(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE108

MICSR_1.PE108        Location/Qualifiers
FT   CDS_pept        208031..208795
FT                   /codon_start=1
FT                   /gene_family="HOG000264521" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636113"
FT                   /orf_name="MICPUN_99290"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61637.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG701377"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI000199A6BE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y5"
FT                   /transl_table=1
FT                   /translation="MIEYVTRGEWYDGEIRRFVRIDNENPPRKRGVLFVGSSIFREWRE
FT                   ARDFAADVAPLGADCLNRAFGGSTTRDQLDVMEQIVFPHDPKVLVYYCGSNDVNAGVPP
FT                   RVIRDNFLEWCARAFSRCPSARRILFVSIMRAPQKAPVWDALDEANALIREACGEEGEE
FT                   GRRGLKRVSFVDVNPLLRDASTLEPLAQLYRDDGLHFHPSSYDRFAPAIVDAARRALDE
FT                   CGDSVGRGGTGVRGGESSEAPYDPALPPSLGR"
     atgatcgagt acgtcacgag gggcgagtgg tacgacggcg agatccgacg gttcgtccgc        60
     atcgacaacg agaacccgcc tcgcaagcgc ggcgtcctct tcgtgggctc ctccatcttc       120
     cgcgagtgga gggaagctcg cgatttcgcc gccgacgtcg cgcccctcgg cgcggactgc       180
     ctgaaccggg cgttcggagg ttccacgacg cgcgaccagc tggacgtcat ggagcagatc       240
     gtgtttcccc acgatccgaa ggtgctcgtc tactactgcg gcagcaacga cgtcaacgcg       300
     ggagtcccgc cgcgcgtcat ccgcgacaac ttcctcgagt ggtgcgcgcg tgcgttttcg       360
     cggtgcccga gcgcgaggcg aatcttgttc gtgtcaatca tgcgagcccc gcagaaggcg       420
     ccggtgtggg acgcactcga cgaggcgaac gcgctgatcc gagaggcgtg cggcgaggag       480
     ggggaagaag gacggcgagg gctcaaacgc gtgagctttg tcgacgtcaa cccgctgctt       540
     cgcgacgcgt ccacgctcga gccgcttgca cagctgtaca gggacgacgg gctgcacttc       600
     cacccgagtt cgtacgaccg cttcgcgccg gcgatcgtgg acgcggcgcg acgggcgctg       660
     gacgagtgcg gggattcggt ggggcggggg ggaaccgggg tgcgtggggg cgaatcgtcg       720
     gaggcgccgt atgaccccgc gctgccgccg agcctcggac gatga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page