(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE100

MICSR_1.PE100        Location/Qualifiers
FT   CDS_pept        join(194212..194274,194411..196180)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636105"
FT                   /orf_name="MICPUN_56673"
FT                   /product="Kinase/lysine decarboxylase "
FT                   /function="kinase activity"
FT                   /protein_id="ACO61633.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG559924"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199A6B6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X7"
FT                   /transl_table=1
FT                   /translation="MKDVDTPHVTPIKGYAADAGKRKRSLDGTPDASPPEVIALETLAV
FT                   IDHSCKVPDHFFKAGPGFKGEVGGSIRVDEETLQTMLVNVGEFSTKAGGSAANTARGLA
FT                   AGFDIRTSLISAVGKDEWGALFTSSMRRAGVDASKTVVRDDPEARTGRCVCLVDKTGQR
FT                   TMRPSFDDKHRLLPNEITPDMFEGSRWVVVNGYSYYSPGFLEAACDAASIAGCKVAMHL
FT                   ASFEIVRKFRPHLTSLLASGKVHVVFANEDEARELVGGGDASSESIETDTKIEAALAKL
FT                   AEWCDIAVVTLGDKGCVAMRDAERVDQKAFKGFDVKDTTGAGDLFSAGFMYGLLRNASL
FT                   ERCCELGCLSGAAVVQTMGAEISADGWTWVHAHMHEGRARSLVRGSAGAVQRELLACYE
FT                   LIESIGRGVVYYGSARLKADNPHFIRSRELGKMVSELLGTPTWTGGGPGMMEAASLGAM
FT                   DAGKAVAGIRIEREAGTKVRSAAQSYLKPEHTVFCKFLSPRKVALVDAGVRKKSEDRTA
FT                   YVFLPGGLGTMDELFELFTLYQLHKLGTDHPVPVIIVNYDGFYDCLLDFVNTMQGHGTV
FT                   GAGEYDQMVVKNTNDEVVDYLKQYYNIEGHDVAA"
     atgaaggacg tcgacacacc ccacgtcacc ccgataaagg gctacgccgc cgatgcgggc        60
     aagcgcaagc gaagcctcga cggcaccccc gacgcctctc cacccgaggt gatcgcgctc       120
     gagaccctcg cggtgatcga ccacagctgt aaggtccccg accacttctt caaggctgga       180
     ccggggttca agggcgaggt gggcgggtcg atccgcgtcg acgaggagac gctccagacg       240
     atgctcgtca acgtcggcga attctccacc aaagccggcg gatccgccgc gaacaccgcg       300
     cgcggactcg ccgcgggctt cgacatccga acctcactca tctccgccgt gggtaaggac       360
     gaatggggcg cgctcttcac gtcgtccatg cgcagagccg gggtggacgc gtctaaaacg       420
     gtggtccgag acgaccccga agcgagaacc ggacggtgcg tctgcctcgt cgataagacc       480
     ggccagcgaa cgatgcgacc gtcgttcgac gataaacacc gccttttacc gaacgagatc       540
     accccggaca tgttcgaagg ctcccggtgg gtcgtggtca acgggtactc ctattactcc       600
     ccgggctttc tcgaagccgc gtgcgacgcc gcgtccatcg cggggtgtaa agtagccatg       660
     cacctcgcgt cgttcgagat tgtgcgcaag ttccgcccac acctgacgtc tttattggcg       720
     tccggtaagg ttcacgtggt gttcgccaac gaggacgagg cgagggagct cgtcggcggc       780
     ggcgacgctt cgagcgagtc gatcgagacg gataccaaga tcgaggcggc gctggccaag       840
     ctggcggagt ggtgcgacat cgcggtggtg accctgggcg ataagggctg cgtggcgatg       900
     cgcgacgccg aacgcgtgga tcagaaggct ttcaagggat tcgacgtcaa ggacaccacg       960
     ggcgcgggcg acctgttcag cgcgggcttc atgtacggtt tgctgcgcaa cgcgtcgctg      1020
     gagcgctgct gcgagctcgg ttgcctgtcc ggcgcggcgg ttgttcagac gatgggcgcg      1080
     gagatcagcg cggacggttg gacgtgggtc cacgcgcaca tgcacgaggg ccgagcgcgt      1140
     tcgctcgtgc gcggtagcgc cggcgcggtg cagcgcgagc tgctcgcgtg ctacgagctc      1200
     atcgaatcca tcggccgcgg cgtggtttat tacggcagcg ctcgtctcaa agccgataac      1260
     ccccacttta ttcgctcgcg cgagctcggg aagatggtct cggagttgct cgggaccccc      1320
     acttggaccg gcggcgggcc ggggatgatg gaggcggcga gtttgggtgc gatggacgcc      1380
     ggcaaggcag tcgcgggcat ccgcatcgag cgtgaagccg gcacaaaggt acggtccgcc      1440
     gcgcagagct acctcaaacc ggagcacacc gtgttctgca agttcctctc ccctcgcaag      1500
     gttgcgctcg tcgacgcggg cgtccgcaag aagtcggagg atcgcaccgc gtacgtgttc      1560
     ctccccggcg gcctcggaac catggacgag ctcttcgagc tgttcacgct gtaccagctg      1620
     cacaagctcg gaaccgacca cccggtgccc gtgatcatcg tcaactacga cgggttctac      1680
     gattgcctcc tcgacttcgt gaacaccatg cagggacacg gcacggtggg cgcgggcgag      1740
     tacgatcaga tggtggtcaa gaacaccaac gacgaggtgg tcgactacct gaagcagtac      1800
     tacaacatcg aaggtcacga cgtcgccgcg tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page