(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE11

MICSR_1.PE11         Location/Qualifiers
FT   CDS_pept        complement(23336..24058)
FT                   /codon_start=1
FT                   /gene_family="HOG000100014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636016"
FT                   /orf_name="MICPUN_107846"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62034.1"
FT                   /db_xref="HOGENOM:HBG559987"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI000199AA52"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N8"
FT                   /transl_table=1
FT                   /translation="MATADRNLTFYTHSLCPYAHRVSLCLAEKAIPHKREHIDLSNKPR
FT                   WYLDLNRRGLVPAIQLDGEVKTESLELNYFLDDVFEGAARLTPDGRKEEMQTLIDSFDG
FT                   SFISAGLQFVGGGWGFRRGAPGPRQADRMAVECERIERIIEINGNGGPYLMGAEVTLAD
FT                   LALWPFAERYELAMREFQGVELREMGPSGSLSRWIDAMRSRPSVVGLRPDDNKLLASWR
FT                   RTMRLDYFDYETADVDNP"
     atggcaactg ccgatcggaa cctgaccttc tacacgcact cgctttgtcc ctacgcgcac        60
     agggtgagcc tgtgtctggc ggagaaggcg atacctcata aacgcgagca tatcgacctg       120
     tcaaataaac cacgatggta cctggacctg aaccgacgtg ggctggtgcc ggcgatacag       180
     ctcgacggcg aggtcaagac ggagtcactg gagctgaatt acttcctcga cgacgtgttt       240
     gagggagcag cgagattgac cccggatggt agaaaggaag agatgcaaac gctgatcgat       300
     tcattcgatg gctcatttat cagtgcgggg cttcagttcg tcggcggcgg atggggattc       360
     aggaggggcg ccccgggtcc taggcaagcg gacaggatgg cagtggagtg tgagagaatc       420
     gaacgcatca tcgaaatcaa cgggaacggt ggtccatatc tgatgggtgc cgaggtcact       480
     ctcgcggact tggcgctttg gccgttcgca gagcgttatg agctcgccat gagggagttc       540
     cagggcgtgg agctgaggga aatgggtccg agtggctcgc taagtcgatg gattgacgcc       600
     atgagatctc ggccgtcggt tgttggactc aggccagacg ataacaagct gctggcgtcg       660
     tggcgacgaa ccatgcggct ggactacttc gattacgaga ccgcggatgt agacaacccg       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page