(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE103

MICSR_1.PE103        Location/Qualifiers
FT   CDS_pept        join(complement(201013..201168),complement(200575..200907))
FT                   /codon_start=1
FT                   /gene_family="HOG000192807" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636108"
FT                   /orf_name="MICPUN_79960"
FT                   /product="Glycosyltransferase family 1 protein "
FT                   /function="carbohydrate binding"
FT                   /function="transferase activity, transferring hexosyl
FT                   groups"
FT                   /biological_process="lipid glycosylation"
FT                   /protein_id="ACO62081.1"
FT                   /db_xref="GO:0016758"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="GO:0030259"
FT                   /db_xref="HOGENOM:HBG629711"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniParc:UPI000199A6B9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y0"
FT                   /transl_table=1
FT                   /translation="MPKKRKSVFVTVGTTQFDSLIEALDTPECADALRGNGYGSVVIQR
FT                   GKGTRELPTPLEVRVFDFAPSLADEMLAADLVVSHAGSGSVFEALGMRKPLLVVVNDAL
FT                   MDNHQAELAEELGKRGHLRWCESGGLANAIATFDPRGLTPYEPGDPSGIARALDDALA"
     atgccgaaga agcggaagag cgtcttcgtc acggtgggca cgacccaatt cgactccctc        60
     atcgaggcgc tcgacacccc ggagtgcgcc gacgcgctcc gcggaaacgg atacggcagc       120
     gtggtgatcc agcgaggcaa gggcacgcgc gagctcccga cgccgttgga ggtgcgcgtc       180
     ttcgacttcg cgccgtccct cgccgacgag atgctcgccg cggacctggt cgtctcgcac       240
     gcgggttccg gcagcgtgtt cgaagcgctg ggcatgcgca agcccctcct ggtggtggtc       300
     aacgacgcgc tcatggacaa tcaccaggct gagctggcgg aggaactggg caagcggggg       360
     cacctgcggt ggtgcgaatc cggcgggctg gcgaacgcga tcgcgacgtt cgacccgcgg       420
     gggttgacgc cgtacgagcc gggggatccg agcggcatag cgagggcgct cgacgacgcg       480
     ctcgcgtga                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page