(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE121

MICSR_1.PE121        Location/Qualifiers
FT   CDS_pept        complement(230582..231181)
FT                   /codon_start=1
FT                   /gene_family="HOG000100021" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636126"
FT                   /orf_name="MICPUN_107872"
FT                   /product="Predicted protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="ACO62089.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG559996"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="UniParc:UPI000199A744"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z8"
FT                   /transl_table=1
FT                   /translation="MGFMFAPRYHPAMKAVVPVRKALKVRTAFNMLGPMLNPAGTQYAL
FT                   VGVYTPDLQPLMADSLMALGMKKALVVCSTVGDLSLDEMTPCGPTSVVEVTPAGTKSYS
FT                   FDPKDVGIPPCELKDLAGGDAKLNARMLTDALGGEKGPVADCLMLNAGVAMAAAAQAES
FT                   VEEGVAMCKEAHAQGKAGDTLRSWIELSQELKLQEA"
     atgggcttca tgttcgcgcc gaggtaccac ccggcgatga aagccgtcgt cccggttcga        60
     aaggcgctca aggttcgcac cgctttcaac atgctcggac cgatgctcaa ccccgcgggg       120
     acccagtacg ccctcgtggg cgtgtacacc cccgacctcc agcccttgat ggcggactcg       180
     ctcatggcgc tcggcatgaa gaaggcgctg gtggtgtgct ccacggttgg cgatttatcg       240
     ctggacgaga tgacgccgtg cggaccgacg agcgtcgtgg aggtgacccc ggcgggaacc       300
     aagtcgtact cgttcgaccc caaggacgtc ggcatcccgc cgtgcgagct gaaggatctc       360
     gcgggcggcg acgcgaagct caacgcgcgg atgctgacgg acgcgctcgg cggcgagaag       420
     gggccggtgg cggattgcct catgctcaac gcgggtgtcg cgatggcggc ggcggcgcag       480
     gcagagagcg tggaggaggg cgtggcgatg tgcaaggagg cgcacgctca gggtaaggcg       540
     ggcgacacgc ttcggtcgtg gatcgagctc tcccaggagc tcaagcttca ggaggcgtga       600
//

If you have problems or comments...

PBIL Back to PBIL home page