(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE106

MICSR_1.PE106        Location/Qualifiers
FT   CDS_pept        <205043..>205345
FT                   /codon_start=1
FT                   /gene_family="HOG000199425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636111"
FT                   /orf_name="MICPUN_77080"
FT                   /product="Predicted protein"
FT                   /function="two-component sensor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="ACO61636.1"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG640751"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI000199A6BC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y3"
FT                   /transl_table=1
FT                   /translation="HALCVADATAKDQPIVFANDNFFVQTGYPPEEVLGRNCRFLQGPG
FT                   TDRETVRAMREAIAKGKEFHGRLMNYHKNGTSLVNSLVMSPLRDEKGVVTHFIGIQ"
     cacgcgctgt gcgtcgccga cgccaccgcg aaggaccagc ccatcgtctt cgccaacgat        60
     aacttcttcg tgcagacggg gtatcccccg gaggaggtgc tggggcgcaa ctgcaggttc       120
     ctgcagggac cggggacgga cagggagacg gtcagggcca tgcgcgaggc gatcgcgaaa       180
     ggtaaggagt tccacgggcg gctcatgaac tatcacaaga acgggacgag tctcgtcaac       240
     tcgttggtca tgtcgccgct tcgggacgag aagggagttg tgacccactt catcggcata       300
     cag                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page