(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE102

MICSR_1.PE102        Location/Qualifiers
FT   CDS_pept        197061..200516
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636107"
FT                   /orf_name="MICPUN_56675"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /protein_id="ACO61634.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="UniParc:UPI000199A6B8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X9"
FT                   /transl_table=1
FT                   /translation="MGDEQEKWRRALLKKLRGAAGVKARIDAGDGASLQRSQLARGTAS
FT                   AVADLVARCVEAGLARDGPEIAAALAAGADGGIVAMAAANARGPDGEPGARARRKRERA
FT                   AALAAASSQSGGGGGGGEDAKRTRLDDGDRARGSKRASGECKRATWALHALAKAPDADP
FT                   ASVAVTAKALTAVLRDSKRDAASMDALLASVALYAAAKLRSSALIAEGATDAASDARRE
FT                   LRVCASRVAARVDAQLCARVDARGASNALWALATLASSRGEAGVGERERHAATRALVGA
FT                   LSTRVELRAAFNARDAANALWGCAKARVGLSDEATTQLASAVSGSAPGSAPGSAPGSAP
FT                   PGERGANAVEASMALWALASMRGDGTIGAHVARLAATGVVRRLAECAVKVGPTSTTEVD
FT                   QHRVVANASWAAAKLSERVVSGGGGGDTAGDDPAKMDSEFDAVATGLLRRFASAAVEAG
FT                   PAFQLESPRAAAQLVAALRPSLLDAACGGGGADGVPSADDVAAMTILTHRGLRSCFARG
FT                   REEMEKEARGTRRTSANGAHDVVRKYPESIQKPSSDDLAAFCDAAEALSGFGVVVDAGY
FT                   FRSAVAAACTGGPTALGWRAAGRLEHCVFSVLGLGPVAATVTARGSGSHRGRRGGAAER
FT                   APSADDVAAAERLLRRGAAAAEAANDTRLAMETAAADVLLAVPGPDGPVASGGGGGGRM
FT                   LCVDDTHRLLSRMLRERGGWSVTNWNRFSRKDRRGAPRPPAGAFDAATVRLPPTKAAFA
FT                   MALVAVAARLRAGAVAWIYGADREGVRGCEFDLPDGSFEDVRVVHSCASGGGGGVEGFD
FT                   RGAHVEDSVGSFSVLRCVRTDKPFGVSGSGNPAGGGATQLATRSTTPNRDEDLLEGFKK
FT                   VGRLDVRLGDDVHAFERWVTYPGLFAGGGLDVMTAFLLETMTRSSDGWLGSALRGTPEG
FT                   RGGKEGEFSALDFCSGSGTLAACVRRLAPSARLTLLDADAVAMLAARENLSLPSGSSGA
FT                   SVLDSSEPDGSSPRSVHLPAAFALGDGWTGLSSDERFDLIVSNPPVHLGLRPEFTVLKS
FT                   MCAGFDARLKPGGEAWFVAQRYVPVAGICAGIGGLAAKVARVCANDKFAVWSVRKPPGA
FT                   GREDGSLERKAAKKAKKEKKEKSGGKKEKSGKKEKKEKKEKKYS"
     atgggggacg agcaggagaa gtggcgcagg gcgctcctca agaagctgcg cggcgccgcg        60
     ggggtcaagg cgcgcatcga cgcgggcgac ggcgcgagcc tgcagaggtc gcagctcgcg       120
     agagggaccg catcggcggt ggcggatctg gtcgcgcggt gcgtcgaggc ggggctcgcg       180
     cgcgatggac cggagatcgc cgcggcgctg gcggcggggg ccgacggggg catcgtcgcg       240
     atggcggccg cgaacgccag gggtcccgac ggggaacccg gcgcgcgggc gcggcggaag       300
     cgcgaacgcg ccgcggcact cgcggcggca tcatcccaga gcggcggcgg cggcggcggc       360
     ggcgaggacg ccaagcgaac gaggctcgac gacggcgacc gcgcgcgcgg atccaagcgc       420
     gcgagcggcg agtgcaagcg cgccacctgg gcgctccacg ccctcgccaa ggcgcccgac       480
     gccgacccgg catccgtcgc ggtcaccgcg aaggcgctca cagctgtgtt gcgagattcg       540
     aagcgcgacg cggcgtcgat ggacgcgttg ctcgcgtccg tcgcgctgta cgccgccgcg       600
     aagctccggt cgagcgcgct catcgcggaa ggtgcgaccg acgccgcctc cgacgcgaga       660
     cgcgagctgc gcgtgtgcgc cagccgcgtc gccgcgcggg tggacgcaca gctgtgcgcg       720
     cgagtcgacg cgaggggcgc gtcgaacgcg ctgtgggcgc tggcgacgct ggcgtcgtcg       780
     cgaggggaag ccggcgtcgg ggaacgcgag cgccacgccg cgacgcgggc gctcgtcggg       840
     gcgctgtcga cgcgggttga gttgagggcg gcgttcaacg cgcgggacgc ggcgaacgcg       900
     ctgtggggat gcgccaaggc gcgggtcgga ttgtccgacg aagcgacgac acagctggct       960
