(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE115

MICSR_1.PE115        Location/Qualifiers
FT   CDS_pept        complement(219822..220583)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636120"
FT                   /orf_name="MICPUN_56688"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62086.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A73E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z2"
FT                   /transl_table=1
FT                   /translation="MARGAGARLGAASPSARVAPPTSSSSSSSSSRQTSHRRVTTTRRH
FT                   APPRGASSASDAPIASWMESLADRLPPRFPDAPDTYWRGAGSPAGNPQVHGDDSILDLL
FT                   HASGAFHRPRLMVDEGGARQRVMLSLRTGTRTAGHPGWTHGGLTSLLMDETAGQAFAHF
FT                   VQPSRGLGVTANLTVDYASPLPTAKDLLVVAGVGKVDGRKVWIDVQVRDGPPRDDGGDD
FT                   EAEKHSCAGDDDDDGEVFARGSALFVVLAKD"
     atggcgcggg gcgcgggcgc gcggctcggc gcggcgtcgc cctccgcgcg cgtcgcgcct        60
     cccacatcat catcgtcgtc gtcgtcgtcg tcgcggcaga cgtcgcaccg gcgcgtgacg       120
     accacccggc gtcacgcgcc gcctcggggc gcgtcctccg cctcggacgc gcccatcgcg       180
     tcgtggatgg agtccctcgc cgaccgtctg cccccgcgct tcccggacgc ccccgacacg       240
     tactggcgcg gcgcgggttc acccgcgggc aacccccagg tgcacggcga cgattccatc       300
     ctcgatctgc tccacgcgtc gggcgcgttc caccgcccgc ggctgatggt ggacgagggc       360
     ggggcgcggc agcgcgtgat gctgtcgctt cgaacgggaa cgcgaaccgc gggccacccc       420
     ggatggaccc acgggggcct cacctcgctg ctcatggacg agaccgccgg gcaggcgttc       480
     gcgcactttg ttcaaccctc gcggggcctc ggggtcacgg cgaacctcac cgtcgactac       540
     gcgtcgccgc ttccgacggc gaaggatctc ctggtcgtgg cgggggtggg aaaggtggac       600
     ggacggaagg tttggatcga cgtgcaggtc cgggacggac ctccgaggga cgatggcgga       660
     gacgacgaag cggaaaaaca cagctgtgcg ggtgacgacg acgacgacgg ggaggtgttt       720
     gcgcggggat ccgccctgtt cgtcgtgctc gcgaaggact ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page