPLAEVLNEARTPSWAKTPNTAGRKTVGFGASFGNEPPPTHSKALAAALASAAKP
FT                   GKTLNYGKHKETIARALYNEFNADAFDGKLPAKLDISWNAKLLTTAGLTHYKKVTRSTG
FT                   LSEYSARIELSTKVLDCAEKLEATLLHEMCHAAAWLLDHQAKPPHGATFKKWAKQAMRT
FT                   YPDVSVDTCHSYEIFQPYRYRCTQQWCNTEYGRHSKSIDVEAKACGVCNGRLEYLGKFN
FT                   PDGSKAEEKPPTAFSLFVKEHFAATKERMPAGTPHKNIMKELSGLWKSGGGTTGKKTRG
FT                   GDDEALSPDALGESMRTLKL"
FT   CDS_pept        833109..833492
FT                   /codon_start=1
FT                   /gene_family="HOG000264350" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637344"
FT                   /orf_name="MICPUN_57007"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61805.1"
FT                   /db_xref="HOGENOM:HBG560203"
FT                   /db_xref="InterPro:IPR008560"
FT                   /db_xref="UniParc:UPI000199AACC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V3"
FT                   /transl_table=1
FT                   /translation="MSGVQLKAVQDLQAQLTKVMEELDHKVFRPQQKAAFQCSIKCTDL
FT                   RGPQEEMHACLAKCGEPIQRHEAAVMGELQEFQHRVQRCVQQCQDKQATTQDQGKFDKC
FT                   VSECAVFYQKELASLKPQLMKKR"
FT   CDS_pept        complement(833646..834200)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637345"
FT                   /orf_name="MICPUN_107925"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62234.1"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniParc:UPI000199AACD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V4"
FT                   /transl_table=1
FT                   /translation="MEAAVGQLRQLLGLSPSPPHADIDEPKLNIRSVPASSAGFATWEV
FT                   DVLVRRRAAAGHRAAMDSLDSLAAVVKAMPEMDVPKALAEAAGESLSESRLAREAAVDG
FT                   RLEDAAVHARNSHAHAESAFFHPQIISLLYFPQEYKLAVYIPLFLPTLFPLFTGLMWDV
FT                   KFYVRRTRCAAEHRRRAGKAD"
FT   CDS_pept        836124..837818
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637346"
FT                   /orf_name="MICPUN_57009"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61806.1"
FT                   /db_xref="UniParc:UPI000199AACE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V5"
FT                   /transl_table=1
FT                   /translation="MSQSNTGAGYDEFTPVPLTAEALAQLASQDHGLGNVARMMDNGVW
FT                   NTDGVQDDIRRESIDRDVDRYHRTLDMGKRVPRNSRRSEDAEPRISCNSNLSGFDAVGG
FT                   SFIAHLAPRYGSSSFTSRATSLAMNAIAAELDCTEVRAVSTRGSVAHETAGVQAFHSDV
FT                   ISALFVGHLDNKLDLARKCDVPTGISCAELVFHLYNDCGAAFLDQLQGFFAFCIVDAGS
FT                   ATVFAAVDRHASIPLYKARSKGGGVFIAHPGGSGSSAIKLSTLGEMSKIPAGSYVHGNR
FT                   HINPHKYARDKFAERALMEMDTLDETASVLSAGPSPFDIMDQNKTGQPAGFSSLFSSGS
FT                   LFSQSMDDLPSMEGGYPERRETTSPPKVKDVLRRRHSVEDLTKFSDGIGTWNARWNMDE
FT                   DDDDMNVVQVDGHGSESRMGESFHRARKNGSAVSNVSGLDTAPGTPSKADVGTFGKPPA
FT                   VPDERRRHVAHVEKKSSPARTRVRKSSWSNGSEEEARGKENMRRVHSDGELNSLSGRSN
FT                   PKAIPSRAKDDASVISMCRSMSTGHVSSSDALSETECYVSLSLGAGA"
FT   CDS_pept        838324..840309
FT                   /codon_start=1
FT                   /gene_family="HOG000258608" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637347"
FT                   /orf_name="MICPUN_57010"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61807.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG315546"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199AACF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V6"
FT                   /transl_table=1
FT                   /translation="MAGAVTGIPEGRATETIYGLIRDGKHDECAKLLEIQLANAPDSRP
FT                   ALSLLGYCYYYLGNFERAAEMYGQLAKLFPENEDYAVHHAQSLYKASMYQDALRASRAI
FT                   DSKDPAVRQKVSQLQALIAYEEDDLAGCRARLDECPSDDPDVVVNLACCMLKEGRFEEA
FT                   RTRFLDAQQALGFQADIAYNIALCYYRTKQFGPALKHLAEIIERGMREHPELAVGAATD
FT                   ATQTGEEIRSVGNTPALKETALVEAFNLKAAIEYAMGNSEGFREALTDMPPRTEEELDP
FT                   VTLHNVALMNMESDPTDGFHKLNFLLQSPVSPPETFGNLLLLYCKPEHGFYDLAADVMA
FT                   ENPQLVAKHLPQEVHQFLEATILAQTAPEEAYRKFEELVQRNADKLRRLTRKIQEYRQG
FT                   RDDKALKKSLAEYDETLDAYVPALMAQAKIYWDAENYQQVEKILRQGADYCADHEAYKV
FT                   NMAHTCFMQALSNDEKYVDAIQHYEPIVREKLEDESGMGVLNVTAIVLANLCVAYIMTS
FT                   QNEEAEELMRAIERAEEEVQYHDPNRQCFHLCIVNLVIGTLYCSKGNYEFGISRVIKSL
FT                   EPYDKKLETDTWFYAKRCVVALLDLLGKHMITVPDSTMDEVMAFLDEAERHGREIVTQL
FT                   GDDGQGRTLTTEARMIKKMFIKLRDL"
FT   CDS_pept        complement(<840761..>842197)
FT                   /codon_start=1
FT                   /gene_family="HOG000175620" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637348"
FT                   /orf_name="MICPUN_67015"
FT                   /product="Predicted protein"
FT                   /function="gamma-glutamyltransferase activity"
FT                   /protein_id="ACO62235.1"
FT                   /db_xref="GO:0003840"
FT                   /db_xref="HOGENOM:HBG738311"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="UniParc:UPI000199AAD0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V7"
FT                   /transl_table=1
FT                   /translation="GAVAADEARCSAIGAAVLDDGGHAVDASIATALCLGVTHPHSSGV
FT                   GGGAFMVIRLANGTTEAIEFRESAPAAAYRDMYVDGSGANGANRSSTFGGAAVAVPAEL
FT                   AGLHLAWERHGRLPWRRLVEPAALLANGFEVGKDLAREIADMAEDLAKFPVTKEVFLKA
FT                   DGSPLLEGETCANTRLAATLRRVANEGPSVLRTGELADALAKDIRDAGGVMESSDLAAY
FT                   RPRIFEPIVASAMGVELIGMPPPSSGGAAVAQIIEFLDGYDLPLASAGTLGTHRTAEAF
FT                   KHAFAMRMNLGDPDSATPDMTAALNDMLSPTFNAELRSMTKDDRTLNVTAYGAKWNQLD
FT                   DSGTTHVSVVDKERNAVALTSTINTEFGSKLVSPSTGIVLNNEMDDFSSPGEVNHYGLA
FT                   PHEANFIAAGKRPLSSMSPTIVTRDGKLYAVAGASGGPRIITATAQLLLNVIARGMSPL
FT                   DAVNAPRLHHQLVPHVAFAEN"
FT   CDS_pept        join(842783..842881,842993..843400)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637349"
FT                   /orf_name="MICPUN_57012"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61808.1"
FT                   /db_xref="UniParc:UPI000199AAD1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V8"
FT                   /transl_table=1
FT                   /translation="MTGWTPIELPPSNPKRTLDIVPKGLEAQEVCELMFKAIETNDCDT
FT                   YLSCCSHSTRAPRTVGSFGLTNWDQGREQWRKYKVTYRFLGESDPDDDDERPPGEWLKG
FT                   AERLVCRYQGQFGKVPGYDHGETVPRPAQAKQRPEQDVAVHLIREPLGGIWGAEREWRV
FT                   FKVEY"
FT   CDS_pept        complement(843511..845583)
FT                   /codon_start=1
FT                   /gene_family="HOG000181256" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637350"
FT                   /orf_name="MICPUN_80126"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="acyl-CoA oxidase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="fatty acid beta-oxidation "
FT                   /cellular_component="peroxisome"
FT                   /protein_id="ACO62236.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0003997"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006635"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG737904"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000199AAD2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V9"
FT                   /transl_table=1
FT                   /translation="MITAHQADPTEDLRRERSQASFPSRELAALMAGGEAQLKLRERIA
FT                   DAVRADPVFSKKGKYFMERADLYRTTLEKYLALPRLATAIDPNDPITVGKIIRELIDEP
FT                   GGLDLHLGMFIPTIQGQGDEEQRKHWLPMCTKLQIIGTYAQTELGHGTYIRGLETTATY
FT                   DAEKEQFIIHSPTLTATKWWPGGMGKTSTHAVVMARLITHGRDRGPHAFVVQIRRNEDH
FT                   QTMPGVTAGDIGPKMGYNAVDNGFLRFDHVRVPRRAMLMRYSKVDPDGTFHPPPVAKAS
FT                   YGTMVFVRSDIVMNAALYMKKAVTIAMRYNLVRRQSNPGGEKASGGVGQKGLELQVIDY
FT                   QHSQRSLFPILARAFAFHCTSDFMRRMYFRYEKVSTRKGDFSALPELHATSSGLKAYCS
FT                   WATKDAIELCRLCCGGHGFMMLAGFGTTFGNYAPNATYEGDNNVLCLQTARYLLKVARA
FT                   VAKAAARGGDVRDAEEGAQGTSAYILEGGGGLEPGCQLGKSVGLRDTEAALGAFAHAAR
FT                   RQILAAASRAGTLGADAAMSRDMVAWIKAAKAHCAYVVLLNFVDAVAESKPRVSSATAA
FT                   VMDRLVSLHALATMDDNMGDFLEDGHVSADQAAAIRAEVAVLLAELRPDAAALVDSFAL
FT                   DDYFLNSALGSHDGDVYRRLYDEVQSAPFNASHVPPGYADLLHSRLIKGAGRSRL"
FT   CDS_pept        845975..847522
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637351"
FT                   /orf_name="MICPUN_57014"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61809.1"
FT                   /db_xref="UniParc:UPI000199AAD3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W0"
FT                   /transl_table=1
FT                   /translation="MGAESKGILKPSRFSAHVDEPAAHADEGDATPSATQTTHYKEFHS
FT                   RVADVFANLGPGICGSGSTGGASDPKGSHQSPAEAVWMPANTTVTRRGARDDYSDDDDD
FT                   DEDEDGRIGRPKRNGNDDSSDDSRDDPSDEDDEEDRPTFDHTASNAEVSEVRRQRQKAR
FT                   WAEDLDCLESDEEGDDDQKKMAKLGRSVGRCSALNDEEEFDCYDTLAMTGMNRRQPMDR
FT                   NGEGGIDVARIRRLVEGDDDEFEEVDKEDVGFTKVLASNEYERRILAREGKDAPDEDED
FT                   EDEDEDEDEDTPDEAAAAAAGVGAATVDPVADGAAAAGRRKRGGFGGAYVPPNKRAKGE
FT                   PGAAPTRGVAWDDSVPEVTRPRFGGSRGRGGGRGRGRGVPDHVKNPHKYTCYTLDEPLT
FT                   VGGGGGVGDGFKEMEAARRAASAAAAARDATPNERSLPAAPTEKPVFQLSAAAAARRDA
FT                   RRGEKKKAGSATVAGVKIDFAHDDEDDEGGAEDGNRSGLGGSKKRARNFRKKAAEDD"
FT   CDS_pept        join(847817..848164,848264..848350)
FT                   /codon_start=1
FT                   /gene_family="HOG000030633" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637352"
FT                   /orf_name="MICPUN_57015"
FT                   /product="Twin arginine targeting family "
FT                   /function="protein transporter activity"
FT                   /biological_process="protein secretion"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="ACO61810.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="GO:0009306"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR003998"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniParc:UPI000199AAD4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W1"
FT                   /transl_table=1
FT                   /translation="MASTTASLVVRPTHAVRTRARSPASSAAPKSAAMSGLSAPAPAFL
FT                   GAKPAQLSAGITAGRSGAGTRSVATMGLFGLGLPELVVIGGVAAVLFGPSKLPELGKSL
FT                   GKTVKSFQAAANEFQDELKSDKEGEEQPPKQIEEGEKKSD"
FT   CDS_pept        complement(848405..850036)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637353"
FT                   /orf_name="MICPUN_57016"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62237.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AAD5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W2"
FT                   /transl_table=1
FT                   /translation="MGIFDEVFGRKIEGDGGGLFSDKYKAERDVIHDPLPASAYVDVLK
FT                   KNDELLEQLAKSGKGMAREEFSDSDGDSDGYSDKDDSSDSDSDSERPAKKPKKKERSKY
FT                   EEMDEAFAEANAMMAEGEPDKRKKSAAAAAEDTSDDESGSEEDDESDSDAGSDDEDDEG
FT                   AGASSDSDSLTDVEAERAARKAARDEAKAKKAAAKQAKEQQPGEEHRPQDDALPRTVFV
FT                   GNLPVTIKPKKLKTLFSEFGAVDSVRLRNVPVDPEGKMPRGGKVITGKLVENRKSTNAY
FT                   VVFKEEKSVEAACKGMNMREVDGRHVRVDRAVAPSAKANETIAKEKGANAGGEVAYDHT
FT                   RSLFLGNLPYDVDEEDVIRLFHRSKEYPELNGAVEAVRVVRDRKTNLGKGIAFVLFRKG
FT                   SDARTGLLLDGTKMGEREVRVTRASKNREALKAQAEKSKKRKADKEAKKEPQGAARRLG
FT                   LDKAPDAKGSAAAWEGSRSRPGGKRQKIAFGGYDAAIERGKDGKKGAGGKGGGKPAAKG
FT                   ARTGKRPAVAARKAKAKAQAAAGKKK"
FT   CDS_pept        join(852218..852403,852500..>853299)
FT                   /codon_start=1
FT                   /gene_family="HOG000197973" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637354"
FT                   /orf_name="MICPUN_80108"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61811.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG714073"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI000199AAD6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W3"
FT                   /transl_table=1
FT                   /translation="MPGGLLHLDNSEHILSIGYVHRHRPFEEEYDLGEAIGTGGFAVVR
FT                   KAVHRATGVTYAVKTLRKPRKLVAMSLEEVMNELIMMQQLSEHPSIITIKEFFTEGGAD
FT                   YDHIATKPTTGLDEEEDGIVHVVMELLEGQELVDAITDVGAYDEGQSQIVMSSMLDAIA
FT                   FMHARGVVHRDLKLENLCLAKPNDLNSVTLLDFGLAKALTAREKEENVCGTLAYVAPEA
FT                   LVAGVYGQGVDVWALGVAMHVLLTGAWPFDDDDEDELIDQIVECDLDFDEGEEWQAISP
FT                   QAKDLLGGLLEPNPKRRLGAAQALEHAWFTGQKNNTSERLHHVHARL"
FT   CDS_pept        855288..856454
