(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE12

MICSR_1.PE12         Location/Qualifiers
FT   CDS_pept        24318..26423
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636017"
FT                   /orf_name="MICPUN_56583"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61590.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199AA53"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N9"
FT                   /transl_table=1
FT                   /translation="MRAAAKTLAHAFTSSRWVAKRSQRVHNIVRATSSTTAPSPLLRRN
FT                   PRERPADGPTYSFDLGSARVAQLRFLAFHGCGTRYTVLYRECDKVEEQPKGGVGRRGRN
FT                   RAAKEVSDDIGFDAGELESTGEGDGPGWRVRLANSQEITLNALKEITPRDMALAALFDD
FT                   DLGDARLYRRGEERWLASTAAPKWPEELLASLDERGVGVHGANAVTCVDGSYFLELMEL
FT                   SAFPTPVIFPHGAWRLPGVGPTVQGNFRNLASAAIGVDAIDALSAIVNNGAGPDAIGRL
FT                   TGELPGRGRIQLGVDGGRAGVGSAHAAVTENEVTVTFAEGSLGLGFAPLDWERQFGAQV
FT                   WDVDDDSAAAEAGVVPGMVFTHIRGESVDGWTFSEIDREFDGPRPLEVKFNTKVPGAER
FT                   LYAVEMIAEEVTEALLRRKDPEMETFDFEEPGAVFEESTAAVIWREEPSTIFFGDAGST
FT                   TVVHHDIIGQVELCHVLSGSKLLAAAPWGKSSEELLRKAGARGLLSDGKDDGEAEEGVV
FT                   LSAPVHRSLTSDEIALLKHDDLAVVLARPGDCVAFSSICAHFATNGANEPCAAVFHGIL
FT                   TPASTHVLASHPERLDPFSDEEIDEDGFDGHLTGRAVLEELIPAGKDVITDYSAVDKID
FT                   SAMAKESGEKGWRMNRKMRGKAGDAAVKRRFAEAVLNMDSARDVSKAPKMWTGTSRTVF
FT                   YVEPVIK"
     atgagggcag ccgccaagac gctcgcacat gcatttacta gctcgcgttg ggtcgccaag        60
     cgctcacaac gcgtgcacaa catagtccgg gcgacttcat cgacgaccgc cccttcaccc       120
     cttcttcgtc gaaacccacg cgaaagacca gccgatggac ctacatacag cttcgacctc       180
     ggttctgcaa gggtcgcgca gctccgcttc ctcgcttttc acggctgcgg tacgaggtat       240
     acggtgctgt atcgcgaatg cgacaaagtc gaggagcaac cgaagggtgg tgtcgggcga       300
     agagggcgga accgtgcggc gaaagaggtg agcgacgaca tcggctttga cgccggtgaa       360
     ctcgagtcca cgggagaggg agatgggccg ggttggcgtg tgcgcctcgc gaactcgcaa       420
     gaaatcactc ttaatgcgct caaggagata acacctcgag atatggccct cgcggcgctc       480
     ttcgatgacg accttggcga tgcgcgtcta taccgaagag gcgaggaaag atggctcgca       540
     tcgacggctg caccaaagtg gccagaagaa ctcctcgcct ccctggacga gcgcggcgta       600
     ggcgtgcacg gtgctaacgc ggtgacatgc gtggacgggt cgtacttcct ggagctcatg       660
     gagctgagcg cgttccccac accggtgatt ttcccccacg gggcatggcg gctcccgggt       720
     gtcggtccaa ctgtccaagg caacttccga aaccttgcct cagccgccat cggagtggac       780
     gcgatagacg ctctcagtgc gatcgtaaat aacggtgcgg gacccgacgc gatcggtcga       840
     ctcactggcg agctgccggg caggggacgc atccagcttg gggtagatgg gggaagagca       900
     ggcgttgggt ctgcgcatgc cgcggttacg gaaaatgagg tcaccgtgac attcgctgag       960
     gggtccctgg gtctcggctt cgctcctttg gactgggagc gacagtttgg tgcgcaagtg      1020
     tgggatgtcg atgatgattc ggccgcagcg gaggctggcg tggtgcctgg catggtgttc      1080
     acgcacatcc gaggagaaag cgtggatggt tggacattca gtgagatcga cagagaattt      1140
     gacgggccga ggccgctgga agtaaagttc aacaccaaag tgcccggagc ggagaggctt      1200
     tacgcggtgg agatgatcgc ggaggaggtg accgaggcgt tgttacggcg gaaagatccg      1260
     gagatggaaa ctttcgattt cgaggagcct ggagctgtgt ttgaggaatc gaccgctgcc      1320
     gttatttggc gggaggaacc ttccacgata tttttcggtg acgccgggtc caccaccgtg      1380
     gttcaccacg acatcattgg tcaggtcgag ctctgtcacg tgctctcggg atccaaactt      1440
     ctggctgctg caccatgggg aaaatcgagt gaggagctgt tgcgcaaggc aggcgcacgg      1500
     ggtttgttgt cagatggtaa agacgatggc gaagcagagg aaggcgttgt tttgagcgca      1560
     ccggtgcata ggtctctcac ctctgatgag attgcgctct tgaagcacga tgatctcgcc      1620
     gtggtactcg caaggccggg tgactgcgtc gctttctcat ccatttgtgc gcactttgcg      1680
     acaaacggag caaacgagcc ttgcgcagct gtcttccatg gcatcttaac cccagcttct      1740
     acgcacgtgc tcgcgtcgca tccagagcga ctcgatcctt tttcagacga ggagattgac      1800
     gaggatggct tcgacgggca cctgacgggt agagccgtgc ttgaggagct tattccagcc      1860
     ggcaaggatg tcatcaccga ttattccgcg gtggacaaga ttgacagcgc gatggcaaag      1920
     gagagcgggg agaagggatg gaggatgaac cgaaagatgc gggggaaggc tggtgatgcg      1980
     gcggtgaagc gaaggtttgc cgaggctgtc ctgaacatgg attcagctcg tgatgtgagc      2040
     aaagctccaa aaatgtggac cggcacttcc aggactgtct tctatgtaga acctgttatc      2100
     aaatag                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page