(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE1

MICSR_1.PE1          Location/Qualifiers
FT   CDS_pept        join(complement(1474..1486),complement(482..1239))
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636006"
FT                   /orf_name="MICPUN_99220"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62028.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199A9E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M8"
FT                   /transl_table=1
FT                   /translation="MARRTDELADGDRAAHLAENQLTSVPAEIGHLTSLERLELNHNEL
FT                   TRVPAEIGLLTSLRALSLSSNKLTSVPVEIGQLTSLTALFLGDNLLTRVPAEVGQLASL
FT                   EGLFLGDNRLTSVLAEIGQLTSLTELSLGNNQLTSLPAEIGRLTSLTALLLYDNQLTSV
FT                   PAEIGQLTSLVKLSLTENQLTSLPAEIGQLTSLTELYLYGNQLTSVPAEIGQLTSLVRL
FT                   YLGDNRLTSVPAAIRELRAAGCNVRMDNGVTVDE"
     atggcgcgga ggactgacga gcttgccgac ggagatcggg cagctcacct cgccgaaaat        60
     caactgacga gcgtgccggc ggagatcggg catctcacgt cgctggagag gttggagctc       120
     aaccacaatg agctgacgag agtgccagcg gagatcgggc tgctcacgtc gctgagggcg       180
     ttgtccctca gcagcaacaa gctgacgagc gtgccggtgg agatcgggca gcttacgtcg       240
     ctgacggcgt tgttcctcgg cgacaatctg ctgacgcgcg taccggcgga ggtcgggcag       300
     ctagcgtcgc tggaggggtt gttcctcggc gacaatcggc taacgagcgt gctggcggag       360
     atcgggcagc tcacgtcgct gacggagttg agccttggca ataatcagct gacgagcttg       420
     ccggcggaga tcgggcggct cacgtcgctg acagcgttgt tactctacga caatcagctg       480
     acgagcgtgc cggcagagat tgggcagctc acgtcgctgg tgaagctgag cctcaccgaa       540
     aatcagctga cgagcttgcc ggcggagatc gggcagctca cgtcgctgac ggagctgtac       600
     ctctacggca atcagctgac gagcgtgccg gcggagatcg ggcagctcac gtcgctggtg       660
     aggttgtatc tcggcgacaa tcggctgacg agcgtgccgg ctgcgatacg cgagctcaga       720
     gcggcgggct gcaatgtgcg catggataac ggcgtgacgg tggacgagtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page