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637355"
FT                   /orf_name="MICPUN_52253"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61812.1"
FT                   /db_xref="UniParc:UPI000199AAD7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W4"
FT                   /transl_table=1
FT                   /translation="MNRDEKQSALPLPTSSNHIPALRALAESDALSPSLLILSDAARTL
FT                   SRGAFLYLNLASHSLVHLEIRNCEWLESLDFVSELPSLRCLSLRGCVALPSHSLEALAR
FT                   PPKNDDAHAPPRRRGRRRPELAGNRAGARDPPNLVSLDLSGCAAVDDAAGPHLARLPRS
FT                   MRSLDLSTCAVGNLLLDYLTYRGRLTRWRRDRRGIGESENGTSEDGTSDDDGCTATDLR
FT                   LRGTRVSDAGLGHLKTLGPDVALLDLSECRGVSAGAIAELASVLGMSASTSRPGLLVAP
FT                   GTGEGREMCACGSGRESCCELAEEGWRAFLCAVREEEIREEEIREEEIREESQRVAALA
FT                   ASERDESDAVEDDGNIPMFPIGAPLSHSHPSGGESPPHQYRRVSYLID"
FT   CDS_pept        join(complement(857318..859397),complement(856504..857033))
FT                   /codon_start=1
FT                   /gene_family="HOG000100027" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637356"
FT                   /orf_name="MICPUN_57020"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62238.1"
FT                   /db_xref="HOGENOM:HBG608405"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199AB45"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W5"
FT                   /transl_table=1
FT                   /translation="MSSRQVQLNQELARKTLAADVLAIVRDSVDEFNLVNCGTALQRLA
FT                   KCPDTHRLLSPTSSALPGVPRVLQEQFARLLDAAARLVSKDPRHVESRQLASMLWACGK
FT                   LELGHRAADLVEGIETAAIMHASKFNPQELANAIWGAAKLGLDPSRSELVRAVADAIAV
FT                   SLPRASAAPGGPQRNPKGAGPGGWRANAPREWTPQGISNVAMSLAKLDADVTHGEGVST
FT                   TGGGFKYGRVFGEVCAAAKARAEDFNPQEIANILHALAKLTAGDGDGDGGGRTIVGPVE
FT                   RTARDATEALASRITRRWIEAQRLEPQHVANMSWACAKMGAAGGDDLAGALATAAATLA
FT                   PRMNTQELSMCAWSAAAFGSGRWPADCAETVARAFGNRAGEATPRQLAKAAMAYAKLGT
FT                   LHPRLMDAVANAVLALEQPFASALNPQDVANLAWSFSKLGFKKKRLFDAISAAFVAHLG
FT                   EDEARFSSQQLTMIVCAFGLLDFKDESMLNAAMGAMSKERVAEFNPRDLTNTSWALAAL
FT                   GVNAEAKPDLVERIGRTARKRLDDFNSQELLKFLGAFERLGGKDSKLAKAVSKQRTLSY
FT                   EFPALSTHAESSFVKLSSKTPTSYQGTDRVRVDDSCGGWGRGNTGVALWEGSFVLAEWL
FT                   SRQSTPTGSDEMAEVMRGAWGPNESGGWRGMTGVELGAGLGLPSIVASKLGLEMVATDG
FT                   DDDVLELLSQNIETNTSPEAKARVSRLVWGCDEPLEHLGLSEPPKLILASDVVYGNDPQ
FT                   KWKLLVKTMCDLSGPSTLVVIGNVQRYPVHHPMAETKFFSEATARDFERTEVPVTSLHP
FT                   DFRRTGGGACVIHLFRRRPESLKRSRSDSDVSERKVKKSKKEKKGKKEKKSSKKERK"
FT   CDS_pept        complement(859804..861807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637357"
FT                   /orf_name="MICPUN_57021"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62239.1"
FT                   /db_xref="HOGENOM:HBG560211"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniParc:UPI000199AB46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W6"
FT                   /transl_table=1
FT                   /translation="MAQQQPPPLILFLAGAAAGALIAANGVLSAVRKRAGRSRSRDDGR
FT                   RVRVGLEVAKDDNWKIFRGKKVGVVSNPTGVLPTTLEHTVDVMHASVGTVDIRAVFGPE
FT                   QGFRGVGQNSNPYGSYDSDKENGSDGSFVDQRTGLPVYDTYLKKGPELTAILERSGVDV
FT                   VAFDIQDVGARYYAYVWTLYDVMVAAASAKKPISVVVLDRPNPLGGEVLEGPVDIAVGC
FT                   ESLVGRKPIPVRHGMTVGELAWFLNKKYVAADPDNGSRKSVKLSVVAMRGYRRRMTWEE
FT                   TGLPWVPPSPNMPTPRTALAYVGGALLEGTNCCEGKGTTAPFELVGATWADGRLADFLM
FT                   RRTPASAARSVAPLDASNESPQPRSEEEETEPAPSRRGRSSVKRGLNYRPNYAESSPGN
FT                   SPRKNGARPSPGTPRGGIGKKPRGGKSAKGKGRKKSKSRLSRPPSGKMIRIREGAPVDG
FT                   PAAKYREAYFTPTSGALQGRIVSGVQVYPRGIENALFREGVEILLALRRCYPGEFAWRE
FT                   QATVRARVENARWRAENSAVLRSPAKSTYSNYSRKGGYYPDERSSDDGYSSEDDRGWRG
FT                   DDGEVPWSPESARRPGRRPGLPPRSPVPPAPPPPARWDPKKTPFIDMLTGSAALREAVD
FT                   AADDEKVEGVIAEWESQLEKFAEVRRGFLLYD"
FT   CDS_pept        join(862127..862165,862282..862653,862930..867594)
FT                   /codon_start=1
FT                   /gene_family="HOG000188877" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637358"
FT                   /orf_name="MICPUN_105289"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin coat of coated pit "
FT                   /cellular_component="clathrin coat of trans-Golgi network
FT                   vesicle"
FT                   /protein_id="ACO61813.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030130"
FT                   /db_xref="GO:0030132"
FT                   /db_xref="HOGENOM:HBG317411"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR001473"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012331"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="InterPro:IPR022365"
FT                   /db_xref="UniParc:UPI000199AB47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W7"
FT                   /transl_table=1
FT                   /translation="MAAPPVTVKEVVSLTSSGINPQNISFTNLTMESEKFICVRETGAA
FT                   NSVVIVDMAQPMTPMKRPITADSALMNPAAKVIALKATVAGTAQDHLQIFNIDTKSKMK
FT                   SHQMPESVVYWRWISPSLMGIVTNTAVYHWSMEGDSEPQKMFDRTGNLNGCQIIAYRAS
FT                   QDMKWFSVVGIAAGDPSRPGLVKGKMQLFSKELGRSQELDAHACAFSTHQVTGNSVKSQ
FT                   VIAFAQKTVMPDGNVASKLHVIELGAQAGQTPFQKRQAELFFPPEFMDDFPVNMSISEK
FT                   YGVIYVVTKMGLLFVYDLETATAIYRNKVSNDPVFLACDSPSTGGVYAVNRRGQVLLLN
FT                   LNEPAVVPFISGQLNNVSLALQVAVRGGLPGAESLVKPKFEQLFAAGDIKGAAECAADS
FT                   PKGILRNPETIARFKAIPAQPGAAPPLLQYFGICLQRGTLNKVEGVELARLVLAQNKKQ
FT                   LLDTWMAEDKIECSEELGDLLQSVDADMALRVYIKAKANTKVVAALAARGEFEKMGKYC
FT                   EMADYKPDYSYLLQSTLMSNPQGAVTIALQVSKMNPPPLDYNTVADLFLQRNMIREATS
FT                   FLLDVLKEDREDQAAMQTKVLEINLVTFPNVADAILGQGKLTHYDRPRIAQLCEKAGLY
FT                   MRALEHYTEVSDLKRCCVNTHSIDPQALLEWFGTLSREWALECIKELLVSNPRQNLQII
FT                   VNVCKEYTEQIGADAILKLLEEHNSSEGMFFYLGALVATSTEPDHHQKYIEAAAKTGQI
FT                   KEVERITRESEHYDPEKAKVFLMEAKLPDARPLINVCDRFDMVDDLTTFLYQNKMLRYI
FT                   EGYVQKVNPSNTPVVVGALLDLECDEDFVQNLILSVRSLLPVGPLVEEVSKRNRLKMLT
FT                   PFLENLVAEGSTNADVHNALGMILIDSNTNPEHFLTTNEYYDSKVVGKYCEKRDPNLAC
FT                   VAYKRGNCDLELVEVTNKNSLFKLQSRYVVERMDADLWEHVLAEDNPHRRQLIDQVVST
FT                   ALPESKNPEQVSVTVKAFMTAEMPQELIELLEKIVIQNSAFSNNPNLQNLLILTAIKAD
FT                   TTRVMDYINRLDAFNGPEVGEIAVGNELYEEAFAIFKKFDLHVDAMKVLLENLENLERG
FT                   EEYANKVDLPEVWSQLAKAYLSQDLVSAAVAAYIKAKYTDDYLAVIDVAKRADDFDSMV
FT                   KYLAMVRKKVKEPKVDSELCYAYAKTDKLAELEEFITQPNAAKLDNVGDRCFDEGLYEA
FT                   AKVLFTTCSNWGRLASTLVKLHKFSEAVDAARKANNTRTWKEICFACVDEGEFRLAQLC
FT                   ALNIIVNADELEEISEYYQVRGRYEELLSLMEAGVGLERAHMGIFTELGILYAKFKPEK
FT                   LMEHLKLFSTRINIPKLIRACEEMHAWKELSFLYIAYDEYDNAAGVMMAHPDAWEHVGF
FT                   KDVCVKVANLEIYYKALEFYLVSHPTQLNDLLTVLTPRIDHSRVVALMRQANHLPLIKP
FT                   YLQAVQNTNMVAVNDAVNELCLEEEDFESLRTSIDTYDNFDQMSLANKCEKHELLEFRR
FT                   IAGFLYQKNAKWTKSVELSKKDGLYKDAMEAAAQSGDKDIAGDLLQFFIEQENKECFAA
FT                   MLYNCYDLLKPDEVLEIAWMKGLMEYAMPYMIQVMKDYTNKVDVLVEDKKDRNKEKADQ
FT                   EKEKVEQQMNQNMYAQLLPAALPAPGMETTGGMNNPGMYGQMGGVQPGMYGGY"
FT   CDS_pept        867909..869153
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637359"
FT                   /orf_name="MICPUN_107928"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61814.1"
FT                   /db_xref="UniParc:UPI000199AB48"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W8"
FT                   /transl_table=1
FT                   /translation="MRMEKAKALREELDGVRTRSRRLLAKGNRLVERGVQLKAAAERVM
FT                   LGNEINKEDEARRLLVERKKVKDTLDLTTARAEVLAELASKLETAIIVLENATDEESVD
FT                   AAKALAADTLPAAKRASLQEFKTAPVSSRPASMGEDDVSQDSIAERFGRDSLEREFAAL
FT                   EITQLERMLRLTPDDPRISSEDTVVKEDDDDVVVSNTEPAWWQAPSQPKDADGATMTPR
FT                   EALLEVDRARVSSKGVQGHHVVALRKSCAVHGAGTIRVSDRLIGGKKDTAFRAGVGAAM
FT                   TAMETGEGETTGWSSLGGYEPTVFLSDLARDLGVTPERAGVLVANATARKSAAALLQAG
FT                   ASVRGGEAESARVDLKKLTSVLRTFRACAGEYLDLVAFGLEQQLSEAERKIVLGLVPKE
FT                   TSEDVRGAIRCALGL"
FT   CDS_pept        complement(871781..874495)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637360"
FT                   /orf_name="MICPUN_57025"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62240.1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AB49"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W9"
FT                   /transl_table=1
FT                   /translation="MCSRQPPGELAWGRAPRRRGGARNALPQPWKLRLDQRISGKSVRA
FT                   RLVTTRAPRGPGRRFETMQAGVASRSWAPDVADRRRGRGTRTSRRQRRVAVRAAQTGTR
FT                   DDSDDVTARDAWADLGPAGHRRGTNRIAETSAATAAVPAVDAPKSGLKVDPITAAAGGT
FT                   ALAAAGVVAALRSNPKATEELVHLKELMEHRAEVLREFGTGTGREMFPVIRRYAEQIQR
FT                   RYDVLLLPNGVETMIYAEIVKTGAIGAYESLYDNVRNVNLLGHPLKLKTIANLGHQPPV
FT                   PKVNMEDCEEFVTSVLFDDEDENVGLGIIPRPLEVQIYRNAMVTAVYLMEDTLEHFNVR
FT                   FFGTQYSFEFGRPDEGWRTSKNHPTLSDSALRRLVREEIQAPAVLRLAPGVEKNAGKVA
FT                   VALAGEVVGSAEINFLGLPLRFSLQPGGDEAFSSDIGRIPSLSEAGKLVPGGGEVLPNF
FT                   NPATAVIKQNVCSETLEIIENYVELYLESRPKQNIITNPFFFSKKLERETYVGFLSAVI
FT                   GSLENSVICELMGMDVVLNVGSAARDKKGKIKPPNLSTFKVSSDFGDNRREIEELVDWL
FT                   MKDPMYNIKAVPDNIERAIYCNVFELVTNILAGALSSLEIEILGRAVRLKLSEANKRDR
FT                   ADLAKLSRFRPSNEVLQKFSENFSAVPALQEVMMNVYAFVLAFVSYELSNVDVNLVGRK
FT                   LQFSLGVPSEVDERLAAEKMKEESEFNARLRQALNTLVEEMVEAAEEISGKEIDVNLEK
FT                   IEEYERDVLANVGLRASKVKDEVWKFASGVFGSRDDSEGAVAPTTGGASSSAVSNDDLD
FT                   SVIYKTFLAHHSPANKEFPFPYLSPKDFRFAVSDLVKIVRPGGGPDDKFTVSAAAVQKV
FT                   ANAADINGDGVIQWAEYYFAAKELSYLFEVKTP"
FT   CDS_pept        join(874645..875544,875605..875772)
FT                   /codon_start=1
FT                   /gene_family="HOG000084891" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637361"
FT                   /orf_name="MICPUN_79866"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61815.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560215"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AB4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X0"
FT                   /transl_table=1
FT                   /translation="MVPRVFVVSDIHTDFEENMKWVRGLSDTKYANDAIILAGDVSDDL
FT                   SVLGETLVLFASKFRHAFFTPGNHELWCKRRGPLKDGESEADRETIPDSMTKLERVLRL
FT                   CDECGVETRPRLIGDGERKLWIAPVVAWYHSSFDYEPDITETRVHPPHLVMSDFRLCEW
FT                   PGLDPKDESVAEAMDAVNDARGWGTFLEWLRRPEQSAADASVPIVSFSHFLPRLELCPE
FT                   KRMLFYPNLPKAVGSDFVMRRIQNLRAEQPPGTRRKRMHVHCFGHTHFGWDATIDGVRY
FT                   IQAPVSYPHEWKQRPGSLTPCCIFDWEQHGGFAPKMSARWSDHYASNPRTPQNTELAWW
FT                   VRGSALKGRADDESD"
FT   CDS_pept        complement(875860..876738)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637362"
FT                   /orf_name="MICPUN_57027"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62241.1"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniParc:UPI000199AB4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X1"
FT                   /transl_table=1
FT                   /translation="MSAAPPAMSNARPLDDVSNIIDLDALHKELEQARSNVEMWMARRE
FT                   LSMKEQVAVHKTNMAVAEEEYVSLVEREKDLATAAEELARRQEYQQAELDALQEEAAQA
FT                   KELGEDLPQQLQVLREQVTTEKDELERESTKVTGDEMVKAQMLQAHLSAVDLYRTRLGL
FT                   RFEIGDAEELRFFYRHVDPADHEREFMVAVRVVDAGGYELMDCDPDMGDAAQRLLAECN
FT                   RTDNLSGFVRGVRKLFRASVAEEEVAAAAAALREKAKVSAPSYAPADEPEPEPVAPRTP
FT                   FNTRPDDMVPL"
FT   CDS_pept        878017..880236
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637363"
FT                   /orf_name="MICPUN_107929"
FT                   /product="Predicted protein"
FT                   /function="nucleotide binding"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61816.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199AB4C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X2"
FT                   /transl_table=1
FT                   /translation="MSYFNMVFLAMFAISAFLIPGVQRKLIKEVDANMCTIEDYSVIIT
FT                   DLPDDVKDQELHKFFDKKVGKVQNVVVATNNAELLTLAFERQKAKELFHIQVAKYKKGR
FT                   EDPDVSDKKVEWLHEEAVKAKKGLRACDSAIRALQNDRGGDAKRAICAFVTFQEEADFL
