(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE104

MICSR_1.PE104        Location/Qualifiers
FT   CDS_pept        join(complement(202032..202093),complement(201432..201804))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636109"
FT                   /orf_name="MICPUN_56677"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62082.1"
FT                   /db_xref="UniParc:UPI000199A6BA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y1"
FT                   /transl_table=1
FT                   /translation="MIAAAHTVTVRPAAALSARRGLAGSSLRTAAKPPARAALRVRSTA
FT                   TRAEGIVDDVMADIKKKIADNKEKLERAKIVASPPGVPPPPVVPILEPGKIGFVENAER
FT                   QNSRWSMVGWWSLLLVELVAGKGLLEIMGFTVGKGINFTF"
     atgatcgccg ccgctcacac cgtcaccgtg cgacccgccg ccgcgctctc cgcccgccga        60
     gggctcgccg gctccagcct tcgcaccgcc gcgaagcctc ccgcgcgcgc cgcgctcagg       120
     gtccggtcca ccgccacccg cgcggagggc atcgtcgacg acgtcatggc cgacatcaag       180
     aagaagatcg ccgacaacaa ggagaagctc gagcgcgcca agatcgtcgc gtccccgccc       240
     ggcgtgcccc cgccgcccgt cgtgcccatc ctcgagcccg gcaagattgg cttcgtggag       300
     aacgcggaga ggcaaaactc gaggtggagc atggtcgggt ggtggtcgct gctgctcgtc       360
     gagctcgtcg cggggaaggg gctcctggag atcatgggat tcaccgtcgg taagggcatc       420
     aacttcacct tctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page