(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE119

MICSR_1.PE119        Location/Qualifiers
FT   CDS_pept        complement(225348..228875)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636124"
FT                   /orf_name="MICPUN_56692"
FT                   /product="Predicted protein"
FT                   /biological_process="retrograde transport, endosome to
FT                   Golgi"
FT                   /protein_id="ACO62088.1"
FT                   /db_xref="GO:0042147"
FT                   /db_xref="InterPro:IPR012501"
FT                   /db_xref="UniParc:UPI000199A742"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z6"
FT                   /transl_table=1
FT                   /translation="MRSSRRGGGRRADHPFPLVPRDPENLDRDPETLKRQTAYLACALN
FT                   DPTELNALHAAQTSATPDASEVLNSLGQYLGVPGFEREPSSGGARGLSAEERPPPLAKG
FT                   VLPEVARGDHDAYLRKVAGWGAFTAANADRRARDAEDEADGRRRNAFDADDDAEHSCAT
FT                   SGIPSSNGEENERRDATDRWTLQRSSDLDRHAHEDVPAMYFDDSFDLSDPAVFRRAFCP
FT                   DDDDDDLNDTAGESSRTAVRASTSSSHPTAVRRSRALFGLAAQTRLGSYLDKIETSLVL
FT                   AIGSRSESFFEASARLHELDAFVSETCETIERTRRTLLDASTYAARARESVASLHSKRA
FT                   NLAALADAFEQLATVRECREDLDVLRRAGDWGGSLEACEDVRRAIASPSLPPGLRLLED
FT                   VAHHADVTERDVVDALVCEFVRAARVQPGSVGYVQHGGERGDDGGGDSPGGDSPGGDSP
FT                   GGGGSWSPATTRAALAAVRAAARDAGMEGVEDEEEDEDEEDAYETDTGLGPGETSAADV
FT                   RESLLPPLMALTRGATDRVSGGRIADAMRAWGRTAAADARACVRAACIACIAAVQPGGE
FT                   YAVAEPGGRNASPESFSGGGRDGIIQRAIGALPPSVFAVVVRAVTVALAGHFARADIVR
FT                   SAVRSALGTAPRRGDDDVGRGQKTKNDDEKNASGTPTDECARAACAALPAGERAAASAA
FT                   ASDAVLALTDAAQGAVARAIASLTKGCTLAEFSNVCDAADDFLERAERLGGGRRCLALR
FT                   ATLAAQCKDLFAARHAAFAAKLGVVLEAETWTAATPVPPEFQRVLDDVVSFAAAGREGN
FT                   EESGDASVTTNGDASSCASADALMFPNTGERVVPVGASLALLKMLRDHVASAARFPSLA
FT                   PTAVHKTAELLRVFNARTAALVLGAGAMRTAGLRSITAKHLALATESVRLFSLVTPLLS
FT                   AALAPALPQSRRRGLLADFDATVKDLATHKRELHAKTVGIMRDRLAHHSSRLPTIWCSR
FT                   VFTGRSRKAGSSVGWRERTEEDESKGESKEDAEARGPSEFATALGKEIGTLRRVIAGTL
FT                   CARDASAVLDEVLAHFDECATGTLREARRSVAKEWMAKMGDDSGEGSGSGDGAGAEGVA
FT                   EGGAEGGAEGGDDAEIASKAPPSDEEVRALIALDGAALLECLGTLVKGGEGGDGAVGAP
FT                   TLTRFLSEL"
     atgcgatcct cgcggcgcgg cggaggtcgc cgcgccgacc accccttccc tctggtccct        60
     cgcgaccccg agaatttgga ccgcgacccc gagacgctca agcggcagac cgcgtaccta       120
     gcctgcgcgc tcaacgaccc gaccgagctc aacgcgctcc acgcggcgca gacgtccgcc       180
     accccggacg cctcggaggt tctcaactcc ttgggtcagt acctgggcgt cccggggttc       240
     gaacgtgagc cgtcgagcgg cggcgcgcgg gggttgagcg cggaggagcg acccccgccg       300
     ctggccaaag gggtgctccc ggaggtggcg cggggcgatc acgatgcgta ccttcgcaag       360
     gtggcgggat ggggcgcgtt caccgcggcg aacgcggatc gacgcgcgcg agacgccgag       420
     gatgaagccg acggacggag gaggaacgca ttcgacgccg acgacgacgc cgaacacagc       480
     tgtgcgacgt ccggcatccc atcgtccaac ggagaagaaa acgagcgacg cgacgcgacc       540
     gatcgttgga ctctgcagcg atcatcggac ctcgaccgtc acgcccacga ggacgtcccg       600
     gcgatgtact tcgacgactc cttcgacctc tcggatccgg cggtgttccg ccgcgcgttt       660
     tgccccgacg acgacgacga cgatcttaac gacacagctg gcgagtcgtc gcgcacagct       720
     gtgcgagcgt cgacgtcgtc gtcgcatccg acagctgtgc gccggtcccg ggcgttattc       780
     gggttggccg cccaaacgcg cctgggctcg tacttagata agatcgagac gtcgctcgtg       840
     ctggcgatcg ggtcacggag cgagtcgttc ttcgaggcgt ccgctcgatt gcacgagctc       900