FT                   KMFDMYRPGIFAWLWRPVDLRLRKKHRLRVKQAPPPADIRWENLQFNWAQRSFRQLNIS
FT                   LLTAVVLGLAFVSIAAVQMMAANAATPYDTEECRLNCHYGTDPVTMENEDLRNIYLKCY
FT                   EAEQEGDPKRDITQTPSPPPPPAYGRRLMAQDLVSSQANYVASHNGTCGAFDSFCYACY
FT                   CLEHISAGSVLDESEYCQPYIFGYTMQVVAQSVASAIVVVLNLLLKPLLVFLVRFEKHH
FT                   SASGEQMSVMLKLFMAQFFNTAILLVVLNGSFPWLRAQLEGTPVEGLLFQGEMEDFVPA
FT                   WYNEVGYALVISMVATPASQRIFSIIRLFRFKIGKFFASRNAVTQDQLNKAFEGMEFNL
FT                   AINYGELLNILFVTLTFSPGLPILVPLTSFAYMVRYGFDKYEFARVSKMPPWYSTILGM
FT                   GVAHLMAYACLGYLILAIWANSYYTMAPDPMIEGLIGSALYGFCDAWESLPEPLASVFG
FT                   TMSDPSEMARRALQKNTAIYTLTLFIIVVILFFRGLIATMRSILAEIYPAYFQTDKRQA
FT                   EGNPTFDLAIAGSQLLGARTYSIRDAPQYQAAFERIVWELDDGKL"
FT   CDS_pept        883118..884770
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637364"
FT                   /orf_name="MICPUN_57030"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61817.1"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniParc:UPI000199AB4D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X3"
FT                   /transl_table=1
FT                   /translation="MATKSFAELCEMSASKGGMEKTVKFTYDEHVSVVMAAFRERSQGP
FT                   HPSMPLVHRVDILDERPEKPDSDGTDTESWAMRYRRFFAENDAPPWVKKISGGEYLRGT
FT                   ERIEWSEPAGKMVMYTVNESHSQLVTAEEICIIEADPERPHTGTIKTLTVRARLRLRGW
FT                   WTLGISAIAERFLLGRYVSLVNQGRKIELEEIRKWRHTGKAELVLRGAFERSRTPSSER
FT                   ALGMILAGGTSKLPSLEPEADEGGKVSPKSTLSRLRGNSAPSVDGLEVESLEEFERSIS
FT                   EKDPRETTDEIVQAGMSEVHWLGLRYAKRREEIFDESSTDSDEYAYESTPRPESPLLSY
FT                   ASTDEDEYEYDSTPRPESPLYVPLDTDDEDVEDDENGEETPAVDAVIDDEFRSSGSPGA
FT                   ASPIWSPGDERTVLDVSVDEATIAKSLAKDWKEIEALEHEAIRRKLGLGEEDGDEGGAA
FT                   GALRRWLVRLALVGAGAAILRERRDQLLPLAVRAKKRWTRGRRPVKASASVVDAAAMVD
FT                   ESEEEGEVSAVVEAGEEAAAEAVTPEVDDADDE"
FT   CDS_pept        complement(884893..886434)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637365"
FT                   /orf_name="MICPUN_99522"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62242.1"
FT                   /db_xref="UniParc:UPI000199ABBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X4"
FT                   /transl_table=1
FT                   /translation="MRDTNVDWIHDLPFHSFDAGAYGRSVAHVAFTYSTPWLALTAVTV
FT                   VAWAQFHRGCLCGRRSLPRRPVALGMKPAMIMFLIMAWIACSLVPSAYTRFHEGSRDVD
FT                   DALHALDAHATGAMGHAARAKSAAAECSAALAAVDAQFKEHMAAALKVQRARQAAEQFA
FT                   AAAEGVGGVAWKDLDVLRGYDDKWERFDTWFTALSATTYGLLIVASLAPVVARLLMLST
FT                   ASRSTVDAVDAALRFAPFVAMIAAWLFLAASSPATVTFAETCHAWVPTVTRTVPTDSAR
FT                   FYFFCGVGESASVDAIPKIPAPSPAIASMRAASIEFRASVEAVLTLDTSLSNAGRNVTT
FT                   AALKRVERCEASGMEFETSVADSLGGCDPMGANLRTARESACGDAVTGIFWNNIAIMLL
FT                   AFVIFYHALRGWLWELWEWVAMGDVVYGGDSPVRKFSGKGYGSGASPRDVESQMERLEG
FT                   DVRGVKGDVKYVMGKVDEMVPLMRDLEAASRVNSPVGKGSPEEKLKQAAAALARR"
FT   CDS_pept        join(<887243..888371,888693..>889055)
FT                   /codon_start=1
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637366"
FT                   /orf_name="MICPUN_66493"
FT                   /product="ATP-binding cassette superfamily "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61818.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI000199ABC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X5"
FT                   /transl_table=1
FT                   /translation="LELFAIAGGVNAALDFWNVFLFTFVQNRIVRRLRSTLFAKILGQE
FT                   IGYFDVTSAGSISSRLTADTTEIASNLSWVFRNVTEAVVRVTGIAVYLMLQNWRLGLVA
FT                   CAIIPITTAANRIYGEWMTKNATATQDSLAAANHVALEAIGSIRTVVSFANETHEIKRY
FT                   DSALGRWYALCNRQAVVTGVYFSVIYSFLSQLLVPVALLVYGSHLVMSGRMHPERLIAF
FT                   MLYQGQLQEYVSNLLNAFTSMYKSSGSAAAVFELIDRTPVGNNKGSHVVTPFLGAVELR
FT                   DVHFCYPARPEKVVLNGLALRAEPGEFIALVGGSGSGKSTVFHLLQHFYEPQMGVVALD
FT                   GVDVSLVSHAWLHRVMACVGQEPVLFSGTVLENITYIVDGEVISAAMAANAHTFVTSMP
FT                   RGFHTQVGERGVQLSGGQKQRIAIARAILCNPAVLLLDEATSALDAASEAQVQSALDNA
FT                   MNGRTTLVIAHRLSTVKNADKIFVLHRGAVVEEGTHEEL"
FT   CDS_pept        join(complement(890009..>890782),
FT                   complement(889475..889870),complement(<889191..889441))
FT                   /codon_start=1
FT                   /gene_family="HOG000029870" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637367"
FT                   /orf_name="MICPUN_68096"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO62243.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG690163"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199ABC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X6"
FT                   /transl_table=1
FT                   /translation="KSGDVLTLECTSLAFGGRGVCKLPGGFVVFCDRAVPGETLEARVT
FT                   SLKGGGRFAEATKVSSISPCEHRTAAPCPHFERCGGCTWQDIAYAHQLTMKRDQVVDVM
FT                   TRVAKVDQTRVQNIVGDCVPSDKTERYRNKMEFAFGPGANGRGVVIGLRPSGNHSDLVE
FT                   IGNPDGCLLQHPVADEVLRGCRAHLDSNGNSSLLDAFNRRTGEGVLRSLTVRVAVDENG
FT                   ETIAAVDIAAATRGDDEDAALRGLAEAIAKVRGVASSGGGDADGEGWSGEDVEVLSGAA
FT                   TLPMKLRGVTFALSAPSFFQTNTDQAEKLVAAVEDACGFSGDGTEVVLDLFCGVGTLGL
FT                   CVAKKAKHVFGWEVVPEAVKDAERNAEANGITNATFRRGDLAKLKASLPGPDIVIADPA
FT                   RAGMDESLVKVLRSIGAERIVYVSCNPATQARDLLRLKGGDGGEGARYDVRYCTPVDMF
FT                   PHTPHVETVVVLDRI"
FT   CDS_pept        891157..892089
FT                   /codon_start=1
FT                   /gene_family="HOG000264906" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637368"
FT                   /orf_name="MICPUN_57034"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61819.1"
FT                   /db_xref="HOGENOM:HBG560221"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniParc:UPI000199ABC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X7"
FT                   /transl_table=1
FT                   /translation="MAETAGPKIGDARSLWNFTPSPGWTKDECATLRLCLMKFGIGRWV
FT                   QIVDSGVLPGKQIQQLNGQTQRLLGQQSLAEYTGMHVDVDRIREDNNEKTGPDIYRKNG
FT                   LITNTGGKLKKEAMQALRAENKAKYGLSETEIAEIVLPDPPSKKKLGADAYMGKNHNKG
FT                   GVAGLTRRMEKRRRTADVLTVDVDALARPAKMALLKALRARLVVLTTAAEEGRVLKENK
FT                   AKAAAKPKPEAKKRAASSKRKSVDSASGEENDAPTPKRDTARRASAGCGGVVGQLVAMG
FT                   FDKKKAAEAVKEVGNDTMECVNWLVVNCA"
FT   CDS_pept        complement(<892698..892982)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637369"
FT                   /orf_name="MICPUN_79915"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62244.1"
FT                   /db_xref="InterPro:IPR019367"
FT                   /db_xref="UniParc:UPI000199ABC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X8"
FT                   /transl_table=1
FT                   /translation="MVCSKCEKKLSRGIHQEMWKDGSRHTIEGGGRKINQNMALSGKKR
FT                   WTPYGGATGGSKCKICKQSLHQQGIYCQKCAYHHGMCSMCGVKVMDTTFY"
FT   CDS_pept        893098..894243
FT                   /codon_start=1
FT                   /gene_family="HOG000241816" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637370"
FT                   /orf_name="MICPUN_80110"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61820.1"
FT                   /db_xref="HOGENOM:HBG746219"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI000199ABC4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X9"
FT                   /transl_table=1
FT                   /translation="MATTDEFVPLPQLADVDGYRPTTFDYDPPAGSKDPRGGTPPGKSE
FT                   WVDVFRKSIPEFRKRAAADPRVPDAASLADRFADDFSAALDRIHAGDHADLFEGQPTVL
FT                   KMCRLRDETLRSLGFTDCFKDVKATENERALTVLPAVLAEIDAIADAKDRLLALIQGAF
FT                   AGNIFDLGAAASAKLHEDGGGDFRSTRARLKSRPWLVDDFDSLHQAWTANGATGGELAS
FT                   TWRKCVMFVDNSGADVVLGMLPIARELARRGCKVVLAANEVASINDVTAAELEDLLPRV
FT                   AELDETFAEAVKCGAIAVCSSGSDLPVIDLRRVSKRLAAVVDDADFVILEGMGRAIETN
FT                   LEAAFDCDALRIGMVKHPEVAQCLGGELYDCVCRFEAAGYI"
FT   CDS_pept        join(complement(900067..900165),complement(894300..899870))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637371"
FT                   /orf_name="MICPUN_57037"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62245.1"
FT                   /db_xref="InterPro:IPR022113"
FT                   /db_xref="UniParc:UPI000199ABC5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y0"
FT                   /transl_table=1
FT                   /translation="MRGDGRRSRAPWPLLIVLLLFLSWTGPTARAEKDPDQVAQGELSA
FT                   SAYAPSSVGADGQPAAAPPPKPDPGGRGAEIETYKDHDDFGKILYPPPRLPLGPQWAPS
FT                   VSIVPTELKFVETPLCQPTTHVIHVYNMDQRETFKILSLTTDAVYMQPVDFRSVEVPPG
FT                   RGRQLKVAFLPRSLGGSHGSFRLLTSKGSIVISARGVGVESPYKLQPLVGAKVPSGVPF
FT                   MWRLELFNPHSSTVKLVEALSSDHTISLGPPSVEDLESQNKFDEEDKAIMEKANNSGRG
FT                   GVRSFPSTIWELPSKSSKVVLSVKLLAAHAGRHEGSIKLVLNRTKGETYDINDVMERHE
FT                   LHVPVQFDAAHGGVFRSPDQIDFGIATRRLDRLRQTVTLFNSGAEPIRVMDVSLRPADP
FT                   SLRVKYTKGYILQPYTEEPVIQLVYSGKLEGVRMGTLLIRTSNSNIPIEVPYRAKIQHG
FT                   KLSWNEAEMSFLSPATGRKPFPAVSNTVRVLNNFRTPIAFHAVRVVNRPPRSNKNTEHT
FT                   EAQAQIAQGNEKPSEIAGALSTADDEEVCCFEVKDFTGGQVVSPGHPLAPFTIEYTPQD
FT                   KNVVFTATLELDTNLTTLEIPIEVHHGQLTCFDADQAEMRAKAAAEAAAMIAAAVVTKD
FT                   AAGNAPRDSDPAAEDSGDAVPCAVLAEGRKATRVGDDISQMGLIDFGVVGVPAERYRRV
FT                   AVYNPNPMPLTIKSVESSVRSVSVTRVEVSGSSLKTPISHVAPGSLLSTLHQTSHKPPP
FT                   PPPRCMTAEGKNVACKQEFWSVQHKGGSGAVIIPPLHIATVHVLAAPEREETAPKGALT
FT                   FYLDNGRQLIAPVAIKALKGTISVSGMNTPVVELPPTFPGRPILAPLKLRNDFRDVVTV
FT                   IGSRSTSPTFSLDLFAQKLKPGRDTTAGQVAFDPAHLPRQYAYTSLGRVRRKPESEKVI
FT                   DKRRSMFAAMLGADVDDSRTKTKAKTLYPDDVDELRRMTDAWRAVAADHGGHADAGAGA
FT                   FVTQTATVLLKTDAVDPFPIEVRSRLLRPSIFSVVEEEEEEPPKKTMDARFQYSTSKSK
FT                   PKSKGEGQRVLNKDGVVDFGSVQLDRRSPRHRVIATNPLGNQVVCVRIMPFVAAAEKSI
FT                   AEMEGDVDAATISAANLHVAGEYDPPGATGFVLEGGDISMKRKTGAGKGAAALVSDGRD
FT                   TACLEPGESVDLGLLSFKPKEVRKYHAHMCVRNNFTTLECATLSGSADAVKVYVAKKPR
FT                   GTQVVTDVGFRLARIGLGGADMLMQTVHVVNRGSVAVEVAKPYVGAFACGGDGSVGGYT
FT                   VQPCKPFTLPPGGSKQLTVACFTDKAAQAAKYARGVAGVWTALTMEVSSPDGVKTTLVA
FT                   NLHASDGIVTGAYAAGEMARSGPRSLIAWLATMCSGGAACWLFYANRASLQGAYERRKK
FT                   AAAAAAATRQEAVVAAVAAAAVATNGKKAKRRGSQDIGSPASPGATKSGSPKSPIVSSS
FT                   MDTESSLGSSPEKTESVLAKAPEPETSGMDSASGSSPALSPKISSSKLRDEKKPADKKS
FT                   DKEEAEVEKKEAAKSSSKPSSPVSPARKEKANGTDSKIKSVPAPRTAPSTESANGKVSP
FT                   KTTVSPKTSPANSFKQPAEKTSDKAKVIPKPKGGAAPNPFKQPKQQQERLREEQPATSQ
FT                   APRPEQLPTPNVTFAGKPIRTKASFGNEAGDDWITPPKPAAASPTYSEQSLLSPTGLAA
FT                   EATATAAGLSVLSSPYGHDIFASAPSSMQQQHQQPPLPPGPPPSMQHQQPPLPAGPRPP
FT                   NLRQDGTQQMTQQPLGGFAPVGLPGLGSIGGGASGYNMWADHFSQLGQAAAKPSNLATP
FT                   DDVRRLSESAGGSFFGGGLASATDGDALEPDGVGGGDGGGWGLWGSSHKPANSDLDDNE
FT                   WEQKNLDLLNDLELD"
FT   CDS_pept        900514..901929
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637372"
FT                   /orf_name="MICPUN_57038"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61821.1"
FT                   /db_xref="UniParc:UPI000199ABC6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y1"
FT                   /transl_table=1
FT                   /translation="MAHPAIASLGAGASSVVSSSARVARRQRAPVRVSGSASDRRAARV
FT                   GESERARQRRGRGIEAVAASTGVKVDRFGASVAADFPPRFERPSSPSCSVGLELDEDFL
FT                   DARDDAPDENEVTTTRQCLDSRKVALGSLALFVLVGGVAAIHPDPALAREVTLELPDFD
FT                   IPDFEVPDIPTTPMEFLEVVTTNPYAAVAASVAAYLVIPKAAELLVKYVLVPALVLLVA
FT                   YEASQNPDETIALVASAINQARDHPTVTSGIILAILALVLSPYILVAAGVGLIVSGVQL
FT                   LPEQLKPVLPAPVREIETQIEELQRAVDPGVKRARALGSQAKARGEKLRQEADAQKARL
FT                   EAERDRRLREQAEAAAQRIEDTRAALVAPVVTAQKAAEEAAKETLERAQDVTEAVAEAG
FT                   EGAGQTVKCTSYPTPQERSSCVDRQREERRQRESKRTEELREKASRLRANSAERERPVP
FT                   DVGKALLGSGESS"
FT   CDS_pept        902562..902777
FT                   /codon_start=1
FT                   /gene_family="HOG000237835" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637373"
FT                   /orf_name="MICPUN_57039"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61822.1"
