(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE110

MICSR_1.PE110        Location/Qualifiers
FT   CDS_pept        210593..211957
FT                   /codon_start=1
FT                   /gene_family="HOG000036730" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636115"
FT                   /orf_name="MICPUN_80233"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61638.1"
FT                   /db_xref="HOGENOM:HBG630213"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI000199A6C0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y7"
FT                   /transl_table=1
FT                   /translation="MTKPNRREEGGAPIRPAVWRPGVDGMDADEELEYDPSVYDCLHAW
FT                   QLDWPCLSFDILRDELGDTRERFPHSLFAIAGTQADVATKNHLTMMRLTRLKKTRRVDK
FT                   AAADMDDDSDASESDSDDEDGGIAPINGPIIQVQKVAHHGAVNRVRACPHRPSLVATWG
FT                   ETGVVQVWDLAPQLTKLSMLTADARDAQAAMNVQPQRSAPRHAFTGHADEGYAMDWSPT
FT                   VDARLATGDNAGGIHVWEPREGGRWAVDKTAVFKGHESSVEDLQWSPAEAQVFASCGAD
FT                   GYVCVWDARNANAAPALRVKTHECDVNVMSWNRVANCMLATGADDGSLRIWDLRMFSPS
FT                   DAKHVANFSFHRGPVTSVEWSRFDSAMLATASADHTVCVWDLAVERDAEEEAAAMAAED
FT                   NAMAPEDLPPQLMFVHQGLKDPKELHWHHQIPGLCLTTAADGFNAFKAYNVGPGC"
     atgaccaaac caaaccgcag ggaggagggc ggcgctccga tccgacccgc ggtgtggcgg        60
     cccggcgtcg acggcatgga cgccgacgag gagctcgagt acgacccgag tgtctacgac       120
     tgcctgcacg cgtggcagct ggactggccg tgcctctcct tcgacatctt gcgcgacgag       180
     ctgggcgaca cgcgagagcg gtttccccac tcgctcttcg caatcgccgg cacccaggct       240
     gacgtcgcga ctaagaacca cctcacgatg atgcgtctga cccggctcaa gaagaccaga       300
     cgcgtggaca aggccgctgc cgacatggac gacgacagcg acgcgagcga gtcggattcc       360
     gacgacgaag acggcgggat cgccccgatc aacgggccga tcatccaggt gcaaaaggtg       420
     gcgcaccacg gcgcggtgaa ccgcgttcgc gcgtgcccgc acaggccctc tttggtcgcc       480
     acgtggggag aaaccggcgt ggtgcaggtt tgggacctcg ccccccagct caccaagctc       540
     tcgatgctca ccgccgacgc cagggacgcg caagccgcga tgaacgtgca gccccagcga       600
     tcggcgcccc gccacgcctt caccggacat gccgacgagg ggtacgcgat ggactggtcc       660
     ccgaccgtgg acgcgaggct cgcgacgggg gacaacgcgg gcgggatcca cgtgtgggaa       720
     cccagagagg gtggacggtg ggcggtggac aaaaccgccg tcttcaaagg ccacgagagc       780
     tccgtggagg atctgcagtg gtccccggcg gaggcgcagg ttttcgcgtc gtgcggcgcc       840
     gacggctacg tatgcgtatg ggacgctcga aacgcgaacg ccgcgcccgc gctgagggtc       900
     aagacgcacg agtgtgacgt caacgtcatg agctggaacc gcgtggcgaa ctgcatgctc       960
     gcgacgggcg ccgacgacgg gtcgcttcgc atatgggacc ttcgaatgtt ctcgccgagc      1020
     gacgccaagc acgtggcaaa cttttcgttt caccgagggc ccgtgacgtc cgtcgagtgg      1080
     tcgcggttcg atagcgcgat gctcgccacg gcctcggccg atcacaccgt gtgcgtctgg      1140
     gatctcgcgg tggagaggga cgcggaggag gaggcggcgg cgatggcggc cgaggacaac      1200
     gcgatggcgc cggaggatct gcccccgcag ctgatgttcg tgcaccaagg tttgaaggac      1260
     ccgaaggagc tgcactggca ccaccagatc ccggggctgt gcctgaccac ggcggcggac      1320
     gggttcaacg cgttcaaggc gtacaacgtc ggcccggggt gttag                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page