(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE101

MICSR_1.PE101        Location/Qualifiers
FT   CDS_pept        complement(196297..196938)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636106"
FT                   /orf_name="MICPUN_56674"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62080.1"
FT                   /db_xref="UniParc:UPI000199A6B7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X8"
FT                   /transl_table=1
FT                   /translation="MAAAARVASSSGASSTSRPVPPRRRGRVAASAASTVATDAAQLAA
FT                   GVVAGAALLSIAWPLLERELRPIRCARCRGMGWTVCTNCKGRGKTGCPPLMYATVERRA
FT                   KMRRSTASDDADSEVPIDGSCDGVMIAGPPRSREDAPTCADPETEAAYAPGLVERLSYC
FT                   RECGGKGRCGCDACNRTGIENNWLYGPAANGGWGARGQWRDPANPPPPPP"
     atggccgccg cggcacgcgt cgcgtcgagc tctggggcgt cgtccacgtc gcgcccggtc        60
     ccaccgagac gacgcggtcg cgtcgccgcg tccgcggcgt ccacggtcgc gacggatgcg       120
     gcgcagctgg cggccggcgt cgtcgcgggc gcggcgctcc tgtccatcgc gtggccgctt       180
     ctggagcgcg agctcaggcc gatacgatgc gcgaggtgcc gggggatggg gtggacagtc       240
     tgcaccaact gcaagggcag gggtaagacg ggatgcccgc cgctgatgta cgccaccgtc       300
     gagcgccgcg cgaagatgcg tcgatcgacg gcgagcgacg atgcggactc ggaggtgccg       360
     atcgacggga gctgcgacgg ggtcatgatc gccggtccgc cccggtcgag ggaggacgcg       420
     ccgacctgcg ccgaccccga gactgaggcg gcgtacgcgc cggggttggt cgagaggctg       480
     agctactgca gggaatgcgg gggcaaaggg cggtgcgggt gcgacgcgtg caaccgaacg       540
     ggaatcgaga acaactggct gtacggtcca gcggcgaatg gcgggtgggg ggcgaggggg       600
     cagtggcgcg accccgcgaa cccgcccccg cccccgccgt ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page