FT                   /db_xref="HOGENOM:HBG444320"
FT                   /db_xref="UniParc:UPI000199ABC7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y2"
FT                   /transl_table=1
FT                   /translation="MSSAGLVFYREVCRAIRKLPKDTQSYYRVVAREKVVAHRDEDEPE
FT                   RIGKIIQRSREDVAWVLKKYSPTKDA"
FT   CDS_pept        902831..905368
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637374"
FT                   /orf_name="MICPUN_99528"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61823.1"
FT                   /db_xref="InterPro:IPR019321"
FT                   /db_xref="UniParc:UPI000199ABC8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y3"
FT                   /transl_table=1
FT                   /translation="MEAFLNPCVRSDGERLDPSLSPAPSLLAEDGRGVLYALGADGVIR
FT                   ACPARLLNAAARGSIADDALPTRVFKPEPPIDFEPRTISVSPSGHFAAVGGLRHDASAG
FT                   SGSIPPSSALAIVSLRTGGDRSGFEALEDGAPGCRCVPLLDDDFDRHPSMRPLRAAWHP
FT                   NSDGHLCVLLSDGTLHVFDAAVGPVAEQAFRLDPWGRGSRPGPYPLRPEIVDFAFAPPH
FT                   GWGALSLVLLGREGDVYVMCPFAPWGARYPRVTLESLQPPDENSEVWLATTFPTLRRNG
FT                   RGADNEDDDDGYDDDAGGGGGVVPSDDDDDDAGGGGGGAPSDDDDAFAGPTVAARPARI
FT                   EGVATALRGPLPLGTDPVDGDGDGGVIGRGAVARSLAAAPFAAGEGGGALLAVAHQRVV
FT                   ADERDERAPNEGRVSATLDVLILPQEPSPAWAALSEEDEAAAYEAAACDGGPVLTLAPI
FT                   AADDDDGSLQPLLAIDRVELASGEPTLRRPKTSVAAAQNELAPFVSVVWDPSCRDRVFC
FT                   CAGGAVHGVTLTWLAAVEGAVDEEEEGEKSGSELSLPTVVTLMDSPEVLLGVAPCGDPL
FT                   AEGLLLAVDATGAAYGLRPAPPLPEGIDAGNEDEAIDSAAASALAGGAEASAELRALAA
FT                   GPPGPPPAPPAGAAALKPGTIEGNAALAAAAIALKERHLRYAHRVHAATKRHSLRLGAE
FT                   IKRQRVEAKVIREGLEAVLARKEILAAKIERSVANHEEIRERLRKLAEAERSLPHPLTR
FT                   AESAFKTTLQANADDLPLLEAKLEELKRRCEAIGEDFATIGALAAGDGDVFERLAASDP
FT                   AIAAEIELQDAATKANLERVKEIELAVGPLDDF"
FT   CDS_pept        complement(905400..908927)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637375"
FT                   /orf_name="MICPUN_99529"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62246.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199AC3E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y4"
FT                   /transl_table=1
FT                   /translation="MRSTVWREVAESPNLTGIAGPRVRFQCLDANHKHVVLGANTGSLY
FT                   VFARTRADGPSPFGPDADAPEGPLRFMTVVSPPRQPSDDAAKDDPADDARTPQSAFASR
FT                   SRGVSPAIRRIKLSPRGDRCAIAYATGVLNVVEFRPGVERRGGSPKVIVQIPKAHASAD
FT                   VTWLEWSPDGDRLLSGDDKGVVGVTEFANNSVVANTLSLGSAVAQASFSRSGLMAALCT
FT                   NEAVDLLSVPTGVHPKVGTKPREGPYGGCFHVLARDAAPDGALVSKQPESEWMLAARPG
FT                   RRLWVAEAWLEGGTQGEPRSAVAATLKPDVPKGSRAPGAPEPRPGAKSRKWEFGRLHPL
FT                   GRTCVLSVAERALAVVEVPGGSLLEWCPLGEPGSVGIAAGVASAAAVDARAFLLAAPEH
FT                   GGGVWCLEAPATEAALVACVADVAAVAVASRARDGAGKDAGLAETLHAVSLATKLRVPE
FT                   TRLLEDARALVRDVAARRAVGDGGKVLDDEDDDFVDIDAELASAVEAYERFYAEAVGDA
FT                   PPPPPRPSLDERTTASSPPRPAAALSRSSSFASSAGASLSRGDSGLDATIVGAGEFPAA
FT                   ESGKFFFYNPNANAGERKERKSDKEEKKKKKSAKVVDVGDGTAPVDAPRPKRDKPKKSP
FT                   PAPEPIAETSPTNEDKKTAADMGSIVARLEEDRDDYLAAVKALSDLGEAPPVSPPPFLH
FT                   WTEYREIPALVEVGSAAAAAKSTTGKRREALRRARERRIDAAAVAARALRLSRRSLDAS
FT                   PLIPALRRWRLARAECDEIADEIDDVVEFGGGDETHATRQLSDSTQLAREDMFEALALV
FT                   ERELDVAVVELRLVGAEPAERRVGEAAARVFAEADAAEAAARTTKGTIVEPADDKAPKS
FT                   VDEPFDGDLGALAGSLVGALSLGEEERVERILRAIPPEDGEIVAVESFRRALVDLLSRP
FT                   DSAQPLESLESVTTVVAAALGAENALKALEVAVEDEAIEKKIGCDALETFAGNVFADAI
FT                   TCVTLDLVAAVGDERDRGRAASKILRPLEARVSDPPPSPVGRFPQLRAAIAAEASLKAS
FT                   PGDDAAMRRLPFVKKERGRWELAVTHTKPIEPTLEDPTGGWGVRVPLSTACCARCALPL
FT                   REIRWSGDAGQSSLGRLVTFPCGHTLHECCAIEDACVECAASNAKPLRSPAFITLSAAI
FT                   NAELESLRL"
FT   CDS_pept        join(complement(910257..910271),complement(910004..910082),
FT                   complement(909283..909617))
FT                   /codon_start=1
FT                   /gene_family="HOG000019803" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637376"
FT                   /orf_name="MICPUN_93705"
FT                   /product="Predicted protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="ACO62247.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG518785"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniParc:UPI000199AC3F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y5"
FT                   /transl_table=1
FT                   /translation="MATQSVQTFGRKKTAVAVVHCKAGKGLIRFNGAPIELIQPETLKF
FT                   KAMEPIILLGRQRFANLDLRIRVKGGGHVSQMYAVRQAIAKAIVAYYQKYVDEQSKKEL
FT                   KDALLTYDRTLLVADPRRMEPKKFGGRGARARFQKSYR"
FT   CDS_pept        910598..913033
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637377"
FT                   /orf_name="MICPUN_99531"
FT                   /product="Glycosyltransferase family 60 protein "
FT                   /function="heat shock protein binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO61824.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021067"
FT                   /db_xref="UniParc:UPI000199AC40"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y6"
FT                   /transl_table=1
FT                   /translation="MAPATPNARPSFASSAGEPSDTPHVPGRNHARLVAEIAREFRPRL
FT                   DTEGFSAVRELGSQLRELGVESNDDAPAHTHKRCKMCGNVCHARMNSCSSCCLPFVDRG
FT                   SWEPATMPRPGGDVHSETDSDSDSDSDSDDETEVDHVTEPTAPAVNAASAMERRRRERR
FT                   AAAAVPSGGPVGGPVASDSADATTRPGWHDWFNRTGRLREAPTHERGLDPTLERSYAAL
FT                   GCAFGATEADVRIAYRKCVRRVHPDSGGSRKQLARVHDALEAIDRDAWSHGEGAAALRE
FT                   ALVASESEPVSTETGAKKPRVFVSLAVYRDPEGLHTLKDAFDRASDPSRIFAGVHWQHV
FT                   LAKPSGEEPVVDRLHPAQNMFTRQVEANLGKIQGDEDKVRYLEESMKQQGDNQRDLDEK
FT                   EARLHAKASLDATDGTKWEWAGHVRETRESWECAEGPCRARHMSMRLWGGEEYVLHADS
FT                   RTRFDHGWDDVLIAELERIQTLTNNPAVLTGVPLGYHMRMTPVDNPETYERVGYLPVYG
FT                   RDEEREHELSNLVVPLRRDRTDDAPSIAALGVCGFGDLLCYPAAVRLAPYDAADADEPP
FT                   LPAMLVNPSFVFAPAKALVADAPPDLHAPFLYLGEELITSARLWTKGWRTYLPRHCPLR
FT                   VCYDPRNRIDETREDKRRGAQLYDHPRSEAARGTWDQLEERYFMNLQSRRRVLQVIGAP
FT                   DPDSATRDPRDAVILKEPWAPGSVRPVSEFVKSLGVDFDEREISNTSRYAGLDRDALNM
FT                   THDTRAVKKRDTFAARTDATELGDDVLADDGLPLKWKNGSPLFGDLSAGYYERTERWS"
FT   CDS_pept        complement(913082..913807)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637378"
FT                   /orf_name="MICPUN_107931"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62248.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniParc:UPI000199AC41"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y7"
FT                   /transl_table=1
FT                   /translation="MWGALCPIVFGERRWAQLSDAKQYEIRLAFNCAVNGILAPALVYP
FT                   ALTSTPPLNQNGLYATVFPRHEGSVLGCAASVGYLLYDLLAMLSNFTVSIKANGVVAYN
FT                   LYIWHHALSIMFWPVAVLHNSFVFFVNWFVASEASSTFLAARGAMLSLGTINTPVGVAV
FT                   QLGFVASFFMSRIYVMPNLIKSIYYADWGQVPAWQANIARCTVPLPFLLNIYWWMMILR
FT                   SMYKVIFGKKRGGKGKKAA"
FT   CDS_pept        join(<914135..914704,914816..>914920)
FT                   /codon_start=1
FT                   /gene_family="HOG000021237" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637379"
FT                   /orf_name="MICPUN_70512"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61825.1"
FT                   /db_xref="HOGENOM:HBG381802"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI000199AC42"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y8"
FT                   /transl_table=1
FT                   /translation="CTVDRVHWTEMTADRFDGQYRDHKPVVLTGMRGRNDAFRNACAKD
FT                   VLLREWGDKDIVLSTANTHSYLKVTKTLREYVSSHTAPQRLDRRGDETLIWFGDNNHTE
FT                   WRSHFDLYVPPPFGTSDADVAYSFGVGGPHSGVPLHVHGPGWSETIVGRKRWWLSPPKP
FT                   KPRFHPNATSLEWALGLKPLQEGDEGRMLECTIGEGEAVWFPDGWWHATLNLDESAFIS
FT                   SFV"
FT   CDS_pept        join(complement(919382..919867),complement(918633..919309),
FT                   complement(915832..916045))
FT                   /codon_start=1
FT                   /gene_family="HOG000199411" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637380"
FT                   /orf_name="MICPUN_80084"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO62249.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015748"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AC43"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y9"
FT                   /transl_table=1
FT                   /translation="MGACVSIDRSNSIDGARDPRVPRFERPRRAGFSGRTAADLHLDRI
FT                   DIDDVRCVEGGNGPDGHTTGDLGGDRRAEAKGTRSPRKAVDEDEIVQSPSREESPRAVA
FT                   EFVGDDDSTEDSEERTIRWQRGELVGSGGFGRVYVGLDLDTGGMLAVKQIAIAPRISRS
FT                   VRRIEQEVALMRRLKHPNIVSYLGTERTREDVFTIFMEYVSGGSIHSLLQRFGSFGESV
FT                   IRVYTRQILLGLEYLHRHQIMHRDIKGANILVDNQGCVKLADFGASKRLAEIVTVDGVH
FT                   KSIRGTPYWMAPEVIKQTGHGRQADIWSVGCTILEMATGKPPFSEFGSQVSALFHIASS
FT                   TGPPPIPEFLSAEAHDFLILCFNRVPRDRPNATRLLRHPFAVPAPSSGSPTPPRCCKRA
FT                   SWSSSTPSARSSTWRCTFTEDLQTRTSVMRSCSCGSFQRRSPSPTWRTQSGRRRQNARS
FT                   "
FT   CDS_pept        join(920480..920590,920669..>921646)
FT                   /codon_start=1
FT                   /gene_family="HOG000200795" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637381"
FT                   /orf_name="MICPUN_68182"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61826.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG316723"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AC44"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z0"
FT                   /transl_table=1
FT                   /translation="MGPRTPVRVEDLVALANTSTWAEPDAVNYRVVKDADDYQSPIINV
FT                   AHLTGLEGNAHYHYAIPGDTKTHRHFNAPPDSLKESSEDAAAGKEVHASTVFAVVGDTG
FT                   QTEVTAAVFEHIAGMDDADVLLHTGDLSYADGFPPRWDTFGRLAEGVMDRLPSLFVAGN
FT                   HDVTSNGVESQAYHTRYPSPHRSSGSASPEWWSLDVGLAHVIGFSSYAPSKGPGAFDGA
FT                   DAPLTRWLEKDLKKVNRAITPWIIVVFHVPWYNSNHGHFKEAERARVALEKLLYEAGVD
FT                   VVLNGHVHSYERIRAVYDYQPNECGVSHIVVGDGGNYEGPYGESWMNPQPAWSAFREGS
FT                   FGAGRLELHNATHATWEWRRTTC"
FT   CDS_pept        join(complement(923318..923411),complement(922121..923217))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637382"
FT                   /orf_name="MICPUN_57048"
FT                   /product="Predicted protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO62250.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR015465"
FT                   /db_xref="UniParc:UPI000199AC45"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z1"
FT                   /transl_table=1
FT                   /translation="MARGGHSHILKVGKSARQKGRVPSHHSASMRTTASSDFAFGHHSR
FT                   GSLDTAPGRTMMVALAQQVSALITSRAAPAGPSRARAPLVARATGPSRFPGAGMSFRNS
FT                   AAAARRWSEAPKRRSVAPRAADDDWEKLFADLKPLAPELSAAQVEVLERALARGRRQVP
FT                   ITDVAKELELRRDDVLAWVKSNAHRVPELAKRYPPQPEKVATVRLRERPDFDRREGRGI
FT                   RDVDRDDEREYDAQTAYLRNAPGAKHVPKGAPAYKGYVKTRLGANNVATLEKVYASDTH
FT                   PSDDMVESVRRATKLPRSKIVAWFKTRREEDKMAKRRAVRERYGGEEEDDGYYDERGGD
FT                   GFYERRGRGGRGGGGGRRGGRGGGGGLREGGAGDAYGARQERGRRDSTGEWSGRRG"
FT   CDS_pept        923611..924441
FT                   /codon_start=1
FT                   /gene_family="HOG000100028" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637383"
FT                   /orf_name="MICPUN_57049"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61827.1"
FT                   /db_xref="HOGENOM:HBG560231"
FT                   /db_xref="UniParc:UPI000199AC46"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z2"
FT                   /transl_table=1
FT                   /translation="MDSSTSLTRTETPKSKPDVKKEVIPPKVQHSFEDIEGLINNLLML
FT                   NTFTLGFSISFLAAFENEALLAMDQRYFNVFTGAFKGSADDSGKLMIKSFGEQHIGEDY
FT                   SLSPSGTILVRGMRSTTCLTFSLIVGLASYVSMCLSDAREDQKFFIKWYSWFKWIILSG
FT                   YCLYVAGFTLFYLMVAASAYALFPMYCGAKRGFLSNSVWLDTKVDFDASGAPQEGCFIK
FT                   GMKDPVGDTTLILNIMMPAILLFCGIVTYAMHYKTKVIKSGRVGADGTLYGRWK"
FT   CDS_pept        join(complement(926060..926215),complement(924556..925914))
FT                   /codon_start=1
