(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE114

MICSR_1.PE114        Location/Qualifiers
FT   CDS_pept        217787..219739
FT                   /codon_start=1
FT                   /gene_family="HOG000186562" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636119"
FT                   /orf_name="MICPUN_56687"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61641.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG384096"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI000199A73D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z1"
FT                   /transl_table=1
FT                   /translation="MADEHKVRVPTRLRSPSSRLRRSRSCYPISRVGARSSSFHRLPTG
FT                   EIARSIRRCSVHSAAYPPDTDLAMIHRYVAAQALGNAAFSAGNYADAVKHFTDAIGVDA
FT                   ANHVFYSNRSAAYAALNDFDAALNDAEKTVAIKPDWVKGHSRKGAALYGLKRYDDACDA
FT                   YQKGLDLEPDNDACKSGLADAETAAVRAMGAAGDGGDPMASMGAMLSSPELYGKLATNP
FT                   ATRGFLSQPDFIAMLTDVQKNPDKFGSYLSDPRMMQVLSVALGINVMSGEDAMKNPDAM
FT                   FTNKGEPTVPNVTKTTPPPPPAPEPTPMAVEPEPEPEPAGPKAEAKKEKELGNAAYKAK
FT                   NFDVALEHYDKAIALDGEDISFITNKAAVYFEKGDFDSCVKACDDAVEKGRELRVDYKL
FT                   VGKAMTRKGNALVKLDRLEDAIEVYGKSLMEHRNADTLKRLNETERELKERTKKAYLDP
FT                   AKADEAREKGNELFKAQKYPEAVEQYTESIARNPDDHRVYSNRAACYTKLTAFNEALKD
FT                   AEKCIELKPDWAKGYTRKGHVEFFTKQYDKALETYQEGLKHDPNNEELKDGLYRTHVEI
FT                   RKASTGQVDEKELAERQQRAMADPEIQGILSDPVMRQVLNDMSTDPKAAQEHQKNPMVM
FT                   AKIQKLINAGIVQTR"
     atggccgacg aacacaaggt gcgcgtcccg acacgtctcc gttcgccgag ttcacgcctc        60
     cgccgctcgc gatcgtgcta cccgatctcg cgcgtcggcg cccgctcgtc ttccttccac       120
     cgccttccaa ctggcgagat cgcgcgttcg atccgacgat gttccgtcca ttccgcggcg       180
     tacccacccg acactgacct cgcgatgatc caccgatacg ttgctgcaca ggctctcggc       240
     aacgccgcgt tcagcgcggg caactacgcc gacgcggtga agcacttcac cgacgccatc       300
     ggggtggacg ccgccaatca cgtcttctac tcgaacaggt ccgccgcgta cgccgcgctc       360
     aacgacttcg acgccgccct gaacgacgcg gagaagaccg tcgcgatcaa acccgactgg       420
     gtcaagggtc actcgcgcaa gggcgcggcg ctgtacggcc tgaagcgcta cgacgacgcg       480
     tgcgacgcct accagaaggg cctggatctc gagcccgaca acgacgcgtg caagtcgggc       540
     ttggcggacg cggagacggc ggcggtgagg gcgatgggcg ccgcgggcga cggcggcgat       600
     cccatggcat ccatgggcgc catgctctcg tccccagagc tctacggcaa gctcgccacg       660
     aaccccgcca cgcgcggatt cctctcacag cccgacttca tcgccatgct caccgacgtg       720
     cagaagaatc cggacaagtt cggatcgtac ttgtcggacc ctcgcatgat gcaggttctc       780
     tccgtggcgc tggggatcaa cgtgatgtcc ggcgaggacg cgatgaagaa cccggacgcc       840
     atgttcacga acaaagggga gcccacggtt cccaacgtga ccaagacaac gccgcccccg       900
     ccgcccgcgc ccgagcccac gcccatggcg gtggaaccgg agccagagcc ggagcccgcc       960
     ggacccaagg ctgaggccaa gaaggagaag gagctgggta acgccgcgta caaggccaag      1020
     aacttcgacg tcgccctcga gcactacgac aaggccatcg cgttagacgg cgaggatatc      1080
     tcgttcatca ccaacaaagc cgcggtgtac tttgagaagg gcgacttcga cagctgcgtc      1140
     aaggcgtgcg acgacgccgt cgagaagggc cgcgagcttc gcgtggatta caagctcgtg      1200
     ggtaaggcga tgacccgcaa gggtaacgcg ctcgtgaagc tcgacaggct cgaggacgcc      1260
     atcgaggtgt acggcaagtc cctgatggag caccgcaacg cggacacgct caaacgcctc      1320
     aacgagactg agcgcgagct gaaggagcgg acaaagaaag cgtacctgga cccggcgaag      1380
     gctgacgagg cgagggagaa gggtaacgag ctgttcaagg cacagaagta tccggaggct      1440
     gtggagcagt acaccgagtc catcgcgaga aaccccgacg atcacagggt gtactctaac      1500
     cgagcggcgt gctacaccaa gctcacggcg ttcaacgagg cgctcaagga tgccgagaag      1560
     tgcatcgagc tcaaaccgga ctgggcgaag ggttacacgc gcaagggcca cgtcgagttc      1620
     ttcaccaagc agtacgacaa ggcgctcgag acgtaccagg agggcctcaa gcacgacccg      1680
     aacaacgagg agctgaagga tggcctctac aggacccacg tcgagattcg aaaggcgtcc      1740
     accgggcagg ttgacgagaa ggagctcgcg gagcggcagc agcgcgcgat ggcggacccg      1800
     gagattcagg gcatcctgtc cgatcccgtg atgcgacagg tgctcaacga catgagcacc      1860
     gacccgaagg cggcgcagga gcaccagaag aatccgatgg tgatggccaa gattcagaag      1920
     ctcatcaacg cgggcatcgt ccagacccgc tga                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page