(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE109

MICSR_1.PE109        Location/Qualifiers
FT   CDS_pept        complement(208827..209576)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636114"
FT                   /orf_name="MICPUN_56682"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62084.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI000199A6BF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y6"
FT                   /transl_table=1
FT                   /translation="MARSECLYDLLGVADDATDDELKRAYRDAARLHHPDVNPDAEPGR
FT                   FSAVSSAYDVLRDPNKRRAYDATRAWERGVDGGGAGVRTPGATHATWGGFEEYAKGFAE
FT                   RYHRAHATETEWQRRERMAKAAAERAEMEKEFWIQEKARARHMAVEYRRRAAALKHSRA
FT                   LRHEATIGGFWFSKKGWLPMDFVALFTALAFAGGSAHVWKESGRRKFEARGGRAAGEGE
FT                   ETPVVGAVDPKVEVAAAAVKEGETRHR"
     atggcgaggt cggagtgcct ctacgacctc ctcggcgtcg ccgacgacgc caccgacgac        60
     gagctcaagc gcgcgtacag ggacgccgcg cgcctccacc accccgacgt caatcccgac       120
     gcggagcccg gcaggttcag cgccgtgtcc tccgcctatg acgtcctgcg cgatccaaac       180
     aaacgcaggg cgtacgatgc cacccgcgcg tgggaacgcg gcgtcgacgg cggcggcgcc       240
     ggggttcgaa cccccggcgc gacacacgcg acgtggggag ggttcgagga gtacgccaaa       300
     gggttcgcgg agcggtacca ccgcgcacac gcgacggaga cggagtggca acgacgggaa       360
     cggatggcga aagccgcggc ggaacgagcg gagatggaga aagagttttg gatccaggag       420
     aaggcgcggg cgagacacat ggcggtggag tacaggagac gcgcggcggc gttaaaacac       480
     tcgagggcgt tgcggcacga ggcgacgatc ggtgggtttt ggttctcgaa gaaaggatgg       540
     ctgccgatgg atttcgtcgc tttgttcacc gcgctcgcgt ttgcgggggg atcggcgcac       600
     gtgtggaaag agtcggggcg gcgcaagttc gaggcacgag gagggcgggc ggcgggagag       660
     ggagaggaga cgccggtggt aggtgccgtg gatcccaagg tggaggtggc ggcggcggcg       720
     gtgaaggagg gagagacgcg ccatcgatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page