FT                   /gene_family="HOG000012406" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637384"
FT                   /orf_name="MICPUN_105296"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /function="binding"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="ACO62251.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG317811"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199AC47"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z3"
FT                   /transl_table=1
FT                   /translation="MIHPTDDLREVLERGARWNALLTSRLVTDEDLQAIQRYELRDEDA
FT                   RADMMDEEGDACARAFLNVLGDVSQTEYVQYVLALVARMLSDDKTRAAHFLAVEKKDDD
FT                   DKGQGGGGGGGGGEAYAVFLRLLAAPDWFTREKAMFCLTRLIDQRPARDKGLRFSEDGE
FT                   PATPAGVAAVRLSRWLCQELSADPPFHPQRAVPSCVTALASLLSIREVRPVATRAGAAR
FT                   AIAPLLKVAAGPHNVQELYEAGLCAWLLTFHPPACDAMARCGVIRGLMEVAGAAAKEKV
FT                   VRVATLALRNLASATGARETRGEEEAEAGSDGTRTAGDGGGGGVVGVSGVVGVSLVAQE
FT                   SALRKLVQNLRLRDFHDEELLAALADLEDGVLARRKEASSWDRYRAEVTSGALDWTAAH
FT                   IDEGFWRENASKLTDNNCQLLRMLVAAASDPGAEPRTLAVVCHDLGEFATHYPAGRFLV
FT                   QDLKGKDCAMRLLAHADDEVRKQALLCTQKLLVQKWQFLGGEVSSA"
FT   CDS_pept        929164..930042
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637385"
FT                   /orf_name="MICPUN_52266"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61828.1"
FT                   /db_xref="UniParc:UPI000199AC48"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z4"
FT                   /transl_table=1
FT                   /translation="MWGITQALDLIDSAWGFASLDEDDEFLPSLDEDDIPVPSANFGFG
FT                   GGFYNNAFKRDFGVPIGKPQYDWTAPKAAPSLRSSEAADALELWAGAAGRLFAGEAEPL
FT                   IFRGGVDPSTLLREIPDVGMTIDEDEDEDEDIDLEDTARRDAVDAGFSLGWFSSPLGGN
FT                   DTGAYRFVVRDDEPAGPAAAAVGRDGIAVVIDEELRPVGVLRGSPDAMFFDVDAKVREV
FT                   MGMSPAVIEGDTATVGDVAVVCAAAAHDEPVAITDSEGRLRRVLRQEDLLEPIRSQLRE
FT                   QSESRFGNATR"
FT   CDS_pept        complement(<930095..>930757)
FT                   /codon_start=1
FT                   /gene_family="HOG000230756" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637386"
FT                   /orf_name="MICPUN_71655"
FT                   /product="Predicted protein"
FT                   /function="phosphoribosylaminoimidazole carboxylase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="ACO62252.1"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG539656"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="UniParc:UPI000199AC49"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z5"
FT                   /transl_table=1
FT                   /translation="DFAKLDLGRTARTGLPEVVWGPGKTPEQIAKIMLALRDRQSAVMA
FT                   TRVDPEVYERIRAIEPSIEYDAFARVCTLAGAPDAPPTPVVRGILAVLTAGTADLAVAE
FT                   EAAITARLMGVEDVRLIADVGVAGLQRLLSRLDEVREADVVMVVAGMDGALPSVCAGLV
FT                   DAPVIAVPTSVGYGAAMGGLSPLMATLNSCATGVTVVNIDNGFGATMSAIKMLRAAER"
FT   CDS_pept        931171..>931938
FT                   /codon_start=1
FT                   /gene_family="HOG000161443" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637387"
FT                   /orf_name="MICPUN_72034"
FT                   /product="Predicted protein"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO61829.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG735081"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="UniParc:UPI000199AC4A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z6"
FT                   /transl_table=1
FT                   /translation="MSNVYQLEPPTEGKVLLTTSHGEIEVELWAKEAPKACRNFVQLCM
FT                   EGYYDGCIFHRIIKDFMIQTGDPTGTGRGGESIYGEYFKDELHSRIKFNHRGQVAMANA
FT                   GGRDTNGSQFFITLERTDWIDRKHTIFGKVTGHTIYNALQIADLEVDGDRPVEPYPKIL
FT                   KTEIVWNPFEDIVPRVMKKLDGDVDDEEAGDTRKKKKKEKKKLNLLSFGEEAGEEEEEL
FT                   AKMAKPKVKSVFDADAAENDGRIAKPGSAEEAAA"
FT   CDS_pept        join(933660..933891,934045..936116)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637388"
FT                   /orf_name="MICPUN_57054"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61830.1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniParc:UPI000199ACBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z7"
FT                   /transl_table=1
FT                   /translation="MSNGWGVLVAKCDKSRSAKHLDRSVDRSGDVTSEPFREQPDIELR
FT                   LTKTIVGRMLMNAEGTSRAQTQVADILIDMPSVSAKHCVITCDEPEGSDTYVITVTDHS
FT                   RHGVQVNKKKISGPTTLSHGDVLTLPFGMDYEFLVLDDGAKPMAPKPAEPKSAKKTPGK
FT                   RAKSVGKASAGKKKGASEDDDAAAKRAKSGDDDSPSATKKLFADDTNALEEAKQLEDAN
FT                   AKLRDELKAAKETIEERDRTIAEHIESAETTKAQYEEALAAAAKEHKAKLAELTADAKS
FT                   HDANVAAMSASCEAAIKSKEEMQAALDRAVAAREGAEKNAAETAAALEEVKAALKDAEA
FT                   AAAAAAEKAAEGSKELEAENASLRAKLEEERTTTAEKAAEIREAREKLEATEADLAVAK
FT                   NDADQLAIKLAEAKASLAAAVKRADEADTCAAPLRASENEARRVCARKEEEAKAMADRL
FT                   AVARMAHKQAMAALKEVGLRLEYDGTGAAAAEADAEATEAEPNTEPPTMDDGAEDAPMD
FT                   ADGVAGATQAAPGDFETEDAIDEEPRETENEGDRIVGMDVLYASVPASEVPASDVPSSM
FT                   DDGSEDEPVPDTELAAPAEGASPVAAMAPPSPREQPESAARHSVGAATQEAAAVLGGGE
FT                   LGGAPAEEEGEEEKEEKEEEAEDVSSGSDAEEKGSESEDTEEVEEEEPEAAGNAVEEPE
FT                   AEEPEADEPEADEPEAEEPEAEEPVEPALVAKVAVPEEEKENSAPVDASVGKELPFSSE
FT                   VEDVAAVPLSFLED"
FT   CDS_pept        936488..938596
FT                   /codon_start=1
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637389"
FT                   /orf_name="MICPUN_93714"
FT                   /product="Predicted protein"
FT                   /function="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) activity"
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61831.1"
FT                   /db_xref="GO:0004360"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="HOGENOM:HBG645312"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI000199ACBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z8"
FT                   /transl_table=1
FT                   /translation="MCGIFAYVNYGVPTKQKAIVDKLLNGLRRLEYRGYDSAGIAIDNG
FT                   PSLDELSPIVLKETGKIDMLADFITNKENLNSDLFFENHCGIGHTRWATHGPPAPRNSH
FT                   PHTSDANNEFLVVHNGIITNHQALREMLERKGFVFESETDTEVIPKLTKYLYEKFHNRV
FT                   TFRQLVMEVVRQLQGAFALIFKSSHYPGELVAAKRGSPLLLGIVEEPGKNAPHAVLTSE
FT                   GFKTSKEGPIGDEAPRDNGGKRQKTLKNHVEYYFASDASAMVEHTKRVLHLEDDDVAHL
FT                   HNGGYGIYRMERSKPTSGTSSPVHYEPTVQSAEVERTVETLQMEVEQIMKGSFKHFMQK
FT                   EIHEQPESMVQTMRGRMVTCDEGKTAERVFLGGMVNFVSTIRRSRRIILCGCGTSYNSA
FT                   IAVRQLMEELTELPVTLELASDVLDRQCPFFRDDTCVFISQSGETADTLKAMQYAKERG
FT                   ALCVGIVNTVGSAISRSTDCGVHINAGAEIGVASTKAYTCQIVAMVLLALALSEDSISR
FT                   ATRRKEIMQSLLGLPEAVRTALKLDAQMLALAEALKDEQSLLLFGRGYNYATALEGALK
FT                   VKEVALLHSEGILAGEMKHGPLALVDETMPLVVVATRDGSYAKQESVVQQLRARGGRLI
FT                   LIATEGDDQIAEVAGKDATIIWVPEVEDCLQAVVNIVPLQLLSYHLTVLRGHNVDQPRN
FT                   LAKSVTVE"
FT   CDS_pept        join(938732..940451,940473..940930)
FT                   /codon_start=1
FT                   /gene_family="HOG000175261" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637390"
FT                   /orf_name="MICPUN_97165"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61832.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199ACBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z9"
FT                   /transl_table=1
FT                   /translation="MAFWKPGSKKPEASLPLSAEVDREGPGDSGGRLVVFNRNENLALQ
FT                   AQRERLPIFKTRDAILHLVETRATTVLVGQTGCGKTTQVPQYLVEAGWTAGGRLVACTQ
FT                   PRRVAAMTVASRVADEMGVTLGAEVGYAVRFENVSTPGVTRVRFCTDGVLLRELMEDPL
FT                   LSRYSVVMVDEAHERSLATDLLLGLLKKVQRRRPDLRIIIASATIQAEEFAAFFDTRHL
FT                   EPKPASEASSVNAPSREPGIVSVEGRAHTVLIHYLEKPVPDYVKAAVGAAIDVHRAEGP
FT                   GDVLVFLTGEEEIEAAVSMLQEEAEDNSRRLLGGGAGTNPAGGPERFTVHPLYAGLSPA
FT                   QQMEAFRPAPRYTRKIVVASNVAETSVTIEGVVYVVDCCFVKQKAYDPTRGMESLLTAE
FT                   ASRASANQRAGRAGRVRPGKAYRLCTEKAFRDLPETAPPEMIRSDLAATVLQLKALGID
FT                   NIMNFEWLSPPPAANMIKALELLYALQAIDDDARLTKPLGMHLAELPLEPQLGKALLVS
FT                   GELGCVEEMLTVSAYLQVQTLWVSPRGRQKRLDECRDRFAVAEGDAVTALNIHTAWCGG
FT                   RARSFADKNMLSHRALVRASDIRAQLARHVRRVGLVVSSAGKDSAPVRRAMTAGFFANA
FT                   AALAPHGGGAEGSAFRSVRGGATLFIHPGSVLFRARPAMVVYAAAVRTGREYMRDVTAI
FT                   DPEWLSELAPHFYAMTQRSGNERPADAAAVF"
FT   CDS_pept        join(941026..943278,943344..944537)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637391"
FT                   /gene_name="MER3"
FT                   /orf_name="MICPUN_57057"
FT                   /product="DNA helicase Mer3"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61833.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG609620"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI000199ACBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E200"
FT                   /transl_table=1
FT                   /translation="MGSRPWDADYVSGGPPPPLRAPRLRATPVPPSSAPPTGPPPPPPS
FT                   RSPPKDSRDRVRSVEELPPCFQPIFPSFKYFNGIQAEMLDFILSSARSFVVSAPTGSGK
FT                   TVLLELAIVQMLMKHVDRATGAFNHKPGELKAIYMAPLKALVQEKKEEWIAAFGAIGVV
FT                   CKELTGDTDIVSWSELNNVDILLTTPEKFDSITRKNKDRGGMSFFGDCALVMIDEVHLL
FT                   GDERGGSLEAVVSRLKVLSEKPSLRGAPLSSVRFVACSATVPNLDDVGRWLGAPSPDGV
FT                   RHFGEEYRPVRLETKVLGYDPAKNDWMFERRLNERLYEVVLNHFQSKPALVFCSSRDGA
FT                   SSAAKELAEKARNASRNPFVRDERQRESLREAAGRAENRQLKVVIPQGVAFHSASLDWS
FT                   DRELCERLFRDRLVTVMCSTSTLSMGVNLPAFLCVVRGTRQYAGQGEYREIERSALLQM
FT                   CGRAGRPQFDTSGVAVIMTQKHTRVIYDGLVHGTQPIESNLGLAMAEHVNAEIASGIIA
FT                   DSETAMDWLKHSFFYIRVTRNPRHYGIAPGKNPDVACGEIVAENLRKISAAHMCEIGED
FT                   AAAPRGNFVRPLEGGRVMSDMYIRFETMKRIMSVQSPASVPDLLMTLCESDELSSIKLR
FT                   RDEKVLLKGWNLSKDEPAIVRFKVTEIRGKTGKVAVAKTIKTAAQKIYIIAQETMSDQF
FT                   ATVLPPSMRMEVENVFQNGRRIMQGAARYYANVSKKGSFAAYCNALRLAKALDMRMWDD
FT                   TQFPMRQIPKCGKKSVQALANAGLRSLDEVLAQDPRALERIVNKAFPHGNHLHDAIRSL
FT                   PCAMILRIERASEIRGGGITATVTFEPEAGAGGGGGEGTDASVTESSRRWTARLIIGTT
FT                   WNDELLHNERICQRGPAPDNVEAGVPVTRSVSLSSAPPGGQEVTIVATLMFDKCVGRDT
FT                   DAVLRVRATITGGGGGGDAQFERRMGAVEGNVANVVSPKGRNRVAAGKENNLSPAFCRL
FT                   MAAPPVAPKPAPRAIWTEPMIPETATLGSRPVAVSGPSKEPFDAFEDVPEWIPAAAGKR
FT                   RAPDDNDGGWGGCDDADEDLSWGGADAHHGPPPMCQPPTLIVIEDDDDEDGRGRREPRP
FT                   DPPKRVRAAAVFAEPSTPVPDDAGFTDPTSGLTLDLLCDDW"
FT   CDS_pept        complement(944680..945765)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637392"
FT                   /orf_name="MICPUN_107932"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="ACO62253.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI000199ACBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E201"
FT                   /transl_table=1
FT                   /translation="MLRRLQKSLAGNCPVGTPITPLPANGGDGAHEGKAHVHIIAVEPV
FT                   YSAMDDDASNSHPNSPANSPKAAKFSGGAVGGEEFPVASAFVFDAPFVPQGAPKPSGPE
FT                   AALRITWRCRTTARVDGKFPGLCARLLVTDESTTEMSPASSAAEMLRAQSRAIAAAATA
FT                   WDELRNGATSSAVVGVVGGVSANAAAVDDAASAAAVAGCLGALQRSLQGSLAAGVNGGV
FT                   PAICRAFFPEEESRKRAMSDQSSQTPEIDEEDEESDNTKQEEAVTGSPKPQVDPRAMTS
FT                   EDRSGLLAALEDFLSACARAVEVHGTATRLTAAGKPRGESGASTIEQMQGMFVRCLAEI
FT                   RRDITVISDREKDVDNDEEYK"
FT   CDS_pept        join(952641..952861,953051..954485)
FT                   /codon_start=1
FT                   /gene_family="HOG000264952" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637393"
FT                   /orf_name="MICPUN_105298"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="ACO61834.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG560236"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI000199ACBF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E202"
FT                   /transl_table=1
FT                   /translation="MPPVLRPRTPKKGDAPRVKTPGSARPVRREFRNGARAGTGAEDQK
FT                   WSFALSSSGWLFVYYIGVVKALASRGFHRNSKIYGTSGGALTGCLLFLDIDLDALAEYA
FT                   YICAAEARASIRGAFKLRDYCRGAITQFCTANAHEILQGRFEVSITRIFPWYKNLRVNN
FT                   FPTYDFLIQSLMCSACITPLAGFPMWLKGHGLCFDGGVSDFQILKGLARNGTFCKLHCR
