(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE105

MICSR_1.PE105        Location/Qualifiers
FT   CDS_pept        join(202395..203186,203277..203588)
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636110"
FT                   /orf_name="MICPUN_97114"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61635.1"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199A6BB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y2"
FT                   /transl_table=1
FT                   /translation="MSASAPFGSAKRTEELLSLSFNQDSGCFACGTDGGFRIYNCDPFK
FT                   ETFRRRFDSGGIGQVEMLFRCNILALVGGGRSPRFSPNKVMIWDDHQSRCIGELSFRVE
FT                   VRAVRLRRDRVVVVLEHKIYVYNFADLKILHQTDTVANPLGLCALSPTQDSTVMACPGL
FT                   NKGQVRVELYDLGVTKFISAHDGELAQLQLTLDGALLATASEKGTLIRVYDTASATLMH
FT                   EFRRGADRATVYSIAFAPGKDFLAVSSDKGTVHVYVVPERASGSNQEGGVVDAKAAFSF
FT                   VKGFLPKYFSSEWSLAQFKLPDFTRSLVAFGPEPNTLIVVTVEGTYYKVGFDPKSGGAC
FT                   AQVAFSRFLKTAEEEEEGGWGAVRDVR"
     atgagcgctt cggcaccgtt cggctccgca aaacgcacag aggaactcct ctcgctgtcc        60
     ttcaaccagg acagcggctg cttcgcgtgc ggcaccgacg ggggcttccg catctacaac       120
     tgcgacccat tcaaggaaac cttccgcagg cgcttcgaca gcggcgggat cgggcaggtc       180
     gagatgctct tccgctgcaa catcctcgcg ctcgtgggcg gcgggcgatc gccgagattt       240
     tccccgaaca aggtgatgat ctgggacgac caccagagca ggtgcatcgg cgagctctcc       300
     ttccgcgtcg aggtacgggc ggtgcgactg cgccgagatc gcgtcgtcgt ggtcctggag       360
     cacaagatct acgtctacaa cttcgccgac ctcaagatcc tgcaccagac cgacaccgtc       420
     gccaacccgc tcggcctgtg cgccctatcc ccgacgcagg acagcaccgt catggcgtgc       480
     ccgggcctga acaaaggcca agtcagagtc gaactctacg acttgggcgt caccaaattc       540
     atctcggcgc acgacggcga actcgcgcag ctgcaactca ccctggacgg cgccctgctc       600
     gcgaccgcct cggagaaggg gacgctcata cgcgtctacg acacggcgag cgcgacgctg       660
     atgcacgagt tccgcagggg cgcggaccgc gccaccgtct actccatcgc gtttgcgccg       720
     ggcaaagact ttttggcggt gagctcggac aagggcaccg tgcacgtcta cgtcgtgccg       780
     gaacgggcga gcggctccaa tcaggagggc ggcgtcgtcg acgcgaaagc cgcgttctcc       840
     tttgtcaagg gtttcctccc caagtacttc agcagcgagt ggagtctggc gcagttcaag       900
     ctgccggact tcacgaggtc cttggtggcg ttcggaccgg agcccaacac cctgatcgtc       960
     gtcaccgtgg aggggacgta ttacaaggtg ggattcgatc cgaagagcgg cggcgcctgc      1020
     gcgcaagtcg cgttttcgcg atttttgaag actgcggagg aggaggagga ggggggttgg      1080
     ggcgcggttc gggacgtgag gtga                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page