     agcgccgtat ccgggtcggc acccgggtcg gcacccgggt cggcacccgg gtcggcaccc      1020
     cccggcgaac gcggagccaa cgcggtcgag gcgtccatgg cgctgtgggc gctcgcgtcg      1080
     atgcgagggg acgggacgat tggcgcacac gtggcgcgtc tcgcggcgac gggcgtcgtt      1140
     cggagactcg ccgagtgcgc ggttaaagtc ggtccgacgt cgacgacaga ggtggatcaa      1200
     caccgggtcg tcgccaacgc gtcgtgggcg gcggcgaagt tatcggagcg cgttgtatcg      1260
     ggcggcggcg gcggcgacac agctggcgac gatccggcga agatggactc ggagtttgac      1320
     gcggtcgcga cgggcctgtt gcgacggttc gcatccgccg cggttgaagc cggaccggcg      1380
     ttccagctcg agtcgccgcg cgccgccgcg cagctcgtcg ccgcgctccg tccctcgctg      1440
     ctcgacgcgg cgtgcggagg ggggggtgcc gatggggtgc cgagcgcgga tgacgtcgcc      1500
     gcgatgacga tcctcacgca ccggggtttg cgatcgtgct tcgccagggg gcgcgaggag      1560
     atggagaagg aggcgagggg gacgaggcgg acgtccgcga acggcgcaca cgacgtcgtt      1620
     cgtaagtatc cggaaagtat ccagaaaccc tcgtcggacg acctcgccgc gttttgcgac      1680
     gccgcggagg cgctcagcgg cttcggcgtc gtcgtcgacg cgggatactt tcggtcggcg      1740
     gtggctgcgg cgtgcacggg gggaccgacc gcgctgggtt ggcgcgccgc ggggaggctg      1800
     gagcactgcg tcttctcggt gctcggcctc ggccccgtcg cggcgaccgt gaccgcgcgg      1860
     gggagtggat cccatcgggg acgccgaggg ggtgctgccg agagggcgcc gagcgcggat      1920
     gacgtcgccg ccgccgagcg actccttcgc cggggcgccg ccgcggcgga ggcggcgaac      1980
     gataccaggc tggcgatgga gacggcggcc gcggacgtgc ttctcgcggt gcccggcccg      2040
     gacggccccg tcgcatccgg cggcggcggc ggcgggcgca tgctctgcgt cgatgatacg      2100
     caccgtttac tgtctcgaat gcttcgcgaa cgcggcgggt ggagcgtgac gaattggaac      2160
     agattctcga ggaaggaccg gcggggcgcg ccgcggccgc cggcgggcgc gttcgacgcc      2220
     gcgacggttc gtcttccccc gacgaaggct gcgttcgcca tggccttagt cgcggtcgcg      2280
     gcgaggcttc gcgccggggc cgtcgcgtgg atctacggcg cggatcgaga gggcgtccgc      2340
     gggtgcgagt tcgatttgcc ggacggatcg ttcgaggacg ttcgggtcgt tcacagctgt      2400
     gcgagcggcg gcggcggcgg ggtcgagggc ttcgaccgcg gcgcgcacgt cgaggactcc      2460
     gtcggatcgt tctcggtgct gcgatgcgtg cggacggata agccgttcgg ggtttcgggg      2520
     agtgggaacc cggcgggagg cggggcgaca cagctggcga cgaggtcgac gactcccaac      2580
     agggacgagg accttctcga aggtttcaaa aaagtcggta ggttagacgt gcgactcggc      2640
     gatgacgtcc acgcgtttga acggtgggtg acctaccccg ggctgttcgc gggcggtggt      2700
     ttggacgtga tgaccgcgtt tttgctcgag acgatgacgc gctcgagcga cggatggttg      2760
     ggttcagcgc tgaggggaac gccggaaggg agaggcggga aggaggggga gttttcggcg      2820
     ctggactttt gctcggggtc cgggacgctc gccgcgtgcg ttcgccggct cgcgccctcc      2880
     gcgcgtctca ccctgctgga cgcggacgcc gtcgcgatgc tcgccgcgag ggagaacctc      2940
     tccctcccct ctggttcgag cggcgcttcg gtgctcgatt cgtcggaacc cgacggttca      3000
     tctccgaggt cggttcatct tcccgccgcg ttcgcgctcg gcgacgggtg gaccggtttg      3060
     tcgtccgacg agcgcttcga cttgatcgtc tccaacccgc cggtgcacct cggactgagg      3120
     ccggagttca ccgtgcttaa atcgatgtgc gcggggttcg acgcgaggct caagcccggg      3180
     ggcgaggcgt ggttcgtggc gcagaggtac gtgccggtgg cggggatctg cgccgggatc      3240
     gggggtttgg cggcgaaggt cgcgcgagtt tgcgccaacg acaagtttgc ggtgtggtcg      3300
     gtgcgcaagc cgcccggcgc cggaagggaa gacggatctt tggagaggaa agctgcgaag      3360
     aaggcgaaga aggagaagaa ggagaagagc ggcggcaaga aggagaagag cggcaagaag      3420
     gagaagaagg agaagaagga gaagaagtac tcatag                                3456
//

If you have problems or comments...

PBIL Back to PBIL home page