FT                   KTNPKDLVVVCPFYSSRANIRPSKYVPIWWAFYPPPPYKLKELFELGQKDAHAWCDKQE
FT                   DAGSSPEKDDSPRATSSEGSRSSDEDDDMEWEWQRKEKAQARGTSDAKDLSRESSVTAD
FT                   DQDMEPPTSPTATNRGFTEWAAECQEWASLSAEAAARRAMSAARAAANKAEAFVHHEAE
FT                   VVHTYASGKFCQAQAAAEAMRRVASKSNLPEIDLIADLDDDDPEEEIPRGRFQAHRLLL
FT                   KSLACMVIYLELVAQTLLNVCGAGAALLLPGVRSGKLREKVFECCRPLPRVLLQPVPGV
FT                   RKVAKIDGKTAKALGNISVAYRVLCYLVHMEVHC"
FT   CDS_pept        complement(954600..955280)
FT                   /codon_start=1
FT                   /gene_family="HOG000276369" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637394"
FT                   /gene_name="RPIA_1"
FT                   /orf_name="MICPUN_97166"
FT                   /product="Ribose 5-phosphate isomerase "
FT                   /function="ribose-5-phosphate isomerase activity "
FT                   /biological_process="pentose-phosphate shunt, non-oxidative
FT                   branch"
FT                   /protein_id="ACO62254.1"
FT                   /db_xref="GO:0004751"
FT                   /db_xref="GO:0009052"
FT                   /db_xref="HOGENOM:HBG515603"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="UniParc:UPI000199ACC0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E203"
FT                   /transl_table=1
FT                   /translation="MVVGLGTGSTAYFAVERLGEKLKSGELKDIIAIPTSERTREQAES
FT                   LGIPLCTLNEKSVLDVAIDGADEVDPDLALVKGGGGALLREKMVEVMAKKFVVIVDESK
FT                   LCKGLGPGFPLPVEITPFCHMHTLRTIAALPSVAGCEAVLRMGSSSTNKPDGDNIAVTD
FT                   NGNYIVDLHFKEPIKDVNKAAEELKNTVGVVDHGLFVGMSYQVIVAGKDGIKVAGTDGE
FT                   PAWW"
FT   CDS_pept        join(955861..958443,958657..959175)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637395"
FT                   /gene_name="AE_1"
FT                   /orf_name="MICPUN_96291"
FT                   /product="Anion exchanger family"
FT                   /function="inorganic anion exchanger activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61835.1"
FT                   /db_xref="GO:0005452"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniParc:UPI000199ACC1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E204"
FT                   /transl_table=1
FT                   /translation="MSESTSEVPGVGEPPRYVRFLQHLVAEGGYGLDESHALTGLKEWR
FT                   EAEVVGALLRNVKERAPDAVVGRIFTAVNQDGLVVLVGEAGEPENGGDAHANGSTEATS
FT                   NGAHHVASNGTEITSANGRAPRHRVLTDCHISVCTLDQPVNLGAPDGRNARAVFLVMVP
FT                   EVDFTAPWAEGLDRYECLRTIKTAFQRFAARGTFLKTVYADERNLEAATARQKLAEFLG
FT                   ERKSGDGDADGDRDPELGKSSGRMAAKATSTRPTSPRMSTGGSNLARQKSIANMLTPGA
FT                   KTTRLRPVDLVEALRASVAAWADHEQRRLLLLADENERETEAASMYQWTGRLCGGVIDD
FT                   VTNRWAPLFVSDWIDGVSVKTVSASLLMFFGCLAPCIAFGALTDISTGGKMGTMEYLVA
FT                   QSVSGVVWSIFAGQPEIVLRTTGPSTVFLIELARACERDGYPFITAFAWTGIWSAMFMI
FT                   AIACLDACTLMLRNCTRFTQEIFGLFVSAIFIQSGGTALVSYFKSDEYDLAHALFSLIL
FT                   ALLTLQLGLWALQVRTSPFLLPTMRELTADFGVAAAIAVGTLTAYGSNVKGMEMLKMTS
FT                   SIEPADGRGSWVVDLHAGPAHLKWLAIVPALLLTALMYVEMNISSLLANKPENKLIKGP
FT                   AHHQNFLVMALITLVFALFGLPPMTGSLPHSPQFIRALSDVEEITVGGETRTNVIWVRE
FT                   NRLAPLLVHVLMSLTIVMAPALRQIPMAVLYGLFLYMGITGLATSQLWTRIKMIAMDPR
FT                   LLPPTHYVRKVPLTRVHAFTLVQMCCCAALLGVRQSPAALFFPLFLGALMPLRYTLTHE
FT                   GVSLFTPEMLKMLDMIAEASNAETAARTGRTDAEDHLTIRGDVADFDRSPNLSTSPSGD
FT                   LKAPPGLGENGVLATCLTNPSGVGVLSGTLVCATDLGTRRILRPKILPLALTSAQAAGT
FT                   PNTSAVATRTVVGVTCGCSASTLPASFMANASTSVNIRIAVASAAVDTAVTPSAKAFAP
FT                   SPARGAAFSKTALADEVAVVISGSVASWSAVASSMTYPGAMVLA"
FT   CDS_pept        960347..962326
FT                   /codon_start=1
FT                   /gene_family="HOG000265335" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637396"
FT                   /orf_name="MICPUN_99546"
FT                   /product="Glycosyltransferase family 77 protein "
FT                   /function="transferase activity"
FT                   /cellular_component="endoplasmic reticulum"
FT                   /protein_id="ACO61836.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG560238"
FT                   /db_xref="InterPro:IPR003388"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniParc:UPI000199ACC2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E205"
FT                   /transl_table=1
FT                   /translation="MQEVDPSKQDHPKWMRDMWSEKVQAVDKNVIDKELEARLESRPPE
FT                   LDHVQPGEELFVTFGTASVTDFVQNWLESADKLGLSPLFVGALDEDMYEWCKKRGVPSM
FT                   LLKGNTVLKNRGQQFITAGDKSFKKMGTVKTKFIQDLLELGIAPILTDADVVWLKDPRS
FT                   YFKRGTYITADVLVSTDCIDVPADRKDNNGCSHVNFNTGVLHFRPTDAAKAFVQTWKTK
FT                   VATSTIAWMRDQPAFNLITHEGVGGHSLEPAVSVPEERRGTEGHRMVYWAANASIRLGV
FT                   LPNWLFGNGHSYFVQWHHLTHPEDGEPFSVHLTYQYGDTGSYAFGKRERMRQAGIWRSD
FT                   PREYFEDGKYLVVSDEGSQVDFSGESPGGEEVGSDRNAYRTAIDRHLREDKLRRTTIRN
FT                   ALALARALNRILVLPEARCYCDKIWNNLNACRAPGAESFKLPYACPMDHIYDLPSWFNP
FT                   GMPDFREPGFLDDPRVPDAIKASVGRVVVDRDGDTRAGKPGWDMNDGKVVKLRHGFTVP
FT                   DAKLALKSLEEKRVIEVDFLGNEGTFCGFGDDAKNKEFDRIVVKPLSASQYYCFTELWE
FT                   DQGSPRGGRNGPYEPQVVLRHCGMMEDDFKRAGKVHAGVVEHIDKPDGGCSCEWGFGLP
FT                   RGLAHISKDESICPRRNSDQPTAG"
FT   CDS_pept        complement(962413..963198)
FT                   /codon_start=1
FT                   /gene_family="HOG000264921" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637397"
FT                   /gene_name="TIC55-2"
FT                   /orf_name="MICPUN_57064"
FT                   /product="Chloroplast envelope protein translocase family "
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO62255.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG560239"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="UniParc:UPI000199ACC3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E206"
FT                   /transl_table=1
FT                   /translation="MDSDAAVGPSRSGEWHVVAKSDQLARENARVQVTADGRYLVVARS
FT                   GGRLYAFDATCYHMGAPLLHGDIEDVDGHGACITCPWHHYQISMSTGERLYQDMSRKTC
FT                   TLPKKQRVHEVMEADGEVRVRLSGGGKPPSPPPDVIRPKPHEVDYEWESDRYAFKPPPP
FT                   SQASQKAPRSGKVFNRGGGRFPPGAFGRGSAGLHPGLVGAGVGREVGRMVADSMRGGDG
FT                   KAPWAMSRGFAQPPPKAKPALAGEALAEGEELPDAPGDG"
FT   CDS_pept        963441..963827
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637398"
FT                   /orf_name="MICPUN_99547"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO61837.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199A5D8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E207"
FT                   /transl_table=1
FT                   /translation="MADMVQEIVVAKPVSPVQFMIDYLAVGSSLCQQDKYGLSMMRRAR
FT                   LMKIFKAWDKNQDKTVDLKELRAFTRKHGGNAVTQDELKDIFMDMDESGDSKVDEDEFL
FT                   KFFSLSVKRMDDDEFEQMIQDMLQ"
FT   CDS_pept        complement(964030..964257)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637399"
FT                   /orf_name="MICPUN_57066"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62256.1"
FT                   /db_xref="UniParc:UPI000199A5D9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E208"
FT                   /transl_table=1
FT                   /translation="MGGGAVTAVRATEDPTSFNQVVLQAGPLLLPLVLSTSAAVYRSSR
FT                   EGGLARLPLGMWGGICLVWLYWLGSQNGIF"
FT   CDS_pept        964543..965946
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637400"
FT                   /orf_name="MICPUN_57067"
FT                   /product="KH domain-containing protein "
FT                   /function="RNA binding"
FT                   /protein_id="ACO61838.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI000199A5DA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E209"
FT                   /transl_table=1
FT                   /translation="MGDDAQVKEEEGMSPPRGQSRSRSRSRSPRRRSYSPDRRRRRDSR
FT                   DRSRSRSRGRGRSWSRSRSRSPRGYRRRSRSYSRSRSRSRSPPRRRRRSPPRGERDSRR
FT                   PPPGGPARVKAEAEEAIPCVGYEGRIIGRGGETIRRIQEETGARISIDRASGECMVSGS
FT                   TEQVILGSAAVKKIIAEAGERGGGGGGNGGGGGGFRPPSGPFEAEETIPCAGSEGRVIG
FT                   KGGETIRRLQEETGCRIDIEKGSGLCTIKGTVAAVRAAAAAVRRQIEDGDGGGGGFKRK
FT                   RDSEDEPIDSAAYGRELAQREEDDEPKPPPIEPDFGLSGALAAETNTVNGVTLVYTEPL
FT                   EAKKPTVRWRLYVFKNGELQGDPLKIHQQSYYLLGRERKVVDIPTDHPSCSKQHAVIQF
FT                   RARDVMDDDTGDMVQVVTPYILDLDSTNGTHLNGERIDPRKYYQLLEKDTLVFGQSTRE
FT                   FVILNEDSK"
FT   CDS_pept        complement(966003..968894)
FT                   /codon_start=1
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637401"
FT                   /orf_name="MICPUN_57068"
FT                   /product="Chaperone, Hsp100 family, clpb-type "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein metabolic process "
FT                   /protein_id="ACO62257.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR023150"
FT                   /db_xref="UniParc:UPI000199A5DB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E210"
FT                   /transl_table=1
FT                   /translation="MSAMASNVAGGRVVASAVRRDGNAVRSRRPPGLGEFRPSRPLRSK
FT                   VATRVSADSAKKISQNEFTERAWEAIVLAPEIASNSQQQIVETEHLCKAMFEQKDSFAL
FT                   RILTQAGVDPSAAVGFIDRFISRQPKVSGGAQQVLGRHLEALVEEARVRRSAMRDDFVA
FT                   VEHLVLAICKDERVGNALMAELGLNEDALKNAVTKLRGGTNVTDQGAEGKYESLKRYAR
FT                   DLTAEARAGKLDPVIGRDDEIRRTIQILSRRSKNNPVLIGEPGVGKTAISEGLAQRIVQ
FT                   GDVPLSLQGVQVMSLDMGLLIAGAKFRGEFEDRLKAVMKEVTDSDGGIILFIDEIHTVV
FT                   GAGGSGGSGGGMDAGNLLKPMLGRGELRCIGATTLDEYRQYIEKDPALERRFQKVLIDQ
FT                   PSVEDAISILRGLRERYEIHHGVSISDNALVEAAVLSDRYIADRFLPDKAIDLVDEAAA
FT                   KLKMEITSKPTVLDEIDREILKLQMEQLSLRRPAGSRPSEQANVSARLQRVESELASLM
FT                   VRQDTLTFQWEQEKAKLAAIQQLKEEIDAVQTEVSQAERDYDLNKAAELKYGSLMNLQR
FT                   ELLDAEAAMDAAAAQGGDLLRDEVTESDIADIISKWTGIPVSKLQEGEREKLLNLPAEL
FT                   HKRVVGQDLAVQAVTEAIQRSRAGLSDPNRPIASFMFLGPTGVGKTELAKTLATFLFNT
FT                   EEAMVRIDMSEYMEKHAVSRLIGAPPGYVGFEEGGQLTEAVRRRPYSVVLFDEMEKAHG
FT                   DVFNVLLQILDDGRVTDSQGRVVNFKNAILIMTSNIGSQFVLENMNDNSEGGKAYRRER
FT                   VMEAVRGHFRPEFVNRVDEYIVFDPLDFNQVRKIVEQQVERVRSRLKDRKIGLRVDESA
FT                   IQMLCEAGYDPSFGARPVKRAVQHLLETSLAQAILRGDVAENEQAVVWAHGEGEGRQLL
FT                   VAKEEGQRQEEPAQQELNGADPYAQMSWDQTPQ"
FT   CDS_pept        join(complement(969325..>969996),
FT                   complement(<969086..969219))
FT                   /codon_start=1
FT                   /gene_family="HOG000264974" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637402"
FT                   /orf_name="MICPUN_70208"
FT                   /product="Predicted protein"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62258.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG413464"
FT                   /db_xref="InterPro:IPR012926"
FT                   /db_xref="UniParc:UPI000199A5DC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E211"
FT                   /transl_table=1
FT                   /translation="GALDGYLKPPRNGKFLSLLMGNAVDVTSQRQENRLRIKEEYYSFR
FT                   DRSTFTYVAWPTALLYLNRERQKGLEAGAANTWFSLVTVFPVLVQFYWCWMLYFYAALA
FT                   LRENVLRCNGSRIRRWWINHHYYSMGMCLVVLTMDVQSNACLNYMSRFLVFTALQGVVM
FT                   LTQNRYQRFRMYTRVAMGKASPMDVAGGEMGGNAGQLKLLYPLLFGLQIMQVYFGASVL
FT                   VSFFREWQAPAAGALFVVMGVGNFRATCQTYFTKRKFAKESSRSKA"
FT   CDS_pept        970536..971945
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637403"
FT                   /orf_name="MICPUN_57070"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /protein_id="ACO61839.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A5DD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E212"
FT                   /transl_table=1
FT                   /translation="MSGFHTEDGYNGPSLFGQNGAIVGGVRNKLGHVASEEEKQQARRT
FT                   VVVIGIKWLLSPGWRGDDYRDAVFPAEVAQWFEEQIGPVQAVHFKPPVQAWVEFNSASN
FT                   ATAALNLNGATYPRKCKHSPGGRIKVSRATHTELVRGAKDHLRSYHVLIPEKFLKGEVE
FT                   PGAHDGAGDGRAGEKEGEDDEAKVIAALRESNPYFDQDMALYEEHHREKLRAEFDRLAR
FT                   ERSELEEVKRLYRGASAGDVDAIESAIWAGADTDTANPLDGGRTALHYACLAGERAAAQ
FT                   VLVEHGANPSALDALGFTPADALKSGEKDPRGEIAGDLELARAAHAHMASLAMKINAGT
