(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE123

MICSR_1.PE123        Location/Qualifiers
FT   CDS_pept        complement(232735..233526)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636128"
FT                   /orf_name="MICPUN_99299"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62090.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A746"
FT                   /db_xref="UniProtKB/TrEMBL:C1E100"
FT                   /transl_table=1
FT                   /translation="MHCAARAGHLDCVRALGADRERGCDVNARDDHWGTPLHAAVGEGH
FT                   VAIVDWLLANAGADVDAADRDMCTPLHESVRWADARVTAILLARGASPAKRTKRGLTPL
FT                   HVAVAGFGATSRASAAAASALSLHGFVGDGARSDSKRILRLRRGGQVEDGDWYDLRADQ
FT                   ARRDDIVDALLASGACDVDARCFEGGSTPLYLAARWGHAEWVKKLIDAGADVDAARERP
FT                   DPGLGGSVVGPGGPTPLQAARAVGHSECVAVLLEHGAAEAA"
     atgcactgcg cggctcgagc cgggcacctg gactgcgtcc gagcacttgg cgccgatcgt        60
     gaacgcgggt gcgacgtgaa cgctagggac gatcactggg ggacgccgct gcacgcggcg       120
     gtgggtgagg gccacgtggc gatcgtcgat tggcttctcg cgaacgcggg cgccgacgtc       180
     gacgcggcgg atcgcgacat gtgcacgccg ctgcacgagt cggtgcgttg ggcggacgcg       240
     agggtgacgg cgattttgtt ggcgcgtggg gcgtcgcccg cgaaacgcac caaacggggc       300
     ctcacgccgt tgcacgtggc ggtggcgggg ttcggggcga cgtcgcgcgc atccgccgcc       360
     gcggcgtccg ctctctcgct gcacgggttc gtcggcgatg gtgcacgatc ggattctaaa       420
     cgaatcttgc gactgcgacg gggcgggcag gttgaggatg gcgattggta cgaccttcgc       480
     gcggaccagg cgcgtcggga cgatatcgtc gacgcgctcc tcgcgagcgg cgcgtgcgac       540
     gtggacgcgc ggtgcttcga ggggggaagc acgccgctgt acctggcggc tcgatggggg       600
     cacgcggagt gggtgaaaaa gttgatcgac gcgggcgcgg atgtcgacgc cgcgcgtgag       660
     cgaccggatc cgggtctggg cgggagcgtg gtgggtccgg gcgggccgac gccgttgcag       720
     gcggcgcggg cggtggggca tagcgagtgc gtggcggttt tgttggagca cggggcggcg       780
     gaggcggcgt ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page