(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE122

MICSR_1.PE122        Location/Qualifiers
FT   CDS_pept        232035..232694
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636127"
FT                   /orf_name="MICPUN_56695"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61645.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199A745"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z9"
FT                   /transl_table=1
FT                   /translation="MSTIWRPDLLSGDHIVVKEESDDDHQPPAVDVEPPADDHEEDEKS
FT                   EDLAGKMSTIWRPNLSRLYASVAEMEGSESEEEEKDATKKGVKRKRAPPTKGPCEHGVK
FT                   PRSKCKVCSACPHGKWRRFCKECGGASICQHGRQRSKCKECGGGSICEHSRERSQCKEC
FT                   GGASICVHGRQRSQCKECGGASICEHGRRRSECTECGGASICEHGRRRYRCKECKK"
     atgagcacca tctggcgccc agacttgttg agcggagatc acatcgtcgt caaggaagag        60
     tccgacgacg accaccagcc ccccgccgtc gacgtcgaac ctcccgcgga cgaccacgag       120
     gaagacgaaa agtccgagga tctcgcgggg aagatgtcga cgatttggcg acctaacctc       180
     agccggctgt acgccagcgt cgccgagatg gagggatcgg agagcgaaga ggaggagaag       240
     gatgcgacga agaagggcgt gaagcggaag agagcccctc ccacgaaggg gccatgcgag       300
     cacggggtga agcctcgctc gaaatgcaag gtgtgcagcg cttgtcccca cgggaagtgg       360
     cgccgttttt gcaaggagtg cggcggggca tcaatctgcc agcacggccg tcagcgctct       420
     aagtgcaagg agtgcggcgg gggctcaatc tgcgagcaca gtcgtgagcg ctctcagtgc       480
     aaggagtgtg gcggagcatc aatctgcgtg cacggccgtc agcgctctca gtgcaaggag       540
     tgcggcgggg catcaatctg cgagcacggt cgtaggcgct ctgagtgcac ggagtgcggc       600
     ggggcatcaa tctgcgagca cggtcgtcgg cgctacaggt gcaaggagtg caagaaatag       660
//

If you have problems or comments...

PBIL Back to PBIL home page