FT                   YDVDEPDAPDSMPPLHEAVAARKGALTRFLLAQGASVEKTGGSDGDTPLHIAARTGQER
FT                   MCRLLVLRGAAPDAPAAGGDGSTPLHEALRGVKRNGSKGAHAKIAKLFMDEMKRLGRGA
FT                   EAAAIIAGTRS"
FT   CDS_pept        complement(972004..972663)
FT                   /codon_start=1
FT                   /gene_family="HOG000220986" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637404"
FT                   /orf_name="MICPUN_80283"
FT                   /product="Predicted protein"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62259.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG713289"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="UniParc:UPI000199A5DE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E213"
FT                   /transl_table=1
FT                   /translation="MSAVSAAAVKELRDKSGAGMMLCKKALTECNGDMEEAVKWLRKKG
FT                   MASADKKAGRVAAEGAIHSYIHGGSRLGVLVEVNCETDFVARGDKFKELVADIAMQVAA
FT                   SPGVEYVSPEDADPAMVAAEKELMMKMEDVVSKPENIREKIIQGRLSKVVNEKALLKQP
FT                   FIKDPSKTVEQLIKEVTAEIGEKISVRRFVKYNLGEGIEKKVEDFAAEVEATRTAT"
FT   CDS_pept        join(975993..976128,976414..977645)
FT                   /codon_start=1
FT                   /gene_family="HOG000131659" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637405"
FT                   /orf_name="MICPUN_80247"
FT                   /product="Predicted protein"
FT                   /function="acyl-CoA dehydrogenase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61840.1"
FT                   /db_xref="GO:0003995"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG699365"
FT                   /db_xref="InterPro:IPR006090"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR006092"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="UniParc:UPI000199A5DF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E214"
FT                   /transl_table=1
FT                   /translation="MAPFGSKVPLAEPSWYQNLNTPYYNASHVAWRAKLRDFFEKEVEP
FT                   IVDDWDKQASMNNHAACGEYVKRMYAKSAQYGILPACVGKPWPGKYTSAAEPEGYDYFH
FT                   ELINVDEGTRAGGGIAWAMMGGLGIGMPPVLNFGVPGDRALQDRVVRECLAGEKIICLC
FT                   ITEPGAGSDVANLACTAEDKGDHFLVNGNKKWITNGIYADYFTVAVRTGPPGSAHKGLS
FT                   MLLIERNSSPGITTSKMDCMGVWPSGTTYIEFDNVKVPKKNVVGRVGDGFKQIMYNFNH
FT                   ERWLLAAQAARMARTCVEESIAFARSRRTFGKFLIEHQAIQHKIGEMARQCEGLQAWLE
FT                   NVTFQMNTMSKEEQNRKLGGHIALLKLSSSRVAEFCASNAMQVLGGAGYTRSGKGTKVE
FT                   RIYREVKAYAIPGGSEEIMLNLAAGQFGFVTRRAPDPRDKIIKQLKDELKRVHSKI"
FT   CDS_pept        join(977864..978909,979111..980788)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637406"
FT                   /orf_name="MICPUN_99553"
FT                   /product="Predicted protein"
FT                   /function="sulfotransferase activity"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61841.1"
FT                   /db_xref="GO:0008146"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniParc:UPI000199A5E0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E215"
FT                   /transl_table=1
FT                   /translation="MATTGDAREAEPLLGGGDTGAPASWWPRGRVGALVAGAMLVLLGL
FT                   CAGSAVGPMPTGLSRLGDDDAAPAPTYPAAEEPPLLDPLVSFNTPRCRQTRASLARVTN
FT                   HDGDVVVIPELRAVYVDIVKAASESIRSALEDNFHASWSADLGQYKHPVTGRPQRSSTS
FT                   YLTDDVLANYTFFTFVRDPNTRFRSSYEQAICRERCTLCTARGAGTMYTPTIAEITAFL
FT                   QGRLMHFYGDIALRGERSDEITLQEAWVDEHFESQILRLSGATKDGTPVPLNFVGRVES
FT                   FEHDWARLMDHLGVKEGDPRRVTPGHQEHACDIPERGKVVQRQRASPVTTLEKVAVAAL
FT                   YHDDFECLGIMASWKDGLEGLRERNVTELACVMMSSQKPPYSAEVLEEARKSARKVEGG
FT                   FASRSKHAKEYAAKVAAKKGDLVKKIVKVMPEGVQKEHYQEAIATAAMIDKAAAEAEAQ
FT                   AKTEVKPEVKVEVKPEVKVEVKPEVETEAKPMDVDPPSQQPSSQGTILRQPSDTAAAMA
FT                   QVEKEPLIKTILRRVLERHEIKYHLSTLELDAKRKYSAKAASAVSHAMKKYNEHVEARN
FT                   AKLPPAQRKPGLGEAALVEHITSQAHKMLLAKLKEAAEPKKEEPPAAPKPGDASFVPAA
FT                   RPPGMEGKSFDDLVQYWKRLGELRVAYLPRVRQTLPMLQKYSRGVGQVAANAENFAKMT
FT                   EHTLIPLLSQTADEPMMTAKFTMDELAALEGHVKKLVALAGGRGVNEVPAPAPAAPKPA
FT                   PADEATAGDTKRKRDGEEEEDGEGGDRKRAKTEDAPEPEPEPEPMPAPRAPSAFTGLTS
FT                   CAPDHAHAQPAPPMPSALEGTSEKRPPGKSVGCPVAAEEGELVAAAVYSSDDVSYWAPD
FT                   GELLRRALEGEVIAGTTKSAAMFKAFEELKEVFSSA"
FT   CDS_pept        complement(980875..981240)
FT                   /codon_start=1
FT                   /gene_family="HOG000100029" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637407"
FT                   /orf_name="MICPUN_80239"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62260.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG560246"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199A5E1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E216"
FT                   /transl_table=1
FT                   /translation="MPEAGGNLSAVRGEDQFGRTLWEKGKNGALVVVKYGAAWCKHCPM
FT                   MLPEFGAAARRHPEAHFVLADVDTLPETGKDIRFTPTFSFYRSGVKLDEITRTSPQQLR
FT                   DHVWMHAPDKPYVPDDA"
FT   CDS_pept        981450..982292
FT                   /codon_start=1
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637408"
FT                   /orf_name="MICPUN_79551"
FT                   /product="Predicted protein"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="ACO61842.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020552"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI000199A5E2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E217"
FT                   /transl_table=1
FT                   /translation="MAEIDHAACLVAAELAARAAGEEIKAAWDAERDVEYKGTVDLVTA
FT                   TDKKCEDLIFDMLQSKFPTHAFVGEESVAAADGKLPEIGDEPTWFVDPLDGTTNFVHAF
FT                   PFSCVSIGLAVKKKPVIGVVFNPISNECFTAVVGNGARLNGKPISVSKVSDLGKALIGT
FT                   EIGVSRDAATVDAIMGRVRACVENARSLRCSGSCAMNMVGVAMGRLDGFYEIGFGGPWD
FT                   CVGAAVIVTEAGGVVCDPSGKPFELTARRVLCGNPDIAPALTKVLTAIPDGPLEPQAP"
FT   CDS_pept        join(complement(983287..984084),complement(982387..983136))
FT                   /codon_start=1
FT                   /gene_family="HOG000264977" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637409"
FT                   /orf_name="MICPUN_80181"
FT                   /product="Predicted protein"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62261.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG560248"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI000199A5E3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E218"
FT                   /transl_table=1
FT                   /translation="MPILLRRTSTGSGFTVGASGRDGVGGALKSVDLYAKMPRELAEGT
FT                   YLGGVFSILLMFVFVSLFGMQLRALWTVGTRTDIAVDHSEDAKFQVNFKVELPALSCEW
FT                   ATVDVIDALGTRHFNISGESIYKHSMGASRYLGVEHASAGRESQREPEYGDTTDLDHYG
FT                   NRRIAYEVTGATFERMIRAHKVLLVEFHAPWCSHCQRLAPIYEHAAELVRSELRRGKRA
FT                   RLAAALATVDCTIESNKDLCKEQHVQAFPTLRVYRAGSLHPVDLVQSVADAKAESSYDD
FT                   EFSETNARAAAMKAAEMARAAKSLGGQIRTSGCIIDGSFRVNRVPGAFYVTPHSMGHNL
FT                   NPDVINMTHTVKHLSFGKHVPGRPSYVPRNLRRVWNRVPKDLGGRFAAGDEATFYSEEP
FT                   NTVHEHYLKIVSRTFEPLEGQAVQLYEYTFNSNRFRLNPPLAADGDPDQHVDGPMIKFS
FT                   YDVSPMSVVLKEVKKPLLDWILGMCALLGGVYTCAGLLETFLQSSVCAVKRRVGKIS"
FT   CDS_pept        join(complement(985080..985451),complement(984255..985028))
FT                   /codon_start=1
FT                   /gene_family="HOG000264978" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637410"
FT                   /orf_name="MICPUN_79531"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62262.1"
FT                   /db_xref="HOGENOM:HBG409849"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A5E4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E219"
FT                   /transl_table=1
FT                   /translation="MLAQEKLVPKPPIRTTVGYNFEHDNDLREAYRNPWNEVRIGRVLE
FT                   DLDSLAGNIAFAHCDDADVATRPQLLVTASVDRVRLLRPLRLKEDMTLTGAVAWVGTSS
FT                   IVIRMEAWPADHPDAPTDPDPGPSLTADFTFVARDSVTNKGAPVNPLVPETDEQRDLFE
FT                   RTARRVEAKRARMRSERTNGADGALSPELAESKRLFVEDVTRAARALRELPALAPAQDV
FT                   AMDATRTENMFVAQPQQRNLSGRIFGGFLLRRAFELAFATTYVFGGAKPKFHSVADMNF
FT                   LRPVEVGDLMRIRARVLHATRTSCGRPSVDVEVEALVTKPESLRSEVSNTFMFKFDVGD
FT                   ANEGRVVRRVLPSSREEAAHVWEKCVRPDVQARLEEQTPLI"
FT   CDS_pept        985948..987432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637411"
FT                   /orf_name="MICPUN_112704"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61843.1"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI000199A5E5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E220"
FT                   /transl_table=1
FT                   /translation="MSSEPSPSPPTAICLTIKNLTKRDFTLGEVPLALTVGELKARIES
FT                   EYEGNPPPNTQRIVYAGALLRDESAGLADVVKASDLEAGAVVFHLVLPAEASSTASTPA
FT                   STPGATPASAREPGAETSTPSSAPSPADGRLPAQPGTPPPAPRADQQSAYPPQPEATPA
FT                   FGFSNQPPPATTQPGSSRPTTPGMTPTVAAYPPPYAGLGAHSPHVQAVYASAYAAAFNS
FT                   LSPGGSPAPGAPVAVPVPVPVFGFGGGWGAPGWGAPGWNGAPGGYQQHGAPGQQQHHAV
FT                   LAPGQQQPTTPTPPRFDLNDPDQAARAVAQAVRDGDPVAAAAAAAAAAAGGRPVHVMQI
FT                   HIDLRLIMKLAMIVAVASQGATNVRMAIYAAMAVVVYLFQTGAVAWVIRRFLPDILDEQ
FT                   ADGMVGGMGAVGGGGAGRAGGAAAPPPRRRPPQGPRTNAVLPGMRDGMPRSWFGEIKVL
FT                   VCGFLASLLPSWQPPELYRHPRPGAAAAGPERPHQD"
FT   CDS_pept        complement(987506..988660)
FT                   /codon_start=1
FT                   /gene_family="HOG000264979" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637412"
FT                   /orf_name="MICPUN_57080"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62263.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG560250"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI000199A658"
FT                   /db_xref="UniProtKB/TrEMBL:C1E221"
FT                   /transl_table=1
FT                   /translation="MGKSLNGSGQDLHDNPKGRDRRNWAGISAALFYGSMSVASVFLNK
FT                   AIFEVWRYRYPASLVAGQTVFTVLAIFTLSRFGVIKLGKFNMDHFKRVFTVSAVFQLKL
FT                   VLDMSALVLVNIPMYGILKSSTTPFVMLLDYVLRKRVPAMRIQAAVWVTTVGGLVAGFG
FT                   DLHFEPLGYVLALSSAACTACYVVLVGKLGDELQLDSFTLLLYNSLWSTPLSFGITILT
FT                   GEVTGVMNYPHVSEVAFLAAFTMSCASAFVLNYATYLCTQLNDALTTSVVGRTKSVVQG
FT                   VAGLFAFSVSWGMTNVIGLTLNSVGICWYAWERYAEKRRGTRLENVRRGIGALNENFLT
FT                   RNESQLTLSPKKQMNGFGLHRHPTRASESGSSSMASMNGHGGGG"
FT   CDS_pept        complement(989040..992651)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637413"
FT                   /orf_name="MICPUN_99558"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62264.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI000199A659"
FT                   /db_xref="UniProtKB/TrEMBL:C1E222"
FT                   /transl_table=1
FT                   /translation="MEEAAPRAAPLQRLGPALRAVLGCDPKALRRAMDSRAAGDGGASS
FT                   GGGKSVKMARELTDALDDIAAFLAADVAEDADSGAAAAYPAVDPMLEHVVRPANGGVAA
FT                   GIDATAKSKKVALRIVAWLLASSPRGAGDECAARVGAALARRCAPPTPKRTRLAACIAL
FT                   HHAAVNLVDGLPPSCSPDAIAPGLLATAAEAGEGDAPTRLQAEAADTLLAITTRLAVVD
FT                   HRALWRALPHLRAVTESVGGWWPAACRAPRIAAREAYTRLRRVEDTGDAEAWSRALANA
FT                   WMDWAPLLAVRGGLDGITAGAVGRDVDTAVGGEVPSPSHGAGDGVESAQARQLARWLET
FT                   AAAAASAERTGGHGATAAASERLAHALVAVGLLVGRAGLAGGGESGDAHARAALRNRAA
FT                   DALVPALGSRSGAARDLAASIAACAIGGGWGAEHAALLDGSLAALDDASAVGDVRSTYS
FT                   GVASLASALVAAEPRAVGFGGTRPGLARVLRTCEHGRTEEARAGALAVIRNVLETAAPG
FT                   EDVVVGSEAAAITAASLGALKDPTLVVRKAAAATFSALPIPDVLPRLLRALSAKDARER
FT                   ASARESAAGAMRAYTETRGASAALDAFIAAVRPGPGEGDVVSGVSENDAEGSRATSVLR
FT                   GWSESLTEDQAREVAAGIAAATLRNPGVTALVRVASALAPRVGEPPACRETFAAVRAAW
FT                   SASRPAEASEASEASSNADDVFERLAPLLVLRTLPLEAWDDDHLFSVDESPSVPDVLLD
FT                   IALAGAGEHDEVRRVAAELHGRAHPDATSESRGVRLAEAVVDGALGRARACMFSLCSSL
FT                   AFRGIDACPSHSSTASPAATREVCARILESLGMDDSDEATKTRMGATETLASLVRAELE
FT                   DADVDRPGDDTDGDDDEPLSLGDEPRGGRAEGGLLEPADGFGQSPLTKSLANIYVDPLA
FT                   APTPAARREPLIRVLDGDDGTENVTENVTETGTENVTETGTETIPPRDGSRPTRRRRSA
FT                   TLNGILAALQGSSAPDWTRPADGNPGAATRIRLTLADVLVSVARRPLRDADAAAAFADR
FT                   ALPALAAVAGGSGSAACEKATEKATADANRRDPCDATRAAAFHVAMVAVAPVTGDGEPS