     gacgcgttcg tgtcggagac gtgcgagaca atcgagcgga cccgccgaac gcttctggac       960
     gcgtccacgt acgccgcgcg agcgcgggag tcggtcgcga gcctccacag caaacgcgcg      1020
     aacctcgcgg cgttagcgga cgcgttcgaa cagctcgcga cggtgcgcga gtgccgcgag      1080
     gatctcgacg tgttacgacg agcgggtgat tggggcggaa gtttagaggc gtgcgaggac      1140
     gttcgaagag cgatcgcgtc gccgtcgctt ccgcccgggc tgcgtttgct cgaggacgtc      1200
     gcgcatcacg cggacgtcac ggagcgcgat gtggtggacg cgctcgtgtg cgagtttgtt      1260
     cgcgcggcga gggtccagcc cgggtcggtg ggatacgtgc aacacggggg cgagaggggc      1320
     gatgacgggg gcggtgactc accgggcggt gactcaccgg gcggtgactc accgggcggc      1380
     ggcgggagtt ggtcgccggc gacgacgcgc gcggcgctcg cggcggtacg cgcggccgcg      1440
     agggacgccg gcatggaagg cgtcgaggac gaagaggagg acgaagacga agaggatgcg      1500
     tacgagacgg ataccggcct cggccccggc gaaacctccg cggcggatgt tcgcgagtcg      1560
     ctgcttcccc cgttgatggc gctcacccgc ggcgcgacgg accgtgtaag tggcggtcgg      1620
     atcgccgacg ccatgcgcgc ttggggccga acggcggcgg cggacgcgcg cgcgtgcgtt      1680
     cgagcggcgt gcatcgcgtg catcgcggct gtccaaccgg gcggggagta cgccgtcgcg      1740
     gagcccggcg ggcgtaacgc gagccccgag tctttctcgg gcggcggtcg cgacgggatc      1800
     atccagcgcg ccatcggggc actcccgccc agcgttttcg cggtcgtcgt gcgcgcggtg      1860
     acggtggcgt tggcggggca cttcgcgcgc gccgatatcg tccgttccgc ggtgcgcagc      1920
     gcgctcggca cggcgccgcg ccggggcgac gacgacgtcg gccgcggaca aaaaacaaaa      1980
     aacgacgacg aaaaaaacgc atccggaact ccaaccgacg agtgcgcgag ggccgcgtgc      2040
     gccgctttac cggccggcga acgcgcggcg gcgtccgcgg cggcgtccga cgcggtgctc      2100
     gcgctgacgg acgccgcgca gggcgccgtg gcgagggcga tcgcgtctct aacgaaaggt      2160
     tgcaccctcg ccgaattttc aaacgtgtgc gacgccgcgg atgacttttt ggaacgcgcg      2220
     gaacggctcg gcggcgggag acggtgcctc gccctgcgcg ccacgctcgc ggcgcagtgc      2280
     aaggacctct tcgcggcgag gcacgcggcg ttcgcggcca agctcggggt ggttttggag      2340
     gcggagacgt ggacggcagc gactccggtg ccgcccgaat tccaacgcgt cctcgacgac      2400
     gtggtatcgt tcgccgcggc gggtcgcgag gggaacgagg agagcggtga cgcgtcggtg      2460
     acgacgaacg gtgacgcgtc atcatgcgcg agcgcagacg cgctcatgtt tccaaacacc      2520
     ggcgagcgcg tcgttcccgt cggagcgtcg ctcgcgctgc tgaagatgct tcgcgaccac      2580
     gtcgcgtccg cggctcggtt cccctcgctc gcgccgacgg cggtgcacaa gacggcggag      2640
     ttgctccggg tgttcaacgc ccgaacggcg gcgctggtgc tcggggcggg ggcgatgcga      2700
     accgcggggt tgaggtccat aaccgcgaag catctcgcgc tcgcgacgga gagcgtgcgt      2760
     ttgttttcgc tggtgacgcc gctcttgtcc gcggctctcg cgccggcgct accgcagtcg      2820
     aggcgccgcg ggttactcgc cgacttcgac gcgaccgtta aagacctcgc gacgcataaa      2880
     agggagctgc acgccaagac ggtgggaatc atgcgggacc ggttggcgca ccactcgtcg      2940
     cggttaccca cgatttggtg ctcgagggtc ttcaccgggc gctcgagaaa agccgggtcg      3000
     agtgttggtt ggagagaaag aacggaggag gacgagagta agggggagag taaggaggac      3060
     gccgaggcgc gaggcccgtc ggagttcgcg acggcgctgg gcaaggagat cgggacgctc      3120
     cgacgcgtca tcgccgggac gctgtgcgcg agagacgcgt ccgcggtgtt ggacgaggtc      3180
     ctcgcgcatt tcgacgagtg cgccacgggg acgcttcgcg aggcgagacg ttcggtggcg      3240
     aaggagtgga tggccaagat gggggatgat agcggtgagg ggagcggatc cggggacggt      3300
     gcgggtgccg agggggttgc cgaggggggt gccgaggggg gtgccgaggg gggcgacgac      3360
     gcggagattg cgtcgaaggc gccgccgagc gacgaggagg tgcgcgcgtt gattgcgctc      3420
     gacggcgccg cgctgttgga gtgtctcggg acgctcgtga agggcggcga gggcggggac      3480
     ggcgcggttg gggcgcccac gctgacgagg tttctgtcgg agctttag                   3528
//

If you have problems or comments...

PBIL Back to PBIL home page