(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE111

MICSR_1.PE111        Location/Qualifiers
FT   CDS_pept        212151..213002
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636116"
FT                   /orf_name="MICPUN_107868"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61639.1"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniParc:UPI000199A6C1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y8"
FT                   /transl_table=1
FT                   /translation="MASAAGAPAALAARLPRARGCRGARRGVRRVRVSAESPGGREELS
FT                   RPSPPEKFMRFEVRKTLRVPVPEPARVNEAAGRAPRSLERWIQRPENVMEVVFSKEGVI
FT                   PRESGEWRISVIKLPFLDWELNPEFDLRVLPKDAAAREFGVRMVSDALRFAPEGGLEKL
FT                   PPGFAGMDIWSYIDCELFIERLPDDDDGTAGGGARSRTAVCADIDLLIAADIPGVFRWI
FT                   PFFEGIGESAIAGSIESVGEFAQANVQAAYEEWVGAEEAATEPSGAPFGGINLAKREQR
FT                   AR"
     atggcctccg cggcgggtgc acccgcggcg ctcgcggcgc gcctaccgcg cgcgcgtggg        60
     tgccgcgggg cgaggagggg cgtccgccgc gtgcgcgtct cggcggaatc ccccgggggt       120
     cgggaggaac tttcgcgccc ctcgccgccc gagaaattca tgaggttcga ggttcgtaag       180
     accctgcggg tgccggtgcc ggagcccgcg cgcgtgaacg aagccgccgg gcgcgcgccg       240
     cgttcactcg agcgatggat tcaacgcccc gagaacgtca tggaggtggt gttcagcaaa       300
     gaaggggtca tcccgcggga gagcggcgag tggaggatct cggtcatcaa gctgccgttc       360
     ctcgactggg agctcaaccc cgagttcgac ctcagggtcc taccgaaaga cgccgccgcg       420
     cgggagttcg gcgtgcggat ggtgagcgat gccctgaggt tcgcccccga gggcggcctg       480
     gagaagcttc cgccggggtt cgcgggaatg gacatatgga gctacataga ctgcgagctc       540
     ttcatcgaga ggctgccgga tgacgacgac ggcacggctg gcggcggggc gaggtcgcgc       600
     acggcggtgt gcgcggacat cgatctgctc atcgcggcgg acatccccgg cgtgtttcga       660
     tggataccgt tcttcgaggg gatcggcgag agcgccatcg cgggcagcat cgagagcgtg       720
     ggagagtttg cgcaggccaa cgttcaggct gcgtacgagg aatgggtcgg cgcggaggag       780
     gcggcgacgg agccgagcgg ggcgccgttc ggggggatca acctcgcgaa gagggagcag       840
     agggccaggt ag                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page