(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE116

MICSR_1.PE116        Location/Qualifiers
FT   CDS_pept        complement(<221452..222259)
FT                   /codon_start=1
FT                   /gene_family="HOG000217543" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636121"
FT                   /orf_name="MICPUN_79584"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62087.1"
FT                   /db_xref="HOGENOM:HBG443829"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI000199A73F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z3"
FT                   /transl_table=1
FT                   /translation="MQGIGRRDPGSKPGEAVLSCSFNQDRSCLAVATRRGFKIYSCDTG
FT                   TCVYDDSMGAVRIVEMLFCTSLLVVVGAGDTPELSPRRLKVLNTSNHTCIADLTFVSSV
FT                   LAVRLNRARLVVVEERRAVVHDLSTLCVQRTIDTVPNPRGVCALSHDEDSSLLALPAHT
FT                   HAGAVVIHDCVNLHVVCELQCHNSPLAACALTRDGAMLATASAKGTVIRVHCLPHGTKL
FT                   WSFRRGVVNANVRSLCFGAESTMDEPDPGAKLLAASSEKGTVHVWRI"
     atgcaaggca tcggcaggcg agatccgggc tccaagcccg gcgaggcggt gctgtcgtgc        60
     tcgttcaatc aggataggag ctgcctcgcg gtggcgaccc ggcgcgggtt caagatctac       120
     agctgcgaca ccggcacgtg cgtctacgac gacagcatgg gcgcggttcg catcgtcgag       180
     atgctcttct gcacctccct gctcgtcgtc gtcggcgcgg gcgatacccc cgagctgtcg       240
     ccccgcaggc tcaaggtgct gaacacctcc aaccacacct gcatcgccga cctcaccttc       300
     gtcagctcgg tcctcgccgt gcgcctcaac cgcgcgaggc tcgtcgtcgt cgaggagcgc       360
     cgcgcggtgg tccacgacct ctccaccctc tgcgtccagc gaaccatcga caccgtcccg       420
     aacccgcgcg gcgtctgcgc gctctcccac gacgaggact cctccctcct cgccctccca       480
     gcgcacaccc acgccggcgc cgtcgtgatt cacgactgcg tcaacctcca cgtcgtgtgc       540
     gaactccagt gccacaactc cccactcgcc gcctgcgcgc tgacccgcga cggcgccatg       600
     ctcgccacgg cgtccgcgaa aggtaccgtc atccgcgtgc actgcctccc gcacggcacg       660
     aagctctggt cctttcggcg gggggtcgtc aacgcaaacg ttcggtcgct gtgctttggc       720
     gcagagtcga cgatggacga accggacccg ggcgcgaagc tcctggcggc gagctccgag       780
     aaggggaccg tgcacgtgtg gcgcatag                                          808
//

If you have problems or comments...

PBIL Back to PBIL home page