(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE10

MICSR_1.PE10         Location/Qualifiers
FT   CDS_pept        21162..23291
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636015"
FT                   /orf_name="MICPUN_99225"
FT                   /product="Predicted protein"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /protein_id="ACO61589.1"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG559982"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI000199AA51"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N7"
FT                   /transl_table=1
FT                   /translation="MVETCAMVGCFAENCDNYLTVDLEPEDFSGGSTSRSSRATEPRER
FT                   VRVDVSRDMKRLRVFDGSSFEGPSPRSAKFKRRIARYFPGSATAADERLDAEARGVKEV
FT                   REAPASIEVVEEPDEPPFAEAATNDEPDEKPNAAKTGDEVEPVPYSSLAALDEGMARIM
FT                   KSNRKRSRDAQTLLKRAVKTKEIKFFNRIIKDFGNDKQMGFAEEAFRRIGDAGLSPTVY
FT                   SYTNLLNACVRVGELDRARKVWDDMIAAGVDPNEVTYTVLVKGLAQDGLLAEAARTVRD
FT                   MTAQSRAGVEGVAPNVRTFSTLLRNCVRHADPGVADECIAAMRDADVKPDVASFEYLLK
FT                   ARCAAMDAKGAWAVVDDMDREYLEVPPQAHAALATVSSLTGDVEKARSACEAARQAVKD
FT                   NGAGTVEDDGAGELFGSRGGYGSDSDEPKAANEQVKGRKKDKRHSQQQQQQQQQEEASK
FT                   SVQQFLKLRNSDALRQVEEVEKFLALGDDFVKEVAAVVNRGPESESSPVLIVEGAANVK
FT                   KPLCFKEVFGNDLPVRLEVCSGHGDWVTERAQRDEGKANWLALEMRRNRIRMTWAKAVR
FT                   RRLDNVALLCGMAHEMMGAHVPSGSLTEVYVNYPDPPEWVGSSQCLVDQAFLRDAHRSL
FT                   KPGVGHLTLVTDDPNYAMRMCRELSKVLRLFKPTEHGGKPFKSGVPEGYGGSYFDEMWK
FT                   NGRQNDRYYIRYKRV"
     atggtcgaaa cgtgcgccat ggttggttgc ttcgccgaga actgtgacaa ctacctgacg        60
     gtggacctag aacctgaaga ttttagcggc ggttccacca gtcgctcctc gcgcgcgacc       120
     gaaccccgcg agagggttcg agtcgacgtt tcgcgagaca tgaaaaggct cagggtgttc       180
     gacggctcct cgttcgaggg accgtctcct cggagcgcaa agttcaagcg tcgcatcgcc       240
     aggtatttcc caggaagcgc gaccgccgcc gacgagagat tggacgcgga agcgagaggg       300
     gtgaaggagg tcagggaggc tcccgcgagc attgaggttg tggaagagcc agatgaacct       360
     cccttcgccg aagcagccac gaacgatgag cccgacgaga aacccaacgc ggccaagacc       420
     ggtgatgagg tcgagcctgt cccgtacagc tccctcgccg ctctcgacga ggggatggcg       480
     aggatcatga agagcaaccg caagcgatcg agggacgcgc agacgctgct caagcgcgct       540
     gttaagacca aggagattaa attcttcaac cgtatcatca aagatttcgg caacgacaag       600
     cagatgggat tcgccgagga ggccttccgg cgcatcggtg acgcgggcct gtcgcccacg       660
     gtgtacagct acacgaacct tctcaacgcg tgcgttcgcg tcggcgagct ggacagggcg       720
     aggaaggttt gggacgacat gatcgccgcc ggcgtggatc ctaacgaagt tacgtacacc       780
     gtgctcgtca agggtctcgc gcaggacggg ctcctcgccg aggcggctcg gaccgtgcgc       840
     gacatgaccg ctcagtcccg cgccggcgtc gagggcgtcg ctccaaacgt tcggaccttc       900
     tccacgctcc ttcgaaactg cgtccggcac gcggatcccg gcgtcgctga cgagtgcatc       960
     gccgccatga gagatgcgga cgtcaaacct gacgtggcgt cgttcgagta ccttctcaag      1020
     gctcggtgcg cggcgatgga tgcgaaagga gcgtgggcgg ttgttgacga catggaccgg      1080
     gagtatctcg aggttccgcc ccaggcgcac gccgcgctcg cgaccgtgtc gagtttgacg      1140
     ggtgatgtag agaaggcgag atcggcgtgc gaggctgcgc gccaggcggt gaaggacaac      1200
     ggtgcgggga cggttgagga tgacggcgca ggcgagttgt ttgggtccag aggtgggtac      1260
     ggcagcgaca gcgacgagcc aaaggcagca aacgaacaag tcaaaggtcg caagaaagac      1320
     aaaaggcatt cgcagcagca gcagcagcag cagcagcagg aagaagcgag caagagcgtg      1380
     cagcagttcc tcaagttacg caacagcgac gcgctacgtc aagttgaaga ggttgagaag      1440
     ttcctcgcct tgggcgatga ttttgtcaag gaggtcgctg cggttgtcaa tcgaggaccg      1500
     gaaagcgagt cgtcacctgt gctgatagtg gagggtgctg caaatgtgaa gaagcctctc      1560
     tgtttcaaag aagtcttcgg gaatgaccta ccagtgcgct tggaggtttg tagcggacac      1620
     ggtgactggg tcacggagcg agcgcagagg gacgagggta aggctaactg gcttgcgttg      1680
     gagatgcgtc gaaacaggat caggatgacc tgggcaaagg ccgtgcgtcg aaggctggat      1740
     aacgttgcct tgctgtgcgg catggcccac gagatgatgg gcgcgcacgt gccaagcggt      1800
     tcactgacgg aggtgtatgt caactaccca gatccccctg agtgggtggg tagttcgcag      1860
     tgccttgtcg accaagcgtt tcttcgcgac gcgcaccggt ctctgaaacc aggtgttggt      1920
     cacctcacgc tcgtcaccga cgacccaaac tacgccatga gaatgtgcag agaactgagt      1980
     aaggttctaa ggctattcaa gcccacggaa cacgggggga agccgtttaa gagcggggta      2040
     cctgagggat acggaggatc ctactttgac gaaatgtgga aaaatggccg gcaaaacgat      2100
     agatactaca tccggtacaa gcgtgtctga                                       2130
//

If you have problems or comments...

PBIL Back to PBIL home page