FT                   GGFRVSGGGRVASHARLLAASCASTLRSSGDVHDSVRVAAARLVTALVAGDDDTLEALA
FT                   GSIPEVRSALRSAVDTAESEELADSCRRLLTCMGAVA"
FT   CDS_pept        992799..994448
FT                   /codon_start=1
FT                   /gene_family="HOG000264986" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637414"
FT                   /orf_name="MICPUN_57082"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO61844.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG560252"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI000199A65A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E223"
FT                   /transl_table=1
FT                   /translation="MVTMLTSCVAASPIRGEIRRIRRARTAPRSVSVRARKDVDTLVRA
FT                   NLPSRFRSRAIQGPLRRGLVHRSPTRIASDAAKDDPEVELSDGVTLDRKAELASVVKFA
FT                   VPLLATNIVTPLLTMTDTAFVGRCAADSVIQLAALGVSTPLTDYTVSLAAFIPAGLTNI
FT                   ISNGVARGEGKESLASKTYGALIVSLTLSSIVAIVLNVWPEQLLTMLKTPPEVMAAAIE
FT                   YTRIRSIAMPAAYLTAAAYAVLVARKDTTSPLACVCIAAAVNVLLDWIAVGVMGKGAAG
FT                   AAWATTAALYAGAVAILGVLKRKGFTDAFPWGEFRWKDQIGPVMAFAGPITFLVFALLS
FT                   IYTTLIIMSNALGVTVSAAHRIAGNIFAVAVLCGDPLIQAGQAFMPRYLLPAVPKRVAA
FT                   RKMAGLLQGVGLFTGFSASTACAFVCLFGGWAFTRDAAVVAQLRAVVVPVCAAVVTNIV
FT                   SKSMYGVTVAAKQLGFLAAITGVGLVGFAGSLWWFKHNLVGSELYYWMWWVVAGYYGLA
FT                   IAAIQVRSFGVPGIVKGSFHDDRKDTPAPATA"
FT   CDS_pept        994660..996261
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637415"
FT                   /orf_name="MICPUN_57083"
FT                   /product="Major facilitator superfamily "
FT                   /protein_id="ACO61845.1"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199A65B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E224"
FT                   /transl_table=1
FT                   /translation="MYASRWLTLVLSQFVMVSSGTLYLFPVYSPMLKSRLDLTQEEVNF
FT                   VGSAAHFGAFFSVFGGFFYDAFGPRATLTLGGALKLGGLLTMALTIQGVAPQSHRFAAF
FT                   CAWVFGTGCSTSLTASLGANYATFKDHNLHGRLVGLILAFFGLSSGILSLVYDVFFTSP
FT                   VSFVYFLALFAGGMDLFAATLVGSPKNLALPDDEPEGGRGLPLGGVGPAPAGTVARLFG
FT                   AADHDAKLTRGLTLCGAVAIHVAVSALLIQSAGGVAAVTIACLLVTGALMTAQSWSLLG
FT                   GGGRVAFRRNEMAQVDPRLNAANKAALEGVGPAKLPFLLDFWLFFIAMMLGIGAGVTVV
FT                   NNLSQMVSAYPTLAPDAAATSRSLMKLLACTNTLGRLASGSLSDKLAHKVGRVQFTVYL
FT                   LALMAVGQCILAAMGGESAPLFGLVVGVFVVGWAFGALFWATPLLVMELFGPKNFGANR
FT                   GLVGLSPAIGGYVMSTLVAGRVYAASAGSNNDCDDGAACYGRAWVFNAFAVVVATGMMW
FT                   WLARRRARGRGMGPIT"
FT   CDS_pept        join(996655..996851,997076..998081)
FT                   /codon_start=1
FT                   /gene_family="HOG000264980" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637416"
FT                   /orf_name="MICPUN_90278"
FT                   /product="Drug/Metabolite transporter superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61846.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560254"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniParc:UPI000199A65C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E225"
FT                   /transl_table=1
FT                   /translation="MAAIAISTPIVARAPVVARRARVTARAAVAPAAKPAVSIGARTMM
FT                   SGSRVESRNMQVASGRKALVCNAGGVQKAAPGEKKKVFGLNLPENESLSFLILAGGSLG
FT                   SALGFAALQEGVFRIPGFKFGAWMTILTTFTYFLCGALEMKLTNDSRKASWKNYGILSV
FT                   YTYGGMAMTNYALSYLNYATRIVFKSAKIIPVMAFSVLIVGKKYDWKEWLSAAILVAGI
FT                   VLFTLGDVASSPAFAPIGVALIAGALCVDAICANFEEKNFFRCENPSTTQEVLCFASLI
FT                   GTFYGLIPFIASGKAGVAIAHSMQYTQVVPMIMGFSVLGYSSVSFILSLIKYYGATEAE
FT                   IIKSLRKVLSIVISFILFPKALNWKYIAGFAAVLVSTAYTFYLKGEKRKAKEAAKAAAS
FT                   A"
FT   CDS_pept        complement(<998756..>999964)
FT                   /codon_start=1
FT                   /gene_family="HOG000230811" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637417"
FT                   /orf_name="MICPUN_67528"
FT                   /product="Major facilitator superfamily "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="ACO62265.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG561587"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199A65D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E226"
FT                   /transl_table=1
FT                   /translation="RWSMVFALFCAFVLCNLDKVNMSVAIVPMAESFGWTSVEKGLVQS
FT                   AFFWGYAFTQVPGGWLAAKYGGKLVLFAGVMLWSFGTLIAPACANFSFTALLVSRFLVG
FT                   LGEGVAPSAATGVLAKGVPGSQRSKAVTATFGGLDVGSLSGLIIAPPIILFLGGWPAVF
FT                   YLFGVLGFIWGAWWAVGYMNDKSTDARETAEEKEAREAKEASGAKADPIPFGKFFKNGS
FT                   FWALMAAHFTWNYFSYGLLAWLPSFLSSALNVTLTKSSFLSILPYLATVAVTTIVAPTA
FT                   DSWEKNGMTRTNVRKLSQTLCFGGGAICLALVGLVVNSTPPEAVTQTTVITVMSLLTVC
FT                   FGMGAWVRTGLFCGHQDMSPKYASIMLGITNTAAAIASTLSTFFTGYFFSISGGSWGWS
FT                   LFFP"
FT   CDS_pept        join(complement(1001733..1001810),
FT                   complement(1000743..1001606))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637418"
FT                   /orf_name="MICPUN_57086"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62266.1"
FT                   /db_xref="UniParc:UPI000199A65E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E227"
FT                   /transl_table=1
FT                   /translation="MEPASPIPPWVEKPEECRWFYGDERPLPAKLWSLQNMWYEGEIGP
FT                   DTLVWTEGMGRRTRVRDMPTLLGILRGDEDEPTGLDQLLADAADADHERVADGATTSFG
FT                   DEALLDAELGSGSSSWELNGGRQRAAAAAAAAGRSSPALVLTLLRELQATQERCAKHEA
FT                   REMALAREEAQARELVRELRALAVEAREARRGLASSPFDLARLAGDASFGDAGTVASLL
FT                   AANDAMDGGECAWAGGSEGAPEEAAVRGRASRRRPAAKADGDSSSAAAAAAARRRRSGD
FT                   GRRASGPGVGTVTVVRLRRKKDAELPRPEWQT"
FT   CDS_pept        join(complement(1004267..1004336),
FT                   complement(1001887..1004147))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637419"
FT                   /orf_name="MICPUN_57087"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62267.1"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006210"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013111"
FT                   /db_xref="UniParc:UPI000199A65F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E228"
FT                   /transl_table=1
FT                   /translation="MKRPGLLAIALALVVGVQSVRSEAPPPPCSGHGTLNPDSTCSCEN
FT                   PRPAAGATGWTGGLCQVPVVGLATQTIGTNEAQSDSLESATWKCYHMATPAATDWNYLS
FT                   LELKQLDGDPDVYGMLYNATDDGRYPTGNTQGWDFREVSSSARGSVRLTVGKRDWAHPN
FT                   DAAEGVYICVTAYGDRVASYELRSVFTRCPAAFAIDSETGATVATQCSAPATGGTTNPT
FT                   DVPGACDEASGTCACKAYADHAYVAPEGSEHDDVPPELGFDSCSARIDFVPSASKSESW
FT                   DDVTLAADAWTFYRFEITDDDYQIQVTMERDEDEGGTARLFLRHETLPDSRWGHHDLPD
FT                   DFVSGTRPTQEVLVTRGDVAFVAGTWYAGVHAGADASSKFTLTVQRFDCPRDCSGRGEC
FT                   VHEQNGTRTCACDTGPLGPYLGPGCEDEYSGLTPSADGWHVNGTLGASDYDFFALPDID
FT                   IRESKRQIELVLSARYDRDETSYYWRPERPVLLLNHGDRSAFPSADNYTFKVTMEERSK
FT                   EYSIQLCAAQMRGSKWQAALYNPARTIPMVYSMSFRKKGVCPSATDGECSDNGDCVADV
FT                   TSPDFATCRCKTGWAGADCNFRACPEGSFIAVPGEGHGTCYRECVDGKHRPDGCDRVAC
FT                   DPPARSAADGSGCVMDECSNDLFFVDSGSDVSCVKRCVASSAGSPKRLSEECDPDTVRG
FT                   AGGSSGSRRRLGFPGVMVLIVVALSVIAGGVGYYAYSSCGGAEALGTLRGALAWGNGRG
FT                   FRRYDRFEGERFDDFAAADFDTP"
FT   CDS_pept        join(1004678..1004803,1005011..1006933)
FT                   /codon_start=1
FT                   /gene_family="HOG000167988" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637420"
FT                   /orf_name="MICPUN_93721"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="ACO61847.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG320237"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199A660"
FT                   /db_xref="UniProtKB/TrEMBL:C1E229"
FT                   /transl_table=1
FT                   /translation="MTAETQQANELYEAKNVLITGGAGFIASHVAILFAKKYPQYKVVV
FT                   VDKLDYCANLNNLRSIAGLLNFKFVKGDVGSADLMTYVMRSEEIDTVMHFAAQTHVDNS
FT                   FGNSFEFTENNIRGTHVLLETVKTLGTIKRFLHVSTDEVYGESSYEKDEANVEAASLLE
FT                   PTNPYSATKAGAEMLVMAYGRSYNLPYIITRGNNVYGPHQYPEKAIPKFIMLAQSGGTI
FT                   PIHGDGMATRSYMHVYDAASAFDTILHKGAIKGVYNIGAHEERTVLSVAQDIGKSLGKD
FT                   ISKTIVHVSDRKFNDRRYFIDCSKLLALGWTQQVSWEEGLKETIDWYTNNGQASGYWGN
FT                   LSGALVAHPTGGKPQLEGEVYQSLEEMMAAQERERAAEREEGKGEKKPMFLVYGRTGWI
FT                   GGKLGKLLTELGHDWCYGSARLQDRVGVQDDIKRSKCTHILNAAGVTGRPNVDWCEDHK
FT                   VETIRANVIGVLQLCDVALENNVHVTNFATGCIYKYDDAHTIGGVPFTEEDDPNFGGSF
FT                   YSETKSYMEMMLRHYPNVMQCRVRMPIDGDLQNPRNFITKIANYAKVVNIPNSMTVLEE
FT                   FVPMAVEGALRGLTGAYNWTNPGAISHNEVLELYRDYLHPEFTWENFTEEEQAEVIKAP
FT                   RSNNTMCDKKIRAAFPQVLGIKESIIKYVMEPNKKAGMRAPIKREIK"
FT   CDS_pept        1007244..1007687
FT                   /codon_start=1
FT                   /gene_family="HOG000012755" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637421"
FT                   /orf_name="MICPUN_57089"
FT                   /product="Predicted protein"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /protein_id="ACO61848.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG609650"
FT                   /db_xref="InterPro:IPR004039"
FT                   /db_xref="UniParc:UPI000199A661"
FT                   /db_xref="UniProtKB/TrEMBL:C1E230"
FT                   /transl_table=1
FT                   /translation="MLATRVAPSAVFLRGAAVKSSARPVRVAGRGPVTTQAFFGGFGGG
FT                   VPKANGQPMICIDCGYIYRGDFDALPRDYKCPQCNVGKNRFKVVEQAGSSYANLAAQKK
FT                   ANKAAAAKAKKGKGPSPRELAKQKLLEAQEEKDRKKGGGFFGR"
FT   CDS_pept        join(complement(1009287..1009351),
FT                   complement(1007773..1009015))
FT                   /codon_start=1
FT                   /gene_family="HOG000229290" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637422"
FT                   /orf_name="MICPUN_90282"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62268.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI000199A662"
FT                   /db_xref="UniProtKB/TrEMBL:C1E231"
FT                   /transl_table=1
FT                   /translation="MSSSLRRLATTVARAAAPVYQGTSRAAGWRQTTPALWRTARAYDV
FT                   NSRSKEHLNIGTIGHVDHGKTTLTAAITKVLAEIGGAEVVAFDQIDKAPEEKARGITIS
FT                   TSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHILLA
FT                   RQVGVPNLAVFLNKVDMVDDEELIDLVEMELREMLSFYKFDGDNIPIVRGSALHALKGT
FT                   DDKLGKEAILELMKACDAFPSPERVLDKPFSMPVEDVFSIQGRGTVATGRIEQGIVKAG
FT                   EDVELIGIVPTQKTTVTGVEMFKKSLTQGQAGDNCGLLLRGLKRDQVQRGQVLCKPGSI
FT                   TPHKKFEAEIYVLNKDEGGRHTPFFSNYRPQFFMRTADITGTITLPEGTEMVMPGDNIT
FT                   AVFELITPIALEKGLRFALREGGRTVGAGIVSKVLD"
FT   CDS_pept        join(1009931..1009987,1010087..1010779)
FT                   /codon_start=1
FT                   /gene_family="HOG000264981" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637423"
FT                   /orf_name="MICPUN_93725"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61849.1"
FT                   /db_xref="HOGENOM:HBG560258"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="UniParc:UPI000199A663"
FT                   /db_xref="UniProtKB/TrEMBL:C1E232"
FT                   /transl_table=1
FT                   /translation="MSQLESYATQTNVQKLSEEEKHKLVAEVMRYMLFSQYRDGAPVTR
FT                   TKLSEHLSKIAPELKRAKVSSYIVAEAQVKFNEIFGIEMKELSRKAQKKTGAARTNLQA
FT                   SEPTKEYVLKSLLPSKIRRQFIDREEDHTFRGFVMAVVALVSVSGGEIEEQVLWKHLAR
FT                   LGVRHDDEAHPKLGNVRDTLNKLCLQRYLMKEKGVGSDGKDTFRYSLAERAMDELPTEK
FT                   VDKYVTELMRGHNDEDGNAAGENGNTT"
FT   CDS_pept        1011884..1012333
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637424"
FT                   /orf_name="MICPUN_57093"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61850.1"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI000199A6D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E233"
FT                   /transl_table=1
FT                   /translation="MSSSDVKHLADPSSPGAGRFTFVIKGKPEPWTKFRKRASGEKDVP
FT                   EPENEAYVAYEIRFFIDPYELEPPKRKANTVGVERSNGTMMLWHTYVPESQRGKGIAEI
FT                   IVEEAMEWASANSLSVDSSCSYVNETFMKRPHNRQRWKHIMIRDY"
FT   CDS_