(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE113

MICSR_1.PE113        Location/Qualifiers
FT   CDS_pept        join(complement(217131..217382),complement(215924..216913))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636118"
FT                   /orf_name="MICPUN_113699"
FT                   /product="Predicted protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="ACO62085.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG559990"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI000199A73C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z0"
FT                   /transl_table=1
FT                   /translation="MSHRAVVTAREAHARLTAARRYSGGSAGAILKSRHVAPAGRISGR
FT                   WGGVSHRRGSRRGPCLVVAKIWTDDGRRKAAEMMGLTAEEAADEKTLKRAFRRLALRYH
FT                   PDIAKDDAGVEKFHQIQEAYRVLSGADLAHVELPQDQEWDTHDWRWAHRYKGAANGVAG
FT                   VDPEQARRRMGEEERRARVGEQLRSMAGAPTRRKRRVIKPLSAQPSNVAVEFNSGTYDD
FT                   DGGGDECPSDGCASEWAQPARSSADTAGDTAGDEENSTKFAYNARAVRGYQSDRHSTET
FT                   AHERLNAQLAGLHRKKVIRARAMGIEFTESAQSANSGAGKTGRAEDPDAEARRQENKVW
FT                   AAKAARFYGGAGLQLEESTPERFLRLAKLAKEWRDQRSQNSFSQALFSSAEEKMSPKEL
FT                   LQSAVEGASLGACA"
     atgtctcacc gggcggtcgt gaccgcgcgc gaggcgcacg ctcgtctcac cgccgcgcga        60
     cgctactccg gcggctcggc gggagcgatt ctgaagagtc gacacgtcgc tccggccggt       120
     cggatctccg ggcgttgggg cggcgtcagt caccggcgag gatctcgccg cggaccttgt       180
     ctcgtcgtgg cgaagatctg gacggacgac ggaaggcgga aggcggcgga gatgatgggt       240
     ctgaccgcgg aggaggctgc ggacgagaag acgctcaagc gcgccttccg ccgcctcgcg       300
     ctccgctacc accccgacat cgccaaggac gacgcgggcg tcgaaaagtt tcaccagatc       360
     caggaggcgt accgagtgct ctccggcgcc gacctcgccc acgtcgagct cccacaggac       420
     caggagtggg acacccacga ctggagatgg gcgcacaggt acaagggcgc cgcgaacggc       480
     gtcgcgggag tcgaccccga gcaggcgcgg cgaaggatgg gcgaagaaga gaggagggct       540
     cgcgtgggcg agcagcttcg gtccatggcg ggcgcgccga cgcggcggaa acgtcgagtc       600
     atcaagccgc tgagcgcaca gccctcaaac gtggcggtgg agttcaactc cgggacgtac       660
     gacgacgacg gcggcggcga cgaatgccca tccgacggct gcgcgagcga gtgggcgcaa       720
     cccgcccggt cgtcggcgga cactgctggc gacacagctg gcgacgagga aaacagtacc       780
     aagttcgcgt acaacgctcg cgcggtccgc gggtaccaga gcgacaggca ctcgacggag       840
     acggcgcacg agcgcctcaa cgcgcagctc gcgggtttgc accgcaagaa ggtgattcgc       900
     gcgagggcga tgggtatcga atttaccgag tcggcgcagt cggcaaactc gggggcgggc       960
     aaaaccgggc gggcggagga tcccgacgcc gaggcgcggc ggcaggagaa taaggtgtgg      1020
     gccgcgaagg cggcgcggtt ctacggcggc gcgggtttac agctggagga gagcacgccg      1080
     gagaggtttc tgcgcctggc taaactggcg aaggagtggc gtgaccagcg aagccaaaac      1140
     tccttctcgc aggcgctctt ctcgagcgcg gaggagaaga tgtcgccgaa ggagctgctg      1200
     cagtcggcgg ttgagggggc gagcctggga gcgtgcgcgt ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page