(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE120

MICSR_1.PE120        Location/Qualifiers
FT   CDS_pept        <229247..>230182
FT                   /codon_start=1
FT                   /gene_family="HOG000171086" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636125"
FT                   /orf_name="MICPUN_68058"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61644.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG736998"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199A743"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z7"
FT                   /transl_table=1
FT                   /translation="IRDPEADGWERTDFPIVCEDCLGPNPYIRMQREDYAAECAISSRP
FT                   FTVFRWRPGNEARYKKTVVCREIALAKNVCQVCLLDLDYGIPVQARDAVLGKEREMIAK
FT                   SDVNLEYQTEQIARRLEEGDEVAIRDQNRAVGKVRAAELLQKMARKKPYYNKNKAPICT
FT                   FWLRNACTRADCPYRPCNGDTHMPELTSAPELRQQNIKDRYYGINDPVANRMLAKANES
FT                   KQDLAPPADESITTLYVGGIDDRVTEDALKDAFYQYGQISSVRTLYAKNCAFVTFVDRA
FT                   GAEKAAEECGSRKAISGINARIMWGKSKKEK"
     attcgggacc ccgaagcgga cgggtgggag cgcaccgact ttcccatcgt gtgcgaggac        60
     tgcctcgggc ccaacccgta cattcgcatg cagcgcgagg actacgccgc cgagtgcgcc       120
     atctcctccc gccccttcac cgtcttccga tggcgacccg ggaacgaggc caggtacaag       180
     aaaaccgtgg tgtgccgcga gatcgcgctc gcgaagaacg tgtgccaggt gtgcctcctc       240
     gacctcgact acggcatccc ggtgcaggcg cgagacgcgg tcctcggcaa ggaacgcgag       300
     atgatcgcca agtccgacgt caacctcgag taccagacgg agcagatcgc ccggcgcctg       360
     gaggagggcg acgaggtggc catcagagac cagaatcgag ccgtcggcaa ggttcgcgcc       420
     gccgagctgc tccagaagat ggcgcgaaag aagccctact acaacaagaa caaggcgccc       480
     atctgcacgt tctggctgcg caacgcgtgc acccgcgcgg actgccccta ccgcccgtgc       540
     aacggcgaca cgcacatgcc ggagctcacg tccgcgcccg agctccgaca gcagaacatc       600
     aaggacaggt actacggcat caacgacccg gtggccaaca ggatgctcgc caaggcgaac       660
     gagagcaagc aggacctcgc gccccctgcc gacgagtcca tcacgaccct ctacgtgggc       720
     ggcatagacg acagggtgac cgaggatgcg ctgaaggatg cgttttatca gtacgggcaa       780
     atctccagcg tgaggactct gtacgccaag aactgcgcgt tcgtgacgtt tgtggaccgc       840
     gccggggcgg agaaggcggc ggaggagtgc ggcagcagga aggccatcag cggcatcaac       900
     gcgaggatca tgtggggcaa gagcaagaag gagaag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page