(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE107

MICSR_1.PE107        Location/Qualifiers
FT   CDS_pept        join(complement(207101..207409),complement(205666..206670))
FT                   /codon_start=1
FT                   /gene_family="HOG000227107" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636112"
FT                   /gene_name="PGK_1"
FT                   /orf_name="MICPUN_104767"
FT                   /product="Phosphoglycerate kinase "
FT                   /function="phosphoglycerate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62083.1"
FT                   /db_xref="GO:0004618"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="HOGENOM:HBG453500"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015901"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="UniParc:UPI000199A6BD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y4"
FT                   /transl_table=1
FT                   /translation="MAAFAAAPALSARAFFAKSSVRAKKTSVRAQARAALKVEAKKKSV
FT                   GDLKKADLEGKTVFVRCDLNVPLDKDLKITDDTRIRAAIPTLEYLVENGAKVLVTSHLG
FT                   RPKDGPEDKFRLTPVGARLSELLSCSVSKVDDCVGDVVKDAVGGMANGSVCLLENVRFY
FT                   KDEEKNGKDFAKQLSEYADLYVNDAFGTAHRAHASTAGVTEFLSPSVAGFLLQKELDYL
FT                   DGAVSNPDRPFCAIVGGSKVSSKIGVIETLLNKADKVILGGGMIFTFYKALGKDVGSSL
FT                   VEDDKIDLAKELMAKAEEKGVKLLLPTDVVVADAFAADAKTQTVSVDAIPDGWMGLDIG
FT                   PDSVKEFQKELNECKSVIWNGPMGVFEMDAFAKGTFAIADTLANLDGITIIGGGDSVAA
FT                   VEKAGLADKMSHISTGGGASLELLEGKVLPGVDALDEA"
     atggccgctt tcgccgctgc ccccgccctc tccgcccgcg cgttcttcgc caagtcctcc        60
     gtgagggcca agaagacctc cgtccgcgcc caggctcgcg ccgcgctcaa ggtcgaggcg       120
     aagaagaagt ccgtcggcga cctcaagaag gctgacctcg agggcaagac cgtgttcgtg       180
     cgctgcgacc tcaacgtgcc cctcgacaag gatctcaaga tcaccgacga cacccgcatc       240
     cgcgccgcca tccccaccct cgagtacctc gtcgagaacg gcgccaaggt cctcgtcacc       300
     tcccacctgg gtcgccccaa ggatggcccc gaggacaagt tccgcctcac ccccgtcggc       360
     gcgcgcctct ccgagctcct ctcctgctcc gtgtccaagg ttgacgactg cgtcggcgac       420
     gtcgtcaagg atgccgtcgg cggcatggcc aacggctccg tctgcctcct cgagaacgtc       480
     cgcttctaca aggacgagga gaagaacggc aaggacttcg ccaagcagct ctccgagtac       540
     gccgacctct acgtgaacga cgccttcggc accgcgcatc gcgcgcacgc gtccaccgcg       600
     ggtgtcaccg agttcctctc cccgtccgtc gcgggtttcc tcctccagaa ggagctcgac       660
     tacctcgacg gcgccgtgtc caaccccgac cgccccttct gcgcgatcgt cggtgggtcc       720
     aaggtgtcct ccaagattgg cgtcatcgag accctcctca acaaggctga caaggtgatc       780
     ctcggcggcg gcatgatctt caccttctac aaggcgctcg gcaaggatgt cggctcctcc       840
     ctcgtcgagg acgacaagat cgacctcgcc aaggagctca tggccaaggc tgaggagaag       900
     ggcgtcaagc tcctcctccc caccgacgtc gtcgtcgccg acgcctttgc cgccgacgcc       960
     aagacccaga ccgtctccgt cgacgccatc cccgacggct ggatgggtct cgacatcggc      1020
     cccgactccg tgaaggagtt ccagaaggag ctcaacgagt gcaagtccgt catctggaac      1080
     ggtcccatgg gcgtgttcga gatggacgcc ttcgccaagg gcaccttcgc gatcgccgat      1140
     accctcgcca acctcgatgg catcaccatc atcggcggcg gcgactccgt cgcggctgtc      1200
     gagaaggccg gcctcgccga caagatgtcc cacatctcca ccggcggcgg cgcctccctc      1260
     gagctcctcg agggcaaggt gctccccggc gtcgacgccc tcgatgaggc gtaa            1314
//

If you have problems or comments...

PBIL Back to PBIL home page